F468076

General Info

Members Datasets Scaffolds Average Seq Length
601 276 1202 529

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0000062|Ga0395899_0000062_103310_105136
Length 608
Sequence MVDTSRRNAFKLLAAGAAAAPFALKAMPSNACTEKPPAWAHGPESQRKADLGNGTYLNPIVAGDHPDPTILKDGSDYYMTFTSFDAYPGIVIWHSTDLLNWSPIAAALSKPIGTVFAVDLCKHNGRYFIYIPAAPQGQPWSIYVIWADDIHGPWSDPIDLKIPGCIDPGHVVGEDGKRYLFVNGIRKIRLADNGLATDGALEPAYSPWRYPDDWVVEDFAPEGPKLLRHGEWFYLITAVGGTAGPPTSHMVIAARSKSIHGPWEHCPHNPLVRTTSAAEPWWSRGHASLVEGPAGDWWMVYHGYENGFRTLGRQTLLEPIEWTADGWFRAKGGDLSRPLPAPKDGKRSASGFALSDDFTRNKFGVQWSLFQPAPGDMQRVQHEKGALLLAAKGQSPADSSPLTCLVGDRSYVAEVTLDLLDDAEGGVLLFYNHKAFVGVGFTPQHMKTFEYADELAWMQQAMPTSSVRIRLTNDNNVVTWHYSHDGGKTWVLHGLRMEVSGMHHNVFGGFLSLKVGIYSANKGSIRIRDFTYRAISYRRLGCKPQHRHLEADHDVGVCTPTYAFCISPNSWPIPTVCWTTLALLTSRIKPYLFTSSSTPDKSWIEECK

