F468083

General Info

Members Datasets Scaffolds Average Seq Length
601 181 1202 144

Family's Representative Sequence

Representative Sequence 3300042157|Ga0439458_0004641|Ga0439458_0004641_305_814
Length 138
Sequence MIQRVAGCELCELSAPAVVDNDRFAVILVDDANYPGFARVIWKDHVREVSDLPDADRLLLNDAVVKLELAPLKVNVASLGNVVPHLHWHVIPRYADDAHFPAPVWAQAQRTTDEAVLQARRALVPQLAEAIARRFAAR

Samples

Sample ID Description Type Environment
1 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
2 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
5 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
6 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
20 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
21 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
22 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
23 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
24 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
25 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
26 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
27 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
28 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
29 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
30 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
31 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
32 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
33 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
34 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
35 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
53 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
54 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
55 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
56 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
57 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
58 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
59 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
60 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
61 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
62 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
63 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
64 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
65 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
66 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
67 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
68 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
69 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
70 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
71 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
72 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
73 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
74 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
75 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
76 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
77 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
78 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
79 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
80 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
81 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
82 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
83 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
84 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
85 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
86 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
87 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
88 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
89 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
90 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
91 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
92 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
93 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
94 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
95 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
96 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
97 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
98 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
99 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
100 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
101 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
102 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
103 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
104 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
105 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
106 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
107 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
108 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
109 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
110 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
111 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
112 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
113 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
114 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
115 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
116 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
117 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
118 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
119 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
120 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
121 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
122 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
123 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
124 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
125 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
126 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
127 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
128 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
129 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
130 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
131 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
132 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
133 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
134 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
135 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
136 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
137 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
138 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
139 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
140 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
141 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
142 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
143 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