Samples

Sample ID Description Type Environment
1 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
9 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
10 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
11 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
12 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
13 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
14 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
15 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
16 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
17 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
18 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
19 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
20 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
21 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
22 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
23 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
24 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
25 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
26 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
27 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
28 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
29 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
30 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
31 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
32 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
33 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
34 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
35 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
36 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
37 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
42 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
69 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
70 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
71 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
72 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
76 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
77 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
79 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
80 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
81 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
84 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
85 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
86 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
90 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
92 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
120 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
121 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
122 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
123 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
124 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
125 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
126 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
127 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
128 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
129 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
130 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
131 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
132 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
133 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
134 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
135 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
136 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
137 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
138 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
139 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
140 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
141 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
142 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
143 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
144 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
145 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
146 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
147 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
148 3300044661 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COC2E Metagenome Unclassified
149 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
150 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
151 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
152 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
153 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
154 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
155 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
156 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
157 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
158 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
159 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
160 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
161 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
162 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
163 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
164 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
165 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
166 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
167 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
168 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
169 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
170 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
171 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
172 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
173 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
174 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
175 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
176 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
177 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
178 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
179 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
180 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
181 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
182 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
183 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
184 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
185 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
186 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
187 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
188 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
189 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
190 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
191 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
192 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
193 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
194 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
195 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
196 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
197 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
198 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
199 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
200 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
201 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
202 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
203 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
204 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
205 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
206 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
207 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
208 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
209 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
210 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
211 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
212 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
213 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
214 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
215 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
216 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
217 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
218 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
219 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
220 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
221 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
222 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
223 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
224 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
225 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
226 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
227 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
228 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
229 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
230 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
231 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
233 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
234 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
235 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
236 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
237 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
238 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
239 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
240 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
241 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
242 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
243 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
244 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
245 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
246 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
247 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
248 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
249 2643221556 Massilia sp. Root1485 Isolate Unclassified
250 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
251 2643221584 Caulobacter sp. Root656 Isolate Unclassified
252 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
253 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
254 2643221684 Massilia sp. Root133 Isolate Unclassified
255 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
256 2738541297 Duganella sp. GV083 Isolate Unclassified
257 2738541337 Pelomonas sp. BT06 Isolate Unclassified
258 2738541357 Duganella sp. GV053 Isolate Unclassified
259 2738543003 Duganella sp. GV066 Isolate Unclassified
260 2738543026 Duganella sp. GV089 Isolate Unclassified
261 2738543029 Duganella sp. GV039 Isolate Unclassified
262 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
263 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
264 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
265 2849560528 Caulobacter zeae 410 Isolate Unclassified
266 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
267 2851153111 Caulobacter radicis 736 Isolate Unclassified
268 2857553236 Duganella sp. R-74557 Isolate Unclassified
269 2857564685 Duganella sp. R-74599 Isolate Unclassified
270 2884411467 Dyella sp. AD56 Isolate Rhizosphere
271 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
272 2904424332 Duganella sp. 1411 Isolate Rhizosphere
273 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
274 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
275 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
276 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.84
Metatranscriptomes 0
Isolates 5.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.14
Nodule 0.17
Rhizoplane 1.5
Rhizosphere 66.56
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395899_0000062 3300037312 Bacteria 211388
2 JGI24736J21556_1005228 3300001904 Bacteria 2195
3 JGI24740J21852_10006551 3300001979 Bacteria 4809
4 JGI24739J22299_10000764 3300001989 Bacteria 11711
5 JGI24739J22299_10010483 3300001989 Bacteria 3442
6 JGI24737J22298_10000146 3300001990 Bacteria 21962
7 JGI24737J22298_10001103 3300001990 Bacteria 9494
8 JGI24737J22298_10012744 3300001990 Bacteria 2741
9 JGI24735J21928_10001534 3300002067 Bacteria 8186
10 JGI24735J21928_10002142 3300002067 Bacteria 6951
11 JGI24735J21928_10024486 3300002067 Bacteria 1826
12 JGI24738J21930_10000047 3300002075 Bacteria 24272
13 JGI24738J21930_10007731 3300002075 Bacteria 2468
14 JGI25156J39149_1000026 3300002705 Bacteria 132099
15 JGI25156J39149_1004036 3300002705 Bacteria 4606
16 JGI25162J39368_1000625 3300002737 Bacteria 25160
17 JGI25157J39369_1000008 3300002741 Bacteria 211083
18 JGI25157J39369_1000967 3300002741 Bacteria 13425
19 JGI25157J39369_1001103 3300002741 Bacteria 12041
20 JGI25157J39369_1001587 3300002741 Bacteria 8009
21 JGI25164J39214_1000048 3300002772 Bacteria 124152
22 JGI25152J39213_1000004 3300002773 Bacteria 191383
23 JGI25152J39213_1000188 3300002773 Bacteria 41653
24 JGI25150J39212_1000438 3300002774 Bacteria 18640
25 JGI25151J46595_10000010 3300003187 Bacteria 277507
26 JGI25165J46597_1000096 3300003214 Bacteria 161294
27 JGI25165J46597_1000566 3300003214 Bacteria 33479
28 JGI25153J46596_10000013 3300003215 Bacteria 303690
29 rootH1_10001460 3300003316 Bacteria 3532
30 rootH1_10006701 3300003316 Bacteria 17835
31 rootH1_10022300 3300003316 Bacteria 6866
32 rootH2_10005870 3300003320 Bacteria 8032
33 rootL2_10006538 3300003322 Bacteria 28705
34 rootL2_10049842 3300003322 Bacteria 8128
35 rootL2_10061224 3300003322 Bacteria 2913
36 rootH1_10006711 3300003323 Bacteria 14816
37 rootH1_10031104 3300003323 Bacteria 3036
38 rootH1_10039315 3300003323 Bacteria 11336
39 rootH1_10044261 3300003323 Bacteria 2599
40 rootH1_10044262 3300003323 Bacteria 6958
41 rootH1_10180860 3300003323 Bacteria 1889
42 rootH1_10293050 3300003323 Bacteria 2273
43 Ga0055539_1000042 3300003752 Bacteria 199725
44 Ga0055539_1000855 3300003752 Bacteria 7110
45 Ga0055533_1000006 3300003756 Bacteria 635559
46 Ga0055533_1001601 3300003756 Bacteria 5849
47 Ga0055525_1000001 3300003759 Bacteria 1016948
48 Ga0055525_1000120 3300003759 Bacteria 119424
49 Ga0055525_1000940 3300003759 Bacteria 8143
50 Ga0055527_1000058 3300003760 Bacteria 95779
51 Ga0055527_1000107 3300003760 Bacteria 59466
52 Ga0055535_1000325 3300003761 Bacteria 48256
53 Ga0055535_1000823 3300003761 Bacteria 22266
54 Ga0055535_1000983 3300003761 Bacteria 18526
55 Ga0055542_1000149 3300003762 Bacteria 88186
56 Ga0055542_1000260 3300003762 Bacteria 59466
57 Ga0055542_1000384 3300003762 Bacteria 45090
58 Ga0055542_1000486 3300003762 Bacteria 36933
59 Ga0055529_1000049 3300003763 Bacteria 208413
60 Ga0055529_1000289 3300003763 Bacteria 59423
61 Ga0055529_1000374 3300003763 Bacteria 48348
62 Ga0055526_1000095 3300003771 Bacteria 80903
63 Ga0055524_1000157 3300003775 Bacteria 79002
64 Ga0055531_10000025 3300003794 Bacteria 161475
65 Ga0055531_10005331 3300003794 Bacteria 7545
66 Ga0055531_10006800 3300003794 Bacteria 6384
67 Ga0065704_10070370 3300005289 Bacteria 28970
68 Ga0070658_10003827 3300005327 Bacteria 12334
69 Ga0070658_10019464 3300005327 Bacteria 5435
70 Ga0070690_100000894 3300005330 Bacteria 15204
71 Ga0070670_100061379 3300005331 Bacteria 3227
72 Ga0068869_100049393 3300005334 Bacteria 3045
73 Ga0070666_10000008 3300005335 Bacteria 293415
74 Ga0070682_100023656 3300005337 Bacteria 3649
75 Ga0070673_100081336 3300005364 Bacteria 2627
76 Ga0070659_100008751 3300005366 Bacteria 7409
77 Ga0070659_100122196 3300005366 Bacteria 2110
78 Ga0070667_100020773 3300005367 Bacteria 5454
79 Ga0070714_100002914 3300005435 Bacteria 12654
80 Ga0070713_100003831 3300005436 Bacteria 9962
81 Ga0070663_100001297 3300005455 Bacteria 13684
82 Ga0070663_100005219 3300005455 Bacteria 7693
83 Ga0070662_100035349 3300005457 Bacteria 3528
84 Ga0068853_100005512 3300005539 Bacteria 9922
85 Ga0068853_100049139 3300005539 Bacteria 3624
86 Ga0068853_100157940 3300005539 Bacteria 2044
87 Ga0070665_100033848 3300005548 Bacteria 5140
88 Ga0070665_100143704 3300005548 Bacteria 2389
89 Ga0068855_100002022 3300005563 Bacteria 25159
90 Ga0068855_100003008 3300005563 Bacteria 20620
91 Ga0068855_100008710 3300005563 Bacteria 12265
92 Ga0068855_100062580 3300005563 Bacteria 4344
93 Ga0068857_100004277 3300005577 Bacteria 12041
94 Ga0068857_100010583 3300005577 Bacteria 8020
95 Ga0068854_100000144 3300005578 Bacteria 49698
96 Ga0068854_100001017 3300005578 Bacteria 16836
97 Ga0068854_100009849 3300005578 Bacteria 6181
98 Ga0068854_100087744 3300005578 Bacteria 2308
99 Ga0068856_100000012 3300005614 Bacteria 166032
100 Ga0068856_100003732 3300005614 Bacteria 15269
101 Ga0068856_100003862 3300005614 Bacteria 15037
102 Ga0068858_100000499 3300005842 Bacteria 41087
103 Ga0075364_10000300 3300006051 Bacteria 24079
104 Ga0075366_10034839 3300006195 Bacteria 2967
105 Ga0097621_100019160 3300006237 Bacteria 5246
106 Ga0105244_10000158 3300009036 Bacteria 70253
107 Ga0105244_10001449 3300009036 Bacteria 19209
108 Ga0105240_10000049 3300009093 Bacteria 236718
109 Ga0105240_10003394 3300009093 Bacteria 24772
110 Ga0105240_10004407 3300009093 Bacteria 21472
111 Ga0105240_10018464 3300009093 Bacteria 9364
112 Ga0105240_10072508 3300009093 Bacteria 4256
113 Ga0105240_10123731 3300009093 Bacteria 3111
114 Ga0105242_10004609 3300009176 Bacteria 10686
115 Ga0105237_10000630 3300009545 Bacteria 49242
116 Ga0105237_10010419 3300009545 Bacteria 9890
117 Ga0105238_10000335 3300009551 Bacteria 51399
118 Ga0105238_10034728 3300009551 Bacteria 5129
119 Ga0105238_10037554 3300009551 Bacteria 4923
120 Ga0105239_10000070 3300010375 Bacteria 144044
121 Ga0105239_10036352 3300010375 Bacteria 5408
122 Ga0157319_1000005 3300012497 Bacteria 372810
123 Ga0157373_10003230 3300013100 Bacteria 12323
124 Ga0157371_10000856 3300013102 Bacteria 34784
125 Ga0157370_10000140 3300013104 Bacteria 87498
126 Ga0157370_10036932 3300013104 Bacteria 4738
127 Ga0157369_10007582 3300013105 Bacteria 12488
128 Ga0157369_10020993 3300013105 Bacteria 7302
129 Ga0157369_10048674 3300013105 Bacteria 4599
130 Ga0157369_10097340 3300013105 Bacteria 3139
131 Ga0157374_10027500 3300013296 Bacteria 5133
132 Ga0163162_10012837 3300013306 Bacteria 8182
133 Ga0182008_10000798 3300014497 Bacteria 22043
134 Ga0182008_10020044 3300014497 Bacteria 3446
135 Ga0182006_1000040 3300015261 Bacteria 209209
136 Ga0182006_1001734 3300015261 Bacteria 12660
137 Ga0182005_1000051 3300015265 Bacteria 114808
138 Ga0213872_10000083 3300021361 Bacteria 87967
139 Ga0209674_100003 3300025226 Bacteria 2196646
140 Ga0209674_100394 3300025226 Bacteria 22429
141 Ga0209672_100009 3300025228 Bacteria 883623
142 Ga0209672_100024 3300025228 Bacteria 367869
143 Ga0209672_100133 3300025228 Bacteria 73558
144 Ga0209672_101393 3300025228 Bacteria 8938
145 Ga0209563_100007 3300025230 Bacteria 1579402
146 Ga0209563_100010 3300025230 Bacteria 1337457
147 Ga0209563_100067 3300025230 Bacteria 256096
148 Ga0207427_100040 3300025231 Bacteria 265135
149 Ga0207427_100220 3300025231 Bacteria 49507
150 Ga0207427_101385 3300025231 Bacteria 8885
151 Ga0209437_100189 3300025233 Bacteria 125144
152 Ga0209258_100011 3300025242 Bacteria 867542
153 Ga0209258_100047 3300025242 Bacteria 367869
154 Ga0209258_100118 3300025242 Bacteria 183558
155 Ga0209258_100474 3300025242 Bacteria 42679
156 Ga0209258_100521 3300025242 Bacteria 36985
157 Ga0207425_1000015 3300025245 Bacteria 466368
158 Ga0207425_1000427 3300025245 Bacteria 27968
159 Ga0209646_1000039 3300025246 Bacteria 349637
160 Ga0209646_1000741 3300025246 Bacteria 11464
161 Ga0209646_1005796 3300025246 Bacteria 2123
162 Ga0209026_1000006 3300025250 Bacteria 677225
163 Ga0209026_1000044 3300025250 Bacteria 266550
164 Ga0209026_1000077 3300025250 Bacteria 200561
165 Ga0209026_1000237 3300025250 Bacteria 73153
166 Ga0209026_1001111 3300025250 Bacteria 12781
167 Ga0209026_1002186 3300025250 Bacteria 7576
168 Ga0209677_100026 3300025253 Bacteria 382520
169 Ga0209677_103649 3300025253 Bacteria 4855
170 Ga0209148_1000013 3300025254 Bacteria 956684
171 Ga0209148_1000024 3300025254 Bacteria 669890
172 Ga0209148_1000054 3300025254 Bacteria 367869
173 Ga0209148_1000280 3300025254 Bacteria 78989
174 Ga0209148_1000385 3300025254 Bacteria 53107
175 Ga0209759_1000020 3300025256 Bacteria 344904
176 Ga0209759_1000291 3300025256 Bacteria 69357
177 Ga0209759_1000759 3300025256 Bacteria 27737
178 Ga0209759_1001513 3300025256 Bacteria 12812
179 Ga0209759_1005083 3300025256 Bacteria 4702
180 Ga0209759_1007145 3300025256 Bacteria 3640
181 Ga0209129_1000074 3300025258 Bacteria 205648
182 Ga0209129_1000987 3300025258 Bacteria 17036
183 Ga0209233_1000108 3300025261 Bacteria 265137
184 Ga0209233_1000143 3300025261 Bacteria 191568
185 Ga0209455_1000012 3300025272 Bacteria 867234
186 Ga0209455_1000025 3300025272 Bacteria 670673
187 Ga0209455_1000052 3300025272 Bacteria 367804
188 Ga0209455_1000440 3300025272 Bacteria 32006
189 Ga0209673_1007488 3300025273 Bacteria 5016
190 Ga0209676_1000063 3300025292 Bacteria 322025
191 Ga0209025_1000002 3300025294 Bacteria 1393142
192 Ga0209025_1001943 3300025294 Bacteria 23849
193 Ga0209564_1000026 3300025295 Bacteria 519154
194 Ga0209758_1000003 3300025297 Bacteria 1398533
195 Ga0209758_1000270 3300025297 Bacteria 102973
196 Ga0209758_1000916 3300025297 Bacteria 39954
197 Ga0209050_1003834 3300025298 Bacteria 10719
198 Ga0209050_1009532 3300025298 Bacteria 4950
199 Ga0209256_1000177 3300025299 Bacteria 125603
200 Ga0209256_1001512 3300025299 Bacteria 23519
201 Ga0209256_1008909 3300025299 Bacteria 4524
202 Ga0209051_1001521 3300025303 Bacteria 19295
203 Ga0209051_1016276 3300025303 Bacteria 3376
204 Ga0209257_1000032 3300025304 Bacteria 680354
205 Ga0209257_1000347 3300025304 Bacteria 95122
206 Ga0209257_1007715 3300025304 Bacteria 6414
207 Ga0207655_1000710 3300025728 Bacteria 38274
208 Ga0207655_1004970 3300025728 Bacteria 9215
209 Ga0207680_10000005 3300025903 Bacteria 660983
210 Ga0207647_10000829 3300025904 Bacteria 24013
211 Ga0207647_10002960 3300025904 Bacteria 12781
212 Ga0207647_10037171 3300025904 Bacteria 3089
213 Ga0207705_10006342 3300025909 Bacteria 8774
214 Ga0207705_10014504 3300025909 Bacteria 5672
215 Ga0207695_10000114 3300025913 Bacteria 242465
216 Ga0207695_10000543 3300025913 Bacteria 78567
217 Ga0207695_10003952 3300025913 Bacteria 20497
218 Ga0207695_10009701 3300025913 Bacteria 11854
219 Ga0207695_10029533 3300025913 Bacteria 6053
220 Ga0207695_10036830 3300025913 Bacteria 5284
221 Ga0207695_10068371 3300025913 Bacteria 3640
222 Ga0207695_10128193 3300025913 Bacteria 2497
223 Ga0207671_10000031 3300025914 Bacteria 247030
224 Ga0207671_10000484 3300025914 Bacteria 54081
225 Ga0207657_10034868 3300025919 Bacteria 4518
226 Ga0207657_10050389 3300025919 Bacteria 3624
227 Ga0207700_10013158 3300025928 Bacteria 5371
228 Ga0207690_10008661 3300025932 Bacteria 6035
229 Ga0207690_10033212 3300025932 Bacteria 3316
230 Ga0207706_10031715 3300025933 Bacteria 4706
231 Ga0207686_10001705 3300025934 Bacteria 12241
232 Ga0207689_10066303 3300025942 Bacteria 2969
233 Ga0207667_10000082 3300025949 Bacteria 157749
234 Ga0207667_10000806 3300025949 Bacteria 40715
235 Ga0207667_10002830 3300025949 Bacteria 21534
236 Ga0207667_10024867 3300025949 Bacteria 6566
237 Ga0207667_10174406 3300025949 Bacteria 2209
238 Ga0207651_10003738 3300025960 Bacteria 7528
239 Ga0207640_10000014 3300025981 Bacteria 219683
240 Ga0207640_10000016 3300025981 Bacteria 208390
241 Ga0207640_10000018 3300025981 Bacteria 193664
242 Ga0207640_10000357 3300025981 Bacteria 29919
243 Ga0207640_10000552 3300025981 Bacteria 22446
244 Ga0207658_10035076 3300025986 Bacteria 3591
245 Ga0207703_10001993 3300026035 Bacteria 18012
246 Ga0207639_10004023 3300026041 Bacteria 9922
247 Ga0207678_10004112 3300026067 Bacteria 13085
248 Ga0207678_10009362 3300026067 Bacteria 8622
249 Ga0207702_10000108 3300026078 Bacteria 95976
250 Ga0207702_10001065 3300026078 Bacteria 28079
251 Ga0207702_10002612 3300026078 Bacteria 16920
252 Ga0207702_10006080 3300026078 Bacteria 10470
253 Ga0207702_10091948 3300026078 Bacteria 2658
254 Ga0207674_10012597 3300026116 Bacteria 9452
255 Ga0207674_10052187 3300026116 Bacteria 4170
256 Ga0209281_1004926 3300027111 Bacteria 3843
257 Ga0268266_10000051 3300028379 Bacteria 296231
258 Ga0265336_10000057 3300028666 Bacteria 105485
259 Ga0307515_10000026 3300028794 Bacteria 382411
260 Ga0307515_10000132 3300028794 Bacteria 176547
261 Ga0307515_10001291 3300028794 Bacteria 56882
262 Ga0265324_10002428 3300029957 Bacteria 9563
263 Ga0307513_10016752 3300031456 Bacteria 8818
264 Ga0307408_100000044 3300031548 Bacteria 169498
265 Ga0307408_100000087 3300031548 Bacteria 101616
266 Ga0307408_100000089 3300031548 Bacteria 100712
267 Ga0307408_100000279 3300031548 Bacteria 51312
268 Ga0307408_100067759 3300031548 Bacteria 2626
269 Ga0307516_10001414 3300031730 Bacteria 33201
270 Ga0307516_10008045 3300031730 Bacteria 11991
271 Ga0307406_10000460 3300031901 Bacteria 23579
272 Ga0307414_10001626 3300032004 Bacteria 11693
273 Ga0307414_10017121 3300032004 Bacteria 4428
274 Ga0307411_10000073 3300032005 Bacteria 30792
275 Ga0307510_10000038 3300033180 Bacteria 106256
276 Ga0307510_10001244 3300033180 Bacteria 27679
277 Ga0373931_0002933 3300035691 Bacteria 7608
278 Ga0395899_0000183 3300037312 Bacteria 91818
279 Ga0395899_0016811 3300037312 Bacteria 5577
280 Ga0395899_0025782 3300037312 Bacteria 4437
281 Ga0395899_0026990 3300037312 Bacteria 4331
282 Ga0395899_0044456 3300037312 Bacteria 3309
283 Ga0395899_0060294 3300037312 Bacteria 2795
284 Ga0395900_0000039 3300037418 Bacteria 248722
285 Ga0395900_0000297 3300037418 Bacteria 74817
286 Ga0395900_0000875 3300037418 Bacteria 39483
287 Ga0395900_0009197 3300037418 Bacteria 10128
288 Ga0395900_0015294 3300037418 Bacteria 7824
289 Ga0395898_0000069 3300037466 Bacteria 254587
290 Ga0395898_0000140 3300037466 Bacteria 190587
291 Ga0395898_0002834 3300037466 Bacteria 19837
292 Ga0395898_0010944 3300037466 Bacteria 9460
293 Ga0395905_0000091 3300037471 Bacteria 151747
294 Ga0395905_0003461 3300037471 Bacteria 16880
295 Ga0395905_0007479 3300037471 Bacteria 10866
296 Ga0395905_0012497 3300037471 Bacteria 8172
297 Ga0395905_0026323 3300037471 Bacteria 5485
298 Ga0395905_0031140 3300037471 Bacteria 5023
299 Ga0395905_0034558 3300037471 Bacteria 4747
300 Ga0395905_0062826 3300037471 Bacteria 3473
301 Ga0395905_0064772 3300037471 Bacteria 3421
302 Ga0395905_0070117 3300037471 Bacteria 3284
303 Ga0395905_0165113 3300037471 Bacteria 2080
304 Ga0395905_0199860 3300037471 Bacteria 1874
305 Ga0395901_0000182 3300038443 Bacteria 81583
306 Ga0395901_0002267 3300038443 Bacteria 19632
307 Ga0395901_0003168 3300038443 Bacteria 16548
308 Ga0395901_0007644 3300038443 Bacteria 10908
309 Ga0395901_0197947 3300038443 Bacteria 2106
310 Ga0395901_0245928 3300038443 Bacteria 1864
311 Ga0451793_0647515 3300041452 Bacteria 2295
312 Ga0439445_0000017 3300042004 Bacteria 22138
313 Ga0439448_0001498 3300042005 Bacteria 6075
314 Ga0439448_0002529 3300042005 Bacteria 4984
315 Ga0439448_0009318 3300042005 Bacteria 2892
316 Ga0439449_0000148 3300042007 Bacteria 23780
317 Ga0439449_0036880 3300042007 Bacteria 1818
318 Ga0450890_000748 3300042127 Bacteria 4721
319 Ga0450891_000030 3300042129 Bacteria 10041
320 Ga0450898_006302 3300042134 Bacteria 1816
321 Ga0450899_001924 3300042135 Bacteria 2299
322 Ga0450889_000154 3300042144 Bacteria 7035
323 Ga0439458_0003400 3300042157 Bacteria 3729
324 Ga0450893_0003065 3300042532 Bacteria 2628
325 Ga0451577_0001100 3300042876 Bacteria 38617
326 Ga0466969_0001829 3300044656 Bacteria 11356
327 Ga0466969_0030475 3300044656 Bacteria 2748
328 Ga0466972_0006972 3300044658 Bacteria 5667
329 Ga0466972_0009228 3300044658 Bacteria 4954
330 Ga0466975_0142054 3300044661 Bacteria 1680
331 Ga0453683_0000388 3300044673 Bacteria 52402
332 Ga0466966_0000185 3300044684 Bacteria 41391
333 Ga0466966_0000893 3300044684 Bacteria 19055
334 Ga0466961_0000838 3300044693 Bacteria 19180
335 Ga0466961_0002054 3300044693 Bacteria 12538
336 Ga0466961_0009691 3300044693 Bacteria 6130
337 Ga0466961_0021300 3300044693 Bacteria 4173
338 Ga0466961_0034991 3300044693 Bacteria 3225
339 Ga0466964_0000235 3300044706 Bacteria 15877
340 Ga0466964_0013264 3300044706 Bacteria 3126
341 Ga0466971_0000321 3300044719 Bacteria 18474
342 Ga0466971_0006747 3300044719 Bacteria 4995
343 Ga0466971_0024553 3300044719 Bacteria 2690
344 Ga0466968_0000415 3300044735 Bacteria 14183
345 Ga0466970_0000676 3300044765 Bacteria 16664
346 Ga0466970_0014806 3300044765 Bacteria 4009
347 Ga0466970_0032087 3300044765 Bacteria 2775
348 Ga0466970_0053522 3300044765 Bacteria 2155
349 Ga0466957_0000301 3300044842 Bacteria 24184
350 Ga0466957_0008884 3300044842 Bacteria 5725
351 Ga0466957_0079680 3300044842 Bacteria 2038
352 Ga0466957_0098628 3300044842 Bacteria 1839
353 Ga0466959_0000324 3300045049 Bacteria 28181
354 Ga0466959_0004379 3300045049 Bacteria 9450
355 Ga0466959_0005917 3300045049 Bacteria 8424
356 Ga0466959_0011694 3300045049 Bacteria 6313
357 Ga0466959_0050430 3300045049 Bacteria 3055
358 Ga0466959_0051365 3300045049 Bacteria 3024
359 Ga0466959_0060055 3300045049 Bacteria 2766
360 Ga0451576_0001377 3300045051 Bacteria 41774
361 Ga0451576_0072490 3300045051 Bacteria 3584
362 Ga0466958_0000079 3300045836 Bacteria 29664
363 Ga0466958_0001861 3300045836 Bacteria 10298
364 Ga0466958_0023991 3300045836 Bacteria 3586
365 Ga0466958_0035388 3300045836 Bacteria 2983
366 Ga0466967_0004988 3300045976 Bacteria 9087
367 Ga0466967_0112882 3300045976 Bacteria 2499
368 Ga0495617_000048 3300046452 Bacteria 113357
369 Ga0495627_000008 3300046453 Bacteria 572150
370 Ga0495627_022856 3300046453 Bacteria 2054
371 Ga0495590_0000030 3300046457 Bacteria 146237
372 Ga0495638_0000502 3300046460 Bacteria 46450
373 Ga0495638_0000577 3300046460 Bacteria 41426
374 Ga0495638_0001521 3300046460 Bacteria 20879
375 Ga0495653_0000094 3300046463 Bacteria 74354
376 Ga0495650_0000212 3300046471 Bacteria 124622
377 Ga0495650_0000227 3300046471 Bacteria 114662
378 Ga0495650_0003980 3300046471 Bacteria 10387
379 Ga0495650_0008312 3300046471 Bacteria 6076
380 Ga0495650_0015103 3300046471 Bacteria 3978
381 Ga0495605_0000684 3300046474 Bacteria 25383
382 Ga0495605_0007359 3300046474 Bacteria 6251
383 Ga0495605_0008715 3300046474 Bacteria 5726
384 Ga0495605_0022554 3300046474 Bacteria 3323
385 Ga0495584_0004029 3300046491 Bacteria 7924
386 Ga0495585_0003347 3300046492 Bacteria 10861
387 Ga0495585_0056931 3300046492 Bacteria 2158
388 Ga0495596_0000522 3300046500 Bacteria 24144
389 Ga0495607_0000791 3300046501 Bacteria 29998
390 Ga0495607_0001184 3300046501 Bacteria 23557
391 Ga0495607_0003449 3300046501 Bacteria 12108
392 Ga0495583_0000002 3300046506 Bacteria 782521
393 Ga0495583_0000034 3300046506 Bacteria 246856
394 Ga0495583_0000202 3300046506 Bacteria 100020
395 Ga0495583_0000480 3300046506 Bacteria 58370
396 Ga0495583_0000655 3300046506 Bacteria 45614
397 Ga0495606_0000316 3300046507 Bacteria 83307
398 Ga0495606_0000392 3300046507 Bacteria 74042
399 Ga0495606_0001466 3300046507 Bacteria 31509
400 Ga0495606_0005479 3300046507 Bacteria 12151
401 Ga0495606_0011434 3300046507 Bacteria 7239
402 Ga0495606_0074046 3300046507 Bacteria 2134
403 Ga0495610_0000021 3300046512 Bacteria 336300
404 Ga0495610_0004696 3300046512 Bacteria 9976
405 Ga0495610_0004761 3300046512 Bacteria 9899
406 Ga0495610_0018050 3300046512 Bacteria 3997
407 Ga0495610_0020020 3300046512 Bacteria 3727
408 Ga0495616_0000008 3300046513 Bacteria 226291
409 Ga0495616_0000195 3300046513 Bacteria 50559
410 Ga0495616_0010746 3300046513 Bacteria 5280
411 Ga0495616_0053010 3300046513 Bacteria 2017
412 Ga0495631_0016898 3300046518 Bacteria 3464
413 Ga0495632_0000864 3300046519 Bacteria 26623
414 Ga0495632_0008099 3300046519 Bacteria 6507
415 Ga0495637_0000517 3300046520 Bacteria 28019
416 Ga0495643_0000639 3300046522 Bacteria 41499
417 Ga0495643_0001431 3300046522 Bacteria 22049
418 Ga0495643_0041750 3300046522 Bacteria 2500
419 Ga0495643_0060304 3300046522 Bacteria 2014
420 Ga0495644_0003909 3300046523 Bacteria 5868
421 Ga0495644_0008286 3300046523 Bacteria 4003
422 Ga0495648_0000192 3300046524 Bacteria 70428
423 Ga0495648_0005053 3300046524 Bacteria 11073
424 Ga0495648_0007457 3300046524 Bacteria 8747
425 Ga0495648_0010461 3300046524 Bacteria 7064
426 Ga0495648_0021530 3300046524 Bacteria 4461
427 Ga0495663_0000512 3300046525 Bacteria 13962
428 Ga0495642_0000174 3300046528 Bacteria 37880
429 Ga0495654_0000005 3300046530 Bacteria 491381
430 Ga0495609_0000009 3300046538 Bacteria 354860
431 Ga0495609_0000044 3300046538 Bacteria 161642
432 Ga0495609_0002111 3300046538 Bacteria 12497
433 Ga0495609_0038269 3300046538 Bacteria 2163
434 Ga0495597_0000630 3300046542 Bacteria 28791
435 Ga0495597_0001389 3300046542 Bacteria 17475
436 Ga0495597_0022682 3300046542 Bacteria 2910
437 Ga0495622_0000337 3300046557 Bacteria 33736
438 Ga0495622_0000342 3300046557 Bacteria 33472
439 Ga0495633_0000181 3300046558 Bacteria 82164
440 Ga0495633_0000775 3300046558 Bacteria 28578
441 Ga0495633_0001583 3300046558 Bacteria 17367
442 Ga0495633_0022330 3300046558 Bacteria 3151
443 Ga0495633_0028875 3300046558 Bacteria 2700
444 Ga0495633_0030104 3300046558 Bacteria 2638
445 Ga0495656_0006811 3300046615 Bacteria 4017
446 Ga0495668_0000300 3300046616 Bacteria 68118
447 Ga0495668_0000875 3300046616 Bacteria 33965
448 Ga0495668_0002420 3300046616 Bacteria 15392
449 Ga0495668_0046806 3300046616 Bacteria 2402
450 Ga0495668_0055128 3300046616 Bacteria 2195
451 Ga0495668_0067849 3300046616 Bacteria 1962
452 Ga0495611_0002942 3300046648 Bacteria 7594
453 Ga0495625_0001453 3300046660 Bacteria 28757
454 Ga0495625_0002719 3300046660 Bacteria 18757
455 Ga0495625_0002731 3300046660 Bacteria 18701
456 Ga0495625_0009740 3300046660 Bacteria 7998
457 Ga0495625_0010502 3300046660 Bacteria 7653
458 Ga0495625_0027765 3300046660 Bacteria 4254
459 Ga0495661_0000113 3300046665 Bacteria 96815
460 Ga0495661_0000426 3300046665 Bacteria 44529
461 Ga0495661_0001850 3300046665 Bacteria 16904
462 Ga0495661_0004761 3300046665 Bacteria 9737
463 Ga0495661_0033854 3300046665 Bacteria 3220
464 Ga0495670_0013561 3300046691 Bacteria 4008
465 Ga0495671_0000310 3300046692 Bacteria 41263
466 Ga0495649_0000052 3300046694 Bacteria 108087
467 Ga0495649_0003458 3300046694 Bacteria 10644
468 Ga0495649_0003576 3300046694 Bacteria 10424
469 Ga0495589_0000035 3300046794 Bacteria 161642
470 Ga0495589_0000037 3300046794 Bacteria 150603
471 Ga0495589_0001144 3300046794 Bacteria 15770
472 Ga0495589_0012665 3300046794 Bacteria 4361
473 Ga0495660_0000057 3300046810 Bacteria 133310
474 Ga0495660_0000555 3300046810 Bacteria 30632
475 Ga0495660_0000839 3300046810 Bacteria 22805
476 Ga0495660_0003693 3300046810 Bacteria 9410
477 Ga0495660_0004024 3300046810 Bacteria 8976
478 Ga0495660_0049998 3300046810 Bacteria 2279
479 Ga0495672_0000285 3300047320 Bacteria 70145
480 Ga0495672_0003714 3300047320 Bacteria 12870
481 Ga0495672_0077075 3300047320 Bacteria 1870
482 Ga0495683_0042646 3300047323 Bacteria 2287
483 Ga0495683_0051930 3300047323 Bacteria 2047
484 Ga0495687_000066 3300047443 Bacteria 161642
485 Ga0495687_000164 3300047443 Bacteria 99940
486 Ga0495687_000168 3300047443 Bacteria 97267
487 Ga0495687_000215 3300047443 Bacteria 82752
488 Ga0495687_001222 3300047443 Bacteria 24544
489 Ga0495687_001324 3300047443 Bacteria 23105
490 Ga0495677_0000011 3300047445 Bacteria 149837
491 Ga0495677_0000013 3300047445 Bacteria 138372
492 Ga0495677_0000255 3300047445 Bacteria 23352
493 Ga0495677_0000609 3300047445 Bacteria 14618
494 Ga0495679_014209 3300047446 Bacteria 2960
495 Ga0495685_019827 3300047447 Bacteria 2311
496 Ga0495673_0000033 3300047469 Bacteria 354152
497 Ga0495673_0000150 3300047469 Bacteria 122768
498 Ga0495673_0001548 3300047469 Bacteria 18062
499 Ga0495681_0008972 3300047470 Bacteria 6207
500 Ga0495686_0000162 3300047472 Bacteria 126699
501 Ga0495686_0000356 3300047472 Bacteria 74751
502 Ga0495686_0013508 3300047472 Bacteria 5663
503 Ga0495686_0029801 3300047472 Bacteria 3547
504 Ga0495615_0002112 3300048090 Bacteria 3119
505 Ga0495626_0000011 3300048091 Bacteria 260928
506 Ga0495626_0000071 3300048091 Bacteria 136767
507 Ga0495626_0001607 3300048091 Bacteria 17612
508 Ga0495626_0006624 3300048091 Bacteria 6565
509 Ga0495626_0012281 3300048091 Bacteria 4496
510 Ga0495626_0043322 3300048091 Bacteria 2112
511 Ga0496102_0025873 3300048905 Bacteria 5227
512 Ga0496103_0006104 3300048906 Bacteria 7199
513 Ga0496103_0091644 3300048906 Bacteria 1918
514 Ga0496104_0145134 3300048907 Bacteria 2279
515 Ga0496105_0008394 3300048908 Bacteria 8029
516 Ga0496106_0047263 3300048909 Bacteria 3238
517 Ga0496107_0020137 3300048910 Bacteria 4711
518 Ga0496114_0056186 3300048917 Bacteria 3284
519 Ga0496116_0000280 3300048919 Bacteria 87774
520 Ga0496116_0027734 3300048919 Bacteria 4116
521 Ga0496117_0004101 3300048920 Bacteria 16328
522 Ga0496118_0004682 3300048921 Bacteria 16037
523 Ga0496118_0105874 3300048921 Bacteria 1884
524 Ga0496119_0000048 3300048922 Bacteria 185846
525 Ga0496120_0000519 3300048923 Bacteria 59691
526 Ga0496121_0016952 3300048924 Bacteria 7484
527 Ga0496122_0000679 3300048925 Bacteria 68253
528 Ga0496122_0009741 3300048925 Bacteria 10039
529 Ga0496122_0019844 3300048925 Bacteria 6117
530 Ga0496123_0000273 3300048926 Bacteria 102487
531 Ga0496123_0010989 3300048926 Bacteria 7912
532 Ga0496123_0011828 3300048926 Bacteria 7510
533 Ga0496124_0015607 3300048927 Bacteria 7270
534 Ga0496124_0023054 3300048927 Bacteria 5694
535 Ga0496124_0023891 3300048927 Bacteria 5569
536 Ga0496124_0030207 3300048927 Bacteria 4813
537 Ga0496124_0030307 3300048927 Bacteria 4804
538 Ga0496124_0030713 3300048927 Bacteria 4764
539 Ga0496124_0058895 3300048927 Bacteria 3228
540 Ga0496124_0062069 3300048927 Bacteria 3129
541 Ga0496125_0001420 3300048928 Bacteria 34946
542 Ga0496125_0002009 3300048928 Bacteria 27587
543 Ga0496125_0016273 3300048928 Bacteria 7148
544 Ga0496125_0062005 3300048928 Bacteria 2994
545 Ga0496126_0000097 3300048929 Bacteria 206014
546 Ga0496126_0012448 3300048929 Bacteria 8712
547 Ga0495678_000002 3300049459 Bacteria 999613
548 Ga0495678_000241 3300049459 Bacteria 61623
549 Ga0501299_005017 3300049522 Bacteria 2012
550 Ga0501300_002498 3300049523 Bacteria 2749
551 Ga0501034_0015172 3300049571 Bacteria 7918
552 Ga0501034_0060956 3300049571 Bacteria 3790
553 Ga0501034_0116722 3300049571 Bacteria 2657
554 Ga0501034_0228865 3300049571 Bacteria 1809
555 Ga0501227_001061 3300049665 Bacteria 6116
556 Ga0501258_000255 3300049687 Bacteria 3287
557 Ga0501221_000455 3300049704 Bacteria 6392
558 Ga0501269_000312 3300049766 Bacteria 13021
559 Ga0501035_0021676 3300049822 Bacteria 5908
560 nmdc:mga07m45_14250_c1 3300050496 Bacteria 4231
561 Ga0500635_0012917 3300053080 Bacteria 2412
562 Ga0500608_000084 3300053122 Bacteria 38834
563 Ga0500618_001044 3300053125 Bacteria 13824
564 Ga0500586_001190 3300053145 Bacteria 5418
565 Ga0500586_001453 3300053145 Bacteria 4996
566 Ga0500634_0000385 3300053161 Bacteria 14134
567 Ga0500637_0000575 3300053178 Bacteria 14440
568 Ga0500609_000195 3300053731 Bacteria 8636
569 Ga0466962_0001038 3300061719 Bacteria 12735
570 Ga0466962_0002853 3300061719 Bacteria 8232
571 2511122812 2510917020 Bacteria 5657507
572 2511126323 2510917021 Bacteria 5705459
573 2643782316 2643221552 Bacteria 5708754
574 2643802211 2643221556 Bacteria 7251154
575 2643908365 2643221579 Bacteria 4443405
576 2643927961 2643221584 Bacteria 5511711
577 2644218668 2643221639 Bacteria 6649903
578 2644256764 2643221646 Bacteria 6433402
579 2644475719 2643221684 Bacteria 7145183
580 2687583120 2687453130 Bacteria 4227172
581 2738826004 2738541297 Bacteria 6549566
582 2739058059 2738541337 Bacteria 6183410
583 2739149801 2738541357 Bacteria 6549408
584 2739191720 2738543003 Bacteria 6549560
585 2739318197 2738543026 Bacteria 6549408
586 2739336438 2738543029 Bacteria 6549249
587 2739793427 2739367756 Bacteria 4553612
588 2748017755 2747842501 Bacteria 5293829
589 2792459984 2791355048 Bacteria 5832535
590 2849565008 2849560528 Bacteria 5393480
591 2849575054 2849573788 Bacteria 5421256
592 2851155899 2851153111 Bacteria 5542585
593 2857555900 2857553236 Bacteria 6166726
594 2857566398 2857564685 Bacteria 6290584
595 2884414783 2884411467 Bacteria 5246714
596 2898332455 2898329390 Bacteria 5168154
597 2904428839 2904424332 Bacteria 7633521
598 2923517098 2923516293 Bacteria 3716336
599 8002870118 8002869464 Bacteria 3588529
600 8047678365 8047673197 Bacteria 7395230
601 8054306147 8054302542 Bacteria 5698134
602 Ga0395899_0000062
603 JGI24736J21556_1005228
604 JGI24740J21852_10006551
605 JGI24739J22299_10000764
606 JGI24739J22299_10010483
607 JGI24737J22298_10000146
608 JGI24737J22298_10001103
609 JGI24737J22298_10012744
610 JGI24735J21928_10001534
611 JGI24735J21928_10002142
612 JGI24735J21928_10024486
613 JGI24738J21930_10000047
614 JGI24738J21930_10007731
615 JGI25156J39149_1000026
616 JGI25156J39149_1004036
617 JGI25162J39368_1000625
618 JGI25157J39369_1000008
619 JGI25157J39369_1000967
620 JGI25157J39369_1001103
621 JGI25157J39369_1001587
622 JGI25164J39214_1000048
623 JGI25152J39213_1000004
624 JGI25152J39213_1000188
625 JGI25150J39212_1000438
626 JGI25151J46595_10000010
627 JGI25165J46597_1000096
628 JGI25165J46597_1000566
629 JGI25153J46596_10000013
630 rootH1_10001460
631 rootH1_10006701
632 rootH1_10022300
633 rootH2_10005870
634 rootL2_10006538
635 rootL2_10049842
636 rootL2_10061224
637 rootH1_10006711
638 rootH1_10031104
639 rootH1_10039315
640 rootH1_10044261
641 rootH1_10044262
642 rootH1_10180860
643 rootH1_10293050
644 Ga0055539_1000042
645 Ga0055539_1000855
646 Ga0055533_1000006
647 Ga0055533_1001601
648 Ga0055525_1000001
649 Ga0055525_1000120
650 Ga0055525_1000940
651 Ga0055527_1000058
652 Ga0055527_1000107
653 Ga0055535_1000325
654 Ga0055535_1000823
655 Ga0055535_1000983
656 Ga0055542_1000149
657 Ga0055542_1000260
658 Ga0055542_1000384
659 Ga0055542_1000486
660 Ga0055529_1000049
661 Ga0055529_1000289
662 Ga0055529_1000374
663 Ga0055526_1000095
664 Ga0055524_1000157
665 Ga0055531_10000025
666 Ga0055531_10005331
667 Ga0055531_10006800
668 Ga0065704_10070370
669 Ga0070658_10003827
670 Ga0070658_10019464
671 Ga0070690_100000894
672 Ga0070670_100061379
673 Ga0068869_100049393
674 Ga0070666_10000008
675 Ga0070682_100023656
676 Ga0070673_100081336
677 Ga0070659_100008751
678 Ga0070659_100122196
679 Ga0070667_100020773
680 Ga0070714_100002914
681 Ga0070713_100003831
682 Ga0070663_100001297
683 Ga0070663_100005219
684 Ga0070662_100035349
685 Ga0068853_100005512
686 Ga0068853_100049139
687 Ga0068853_100157940
688 Ga0070665_100033848
689 Ga0070665_100143704
690 Ga0068855_100002022
691 Ga0068855_100003008
692 Ga0068855_100008710
693 Ga0068855_100062580
694 Ga0068857_100004277
695 Ga0068857_100010583
696 Ga0068854_100000144
697 Ga0068854_100001017
698 Ga0068854_100009849
699 Ga0068854_100087744
700 Ga0068856_100000012
701 Ga0068856_100003732
702 Ga0068856_100003862
703 Ga0068858_100000499
704 Ga0075364_10000300
705 Ga0075366_10034839
706 Ga0097621_100019160
707 Ga0105244_10000158
708 Ga0105244_10001449
709 Ga0105240_10000049
710 Ga0105240_10003394
711 Ga0105240_10004407
712 Ga0105240_10018464
713 Ga0105240_10072508
714 Ga0105240_10123731
715 Ga0105242_10004609
716 Ga0105237_10000630
717 Ga0105237_10010419
718 Ga0105238_10000335
719 Ga0105238_10034728
720 Ga0105238_10037554
721 Ga0105239_10000070
722 Ga0105239_10036352
723 Ga0157319_1000005
724 Ga0157373_10003230
725 Ga0157371_10000856
726 Ga0157370_10000140
727 Ga0157370_10036932
728 Ga0157369_10007582
729 Ga0157369_10020993
730 Ga0157369_10048674
731 Ga0157369_10097340
732 Ga0157374_10027500
733 Ga0163162_10012837
734 Ga0182008_10000798
735 Ga0182008_10020044
736 Ga0182006_1000040
737 Ga0182006_1001734
738 Ga0182005_1000051
739 Ga0213872_10000083
740 Ga0209674_100003
741 Ga0209674_100394
742 Ga0209672_100009
743 Ga0209672_100024
744 Ga0209672_100133
745 Ga0209672_101393
746 Ga0209563_100007
747 Ga0209563_100010
748 Ga0209563_100067
749 Ga0207427_100040
750 Ga0207427_100220
751 Ga0207427_101385
752 Ga0209437_100189
753 Ga0209258_100011
754 Ga0209258_100047
755 Ga0209258_100118
756 Ga0209258_100474
757 Ga0209258_100521
758 Ga0207425_1000015
759 Ga0207425_1000427
760 Ga0209646_1000039
761 Ga0209646_1000741
762 Ga0209646_1005796
763 Ga0209026_1000006
764 Ga0209026_1000044
765 Ga0209026_1000077
766 Ga0209026_1000237
767 Ga0209026_1001111
768 Ga0209026_1002186
769 Ga0209677_100026
770 Ga0209677_103649
771 Ga0209148_1000013
772 Ga0209148_1000024
773 Ga0209148_1000054
774 Ga0209148_1000280
775 Ga0209148_1000385
776 Ga0209759_1000020
777 Ga0209759_1000291
778 Ga0209759_1000759
779 Ga0209759_1001513
780 Ga0209759_1005083
781 Ga0209759_1007145
782 Ga0209129_1000074
783 Ga0209129_1000987
784 Ga0209233_1000108
785 Ga0209233_1000143
786 Ga0209455_1000012
787 Ga0209455_1000025
788 Ga0209455_1000052
789 Ga0209455_1000440
790 Ga0209673_1007488
791 Ga0209676_1000063
792 Ga0209025_1000002
793 Ga0209025_1001943
794 Ga0209564_1000026
795 Ga0209758_1000003
796 Ga0209758_1000270
797 Ga0209758_1000916
798 Ga0209050_1003834
799 Ga0209050_1009532
800 Ga0209256_1000177
801 Ga0209256_1001512
802 Ga0209256_1008909
803 Ga0209051_1001521
804 Ga0209051_1016276
805 Ga0209257_1000032
806 Ga0209257_1000347
807 Ga0209257_1007715
808 Ga0207655_1000710
809 Ga0207655_1004970
810 Ga0207680_10000005
811 Ga0207647_10000829
812 Ga0207647_10002960
813 Ga0207647_10037171
814 Ga0207705_10006342
815 Ga0207705_10014504
816 Ga0207695_10000114
817 Ga0207695_10000543
818 Ga0207695_10003952
819 Ga0207695_10009701
820 Ga0207695_10029533
821 Ga0207695_10036830
822 Ga0207695_10068371
823 Ga0207695_10128193
824 Ga0207671_10000031
825 Ga0207671_10000484
826 Ga0207657_10034868
827 Ga0207657_10050389
828 Ga0207700_10013158
829 Ga0207690_10008661
830 Ga0207690_10033212
831 Ga0207706_10031715
832 Ga0207686_10001705
833 Ga0207689_10066303
834 Ga0207667_10000082
835 Ga0207667_10000806
836 Ga0207667_10002830
837 Ga0207667_10024867
838 Ga0207667_10174406
839 Ga0207651_10003738
840 Ga0207640_10000014
841 Ga0207640_10000016
842 Ga0207640_10000018
843 Ga0207640_10000357
844 Ga0207640_10000552
845 Ga0207658_10035076
846 Ga0207703_10001993
847 Ga0207639_10004023
848 Ga0207678_10004112
849 Ga0207678_10009362
850 Ga0207702_10000108
851 Ga0207702_10001065
852 Ga0207702_10002612
853 Ga0207702_10006080
854 Ga0207702_10091948
855 Ga0207674_10012597
856 Ga0207674_10052187
857 Ga0209281_1004926
858 Ga0268266_10000051
859 Ga0265336_10000057
860 Ga0307515_10000026
861 Ga0307515_10000132
862 Ga0307515_10001291
863 Ga0265324_10002428
864 Ga0307513_10016752
865 Ga0307408_100000044
866 Ga0307408_100000087
867 Ga0307408_100000089
868 Ga0307408_100000279
869 Ga0307408_100067759
870 Ga0307516_10001414
871 Ga0307516_10008045
872 Ga0307406_10000460
873 Ga0307414_10001626
874 Ga0307414_10017121
875 Ga0307411_10000073
876 Ga0307510_10000038
877 Ga0307510_10001244
878 Ga0373931_0002933
879 Ga0395899_0000183
880 Ga0395899_0016811
881 Ga0395899_0025782
882 Ga0395899_0026990
883 Ga0395899_0044456
884 Ga0395899_0060294
885 Ga0395900_0000039
886 Ga0395900_0000297
887 Ga0395900_0000875
888 Ga0395900_0009197
889 Ga0395900_0015294
890 Ga0395898_0000069
891 Ga0395898_0000140
892 Ga0395898_0002834
893 Ga0395898_0010944
894 Ga0395905_0000091
895 Ga0395905_0003461
896 Ga0395905_0007479
897 Ga0395905_0012497
898 Ga0395905_0026323
899 Ga0395905_0031140
900 Ga0395905_0034558
901 Ga0395905_0062826
902 Ga0395905_0064772
903 Ga0395905_0070117
904 Ga0395905_0165113
905 Ga0395905_0199860
906 Ga0395901_0000182
907 Ga0395901_0002267
908 Ga0395901_0003168
909 Ga0395901_0007644
910 Ga0395901_0197947
911 Ga0395901_0245928
912 Ga0451793_0647515
913 Ga0439445_0000017
914 Ga0439448_0001498
915 Ga0439448_0002529
916 Ga0439448_0009318
917 Ga0439449_0000148
918 Ga0439449_0036880
919 Ga0450890_000748
920 Ga0450891_000030
921 Ga0450898_006302
922 Ga0450899_001924
923 Ga0450889_000154
924 Ga0439458_0003400
925 Ga0450893_0003065
926 Ga0451577_0001100
927 Ga0466969_0001829
928 Ga0466969_0030475
929 Ga0466972_0006972
930 Ga0466972_0009228
931 Ga0466975_0142054
932 Ga0453683_0000388
933 Ga0466966_0000185
934 Ga0466966_0000893
935 Ga0466961_0000838
936 Ga0466961_0002054
937 Ga0466961_0009691
938 Ga0466961_0021300
939 Ga0466961_0034991
940 Ga0466964_0000235
941 Ga0466964_0013264
942 Ga0466971_0000321
943 Ga0466971_0006747
944 Ga0466971_0024553
945 Ga0466968_0000415
946 Ga0466970_0000676
947 Ga0466970_0014806
948 Ga0466970_0032087
949 Ga0466970_0053522
950 Ga0466957_0000301
951 Ga0466957_0008884
952 Ga0466957_0079680
953 Ga0466957_0098628
954 Ga0466959_0000324
955 Ga0466959_0004379
956 Ga0466959_0005917
957 Ga0466959_0011694
958 Ga0466959_0050430
959 Ga0466959_0051365
960 Ga0466959_0060055
961 Ga0451576_0001377
962 Ga0451576_0072490
963 Ga0466958_0000079
964 Ga0466958_0001861
965 Ga0466958_0023991
966 Ga0466958_0035388
967 Ga0466967_0004988
968 Ga0466967_0112882
969 Ga0495617_000048
970 Ga0495627_000008
971 Ga0495627_022856
972 Ga0495590_0000030
973 Ga0495638_0000502
974 Ga0495638_0000577
975 Ga0495638_0001521
976 Ga0495653_0000094
977 Ga0495650_0000212
978 Ga0495650_0000227
979 Ga0495650_0003980
980 Ga0495650_0008312
981 Ga0495650_0015103
982 Ga0495605_0000684
983 Ga0495605_0007359
984 Ga0495605_0008715
985 Ga0495605_0022554
986 Ga0495584_0004029
987 Ga0495585_0003347
988 Ga0495585_0056931
989 Ga0495596_0000522
990 Ga0495607_0000791
991 Ga0495607_0001184
992 Ga0495607_0003449
993 Ga0495583_0000002
994 Ga0495583_0000034
995 Ga0495583_0000202
996 Ga0495583_0000480
997 Ga0495583_0000655
998 Ga0495606_0000316
999 Ga0495606_0000392
1000 Ga0495606_0001466
1001 Ga0495606_0005479
1002 Ga0495606_0011434
1003 Ga0495606_0074046
1004 Ga0495610_0000021
1005 Ga0495610_0004696
1006 Ga0495610_0004761
1007 Ga0495610_0018050
1008 Ga0495610_0020020
1009 Ga0495616_0000008
1010 Ga0495616_0000195
1011 Ga0495616_0010746
1012 Ga0495616_0053010
1013 Ga0495631_0016898
1014 Ga0495632_0000864
1015 Ga0495632_0008099
1016 Ga0495637_0000517
1017 Ga0495643_0000639
1018 Ga0495643_0001431
1019 Ga0495643_0041750
1020 Ga0495643_0060304
1021 Ga0495644_0003909
1022 Ga0495644_0008286
1023 Ga0495648_0000192
1024 Ga0495648_0005053
1025 Ga0495648_0007457
1026 Ga0495648_0010461
1027 Ga0495648_0021530
1028 Ga0495663_0000512
1029 Ga0495642_0000174
1030 Ga0495654_0000005
1031 Ga0495609_0000009
1032 Ga0495609_0000044
1033 Ga0495609_0002111
1034 Ga0495609_0038269
1035 Ga0495597_0000630
1036 Ga0495597_0001389
1037 Ga0495597_0022682
1038 Ga0495622_0000337
1039 Ga0495622_0000342
1040 Ga0495633_0000181
1041 Ga0495633_0000775
1042 Ga0495633_0001583
1043 Ga0495633_0022330
1044 Ga0495633_0028875
1045 Ga0495633_0030104
1046 Ga0495656_0006811
1047 Ga0495668_0000300
1048 Ga0495668_0000875
1049 Ga0495668_0002420
1050 Ga0495668_0046806
1051 Ga0495668_0055128
1052 Ga0495668_0067849
1053 Ga0495611_0002942
1054 Ga0495625_0001453
1055 Ga0495625_0002719
1056 Ga0495625_0002731
1057 Ga0495625_0009740
1058 Ga0495625_0010502
1059 Ga0495625_0027765
1060 Ga0495661_0000113
1061 Ga0495661_0000426
1062 Ga0495661_0001850
1063 Ga0495661_0004761
1064 Ga0495661_0033854
1065 Ga0495670_0013561
1066 Ga0495671_0000310
1067 Ga0495649_0000052
1068 Ga0495649_0003458
1069 Ga0495649_0003576
1070 Ga0495589_0000035
1071 Ga0495589_0000037
1072 Ga0495589_0001144
1073 Ga0495589_0012665
1074 Ga0495660_0000057
1075 Ga0495660_0000555
1076 Ga0495660_0000839
1077 Ga0495660_0003693
1078 Ga0495660_0004024
1079 Ga0495660_0049998
1080 Ga0495672_0000285
1081 Ga0495672_0003714
1082 Ga0495672_0077075
1083 Ga0495683_0042646
1084 Ga0495683_0051930
1085 Ga0495687_000066
1086 Ga0495687_000164
1087 Ga0495687_000168
1088 Ga0495687_000215
1089 Ga0495687_001222
1090 Ga0495687_001324
1091 Ga0495677_0000011
1092 Ga0495677_0000013
1093 Ga0495677_0000255
1094 Ga0495677_0000609
1095 Ga0495679_014209
1096 Ga0495685_019827
1097 Ga0495673_0000033
1098 Ga0495673_0000150
1099 Ga0495673_0001548
1100 Ga0495681_0008972
1101 Ga0495686_0000162
1102 Ga0495686_0000356
1103 Ga0495686_0013508
1104 Ga0495686_0029801
1105 Ga0495615_0002112
1106 Ga0495626_0000011
1107 Ga0495626_0000071
1108 Ga0495626_0001607
1109 Ga0495626_0006624
1110 Ga0495626_0012281
1111 Ga0495626_0043322
1112 Ga0496102_0025873
1113 Ga0496103_0006104
1114 Ga0496103_0091644
1115 Ga0496104_0145134
1116 Ga0496105_0008394
1117 Ga0496106_0047263
1118 Ga0496107_0020137
1119 Ga0496114_0056186
1120 Ga0496116_0000280
1121 Ga0496116_0027734
1122 Ga0496117_0004101
1123 Ga0496118_0004682
1124 Ga0496118_0105874
1125 Ga0496119_0000048
1126 Ga0496120_0000519
1127 Ga0496121_0016952
1128 Ga0496122_0000679
1129 Ga0496122_0009741
1130 Ga0496122_0019844
1131 Ga0496123_0000273
1132 Ga0496123_0010989
1133 Ga0496123_0011828
1134 Ga0496124_0015607
1135 Ga0496124_0023054
1136 Ga0496124_0023891
1137 Ga0496124_0030207
1138 Ga0496124_0030307
1139 Ga0496124_0030713
1140 Ga0496124_0058895
1141 Ga0496124_0062069
1142 Ga0496125_0001420
1143 Ga0496125_0002009
1144 Ga0496125_0016273
1145 Ga0496125_0062005
1146 Ga0496126_0000097
1147 Ga0496126_0012448
1148 Ga0495678_000002
1149 Ga0495678_000241
1150 Ga0501299_005017
1151 Ga0501300_002498
1152 Ga0501034_0015172
1153 Ga0501034_0060956
1154 Ga0501034_0116722
1155 Ga0501034_0228865
1156 Ga0501227_001061
1157 Ga0501258_000255
1158 Ga0501221_000455
1159 Ga0501269_000312
1160 Ga0501035_0021676
1161 nmdc:mga07m45_14250_c1
1162 Ga0500635_0012917
1163 Ga0500608_000084
1164 Ga0500618_001044
1165 Ga0500586_001190
1166 Ga0500586_001453
1167 Ga0500634_0000385
1168 Ga0500637_0000575
1169 Ga0500609_000195
1170 Ga0466962_0001038
1171 Ga0466962_0002853
1172 2511122812
1173 2511126323
1174 2643782316
1175 2643802211
1176 2643908365
1177 2643927961
1178 2644218668
1179 2644256764
1180 2644475719
1181 2687583120
1182 2738826004
1183 2739058059
1184 2739149801
1185 2739191720
1186 2739318197
1187 2739336438
1188 2739793427
1189 2748017755
1190 2792459984
1191 2849565008
1192 2849575054
1193 2851155899
1194 2857555900
1195 2857566398
1196 2884414783
1197 2898332455
1198 2904428839
1199 2923517098
1200 8002870118
1201 8047678365
1202 8054306147

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04616

Glyco_hydro_43

Glycosyl hydrolases family 43

56

328

0.97

PF17851

GH43_C2

Beta xylosidase C-terminal Concanavalin A-like domain

355

533

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ms2-assembly1.cif.gz_A-2 crystal structure of the gh43 blxynb protein from bacillus licheniformis 0.8966 34 514
6ms3-assembly1.cif.gz_B crystal structure of the gh43 protein blxynb mutant (k247s) from bacillus licheniformis 0.896 34 514
1yi7-assembly1.cif.gz_B beta-d-xylosidase (selenomethionine) xynd from clostridium acetobutylicum 0.8878 34 514
1yif-assembly1.cif.gz_D crystal structure of beta-1,4-xylosidase from bacillus subtilis, new york structural genomics consortium 0.8838 36 514
2exj-assembly1.cif.gz_D structure of the family43 beta-xylosidase d128g mutant from geobacillus stearothermophilus in complex with xylobiose 0.8823 36 514
ID Description Score Start End Superfamily
6ms2A01 Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 0.8641 34 332 2.115.10.20
5z5iA02 Mainly Beta;Sandwich;Jelly Rolls; 0.8636 332 514 2.60.120.200
5z5fA01 Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 0.862 34 309 2.115.10.20
5zqsA01 Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 0.8616 34 329 2.115.10.20
5jozB01 Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 0.8585 34 328 2.115.10.20
ID Description Score Start End GO Terms
AF-A0A7X5N273-F1-model_v4 Family 43 glycosylhydrolase 0.9954 40 321 GO:0004553
GO:0005975
AF-A0A258GR49-F1-model_v4 Xylan 1,4-beta-xylosidase 0.9903 25 313 GO:0004553
GO:0005975
AF-A0A154QID8-F1-model_v4 Xylan 1,4-beta-xylosidase 0.9898 25 517 GO:0004553
GO:0005975
AF-A0A0Q7W0D6-F1-model_v4 Xylan 1,4-beta-xylosidase 0.9898 23 517 GO:0004553
GO:0005975
AF-A0A3D4LYV2-F1-model_v4 deleted 0.9896 25 260

Map