144 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
145 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
146 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
147 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
148 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
149 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
150 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
151 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
152 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
153 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
154 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
155 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
156 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
157 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
158 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
159 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
160 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
161 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
162 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
163 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
164 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
165 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
166 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
167 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
168 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
169 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
170 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
171 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
174 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
175 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
177 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
178 2643221556 Massilia sp. Root1485 Isolate Unclassified
179 2643221684 Massilia sp. Root133 Isolate Unclassified
180 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
181 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.67
Metatranscriptomes 0.67
Isolates 0.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.16
Nodule 0
Rhizoplane 4.49
Rhizosphere 92.35
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439458_0004641 3300042157 Bacteria 3136
2 Ga0007409J51694_1013470 3300003575 Bacteria 4484
3 Ga0032354_1042837 3300003693 Bacteria 2519
4 Ga0055525_1000018 3300003759 Bacteria 393974
5 Ga0055542_1015878 3300003762 Bacteria 1198
6 Ga0065165_1000379 3300005262 Bacteria 72513
7 Ga0065165_1053034 3300005262 Bacteria 1142
8 Ga0065715_10199869 3300005293 Bacteria 1365
9 Ga0070658_10134700 3300005327 Bacteria 2060
10 Ga0070658_11010205 3300005327 Bacteria 723
11 Ga0070658_11101995 3300005327 Bacteria 691
12 Ga0070680_100632139 3300005336 Bacteria 919
13 Ga0070682_100333539 3300005337 Bacteria 1125
14 Ga0070660_100137046 3300005339 Bacteria 1961
15 Ga0070660_100205691 3300005339 Bacteria 1597
16 Ga0070660_100728141 3300005339 Bacteria 832
17 Ga0070661_100043062 3300005344 Bacteria 3297
18 Ga0070661_101638089 3300005344 Bacteria 544
19 Ga0070671_100501518 3300005355 Bacteria 1044
20 Ga0070659_100026607 3300005366 Bacteria 4452
21 Ga0070659_100208459 3300005366 Bacteria 1610
22 Ga0070662_100691228 3300005457 Bacteria 862
23 Ga0068855_100208353 3300005563 Bacteria 2198
24 Ga0068855_100471400 3300005563 Bacteria 1368
25 Ga0068855_100539669 3300005563 Bacteria 1264
26 Ga0068855_101746040 3300005563 Bacteria 633
27 Ga0070664_100059787 3300005564 Bacteria 3243
28 Ga0068856_100874905 3300005614 Bacteria 917
29 Ga0068852_100024945 3300005616 Bacteria 4838
30 Ga0068870_10556558 3300005840 Bacteria 773
31 Ga0105244_10207568 3300009036 Bacteria 922
32 Ga0105243_10007642 3300009148 Bacteria 8308
33 Ga0105241_10216300 3300009174 Bacteria 1608
34 Ga0105242_10031922 3300009176 Bacteria 4210
35 Ga0105242_10447693 3300009176 Bacteria 1217
36 Ga0105239_10555113 3300010375 Bacteria 1308
37 Ga0157369_10480146 3300013105 Bacteria 1286
38 Ga0157378_10480079 3300013297 Bacteria 1238
39 Ga0157372_10983589 3300013307 Bacteria 977
40 Ga0182008_10025031 3300014497 Bacteria 3035
41 Ga0182006_1028835 3300015261 Bacteria 2254
42 Ga0182006_1148069 3300015261 Bacteria 798
43 Ga0182007_10047235 3300015262 Bacteria 1424
44 Ga0209563_100011 3300025230 Bacteria 1187808
45 Ga0209677_101104 3300025253 Bacteria 12682
46 Ga0209148_1001117 3300025254 Bacteria 15972
47 Ga0207645_10112107 3300025907 Bacteria 1766
48 Ga0207705_10029157 3300025909 Bacteria 3934
49 Ga0207705_10452008 3300025909 Bacteria 996
50 Ga0207654_10011758 3300025911 Bacteria 4468
51 Ga0207657_10209878 3300025919 Bacteria 1563
52 Ga0207657_10239267 3300025919 Bacteria 1450
53 Ga0207657_10742771 3300025919 Bacteria 761
54 Ga0207649_10199624 3300025920 Bacteria 1412
55 Ga0207652_10899905 3300025921 Bacteria 782
56 Ga0207690_10060055 3300025932 Bacteria 2578
57 Ga0207690_10243059 3300025932 Bacteria 1387
58 Ga0207706_10043544 3300025933 Bacteria 3978
59 Ga0207706_10088647 3300025933 Bacteria 2720
60 Ga0207686_10005763 3300025934 Bacteria 6644
61 Ga0207709_10054685 3300025935 Bacteria 2462
62 Ga0207679_10016424 3300025945 Bacteria 4916
63 Ga0207679_10021615 3300025945 Bacteria 4366
64 Ga0207667_10250373 3300025949 Bacteria 1812
65 Ga0207667_10712529 3300025949 Bacteria 1005
66 Ga0207667_11332366 3300025949 Bacteria 693
67 Ga0207639_11033957 3300026041 Bacteria 770
68 Ga0207678_10353221 3300026067 Bacteria 1268
69 Ga0207702_10432259 3300026078 Bacteria 1274
70 Ga0207674_11266380 3300026116 Bacteria 707
71 Ga0207698_10645214 3300026142 Bacteria 1048
72 Ga0316182_1336222 3300030745 Bacteria 925
73 Ga0395899_0022570 3300037312 Bacteria 4768
74 Ga0395899_0066738 3300037312 Bacteria 2641
75 Ga0395899_0128703 3300037312 Bacteria 1809
76 Ga0395899_0137945 3300037312 Bacteria 1737
77 Ga0395899_0195932 3300037312 Bacteria 1411
78 Ga0395899_0258860 3300037312 Bacteria 1191
79 Ga0395899_0309688 3300037312 Bacteria 1066
80 Ga0395899_0344425 3300037312 Bacteria 998
81 Ga0395899_0581847 3300037312 Bacteria 715
82 Ga0395899_0648258 3300037312 Bacteria 667
83 Ga0395900_0000715 3300037418 Bacteria 44112
84 Ga0395900_0001341 3300037418 Bacteria 29739
85 Ga0395900_0075574 3300037418 Bacteria 3463
86 Ga0395900_0257808 3300037418 Bacteria 1742
87 Ga0395900_0283298 3300037418 Bacteria 1648
88 Ga0395900_0379585 3300037418 Bacteria 1381
89 Ga0395900_0585381 3300037418 Bacteria 1057
90 Ga0395900_0734566 3300037418 Bacteria 918
91 Ga0395900_1216639 3300037418 Bacteria 668
92 Ga0395900_1459456 3300037418 Bacteria 596
93 Ga0395900_1467591 3300037418 Bacteria 594
94 Ga0395898_0065139 3300037466 Bacteria 3533
95 Ga0395898_0368665 3300037466 Bacteria 1369
96 Ga0395898_0409541 3300037466 Bacteria 1292
97 Ga0395898_0570955 3300037466 Bacteria 1073
98 Ga0395898_0740416 3300037466 Bacteria 924
99 Ga0395898_0807185 3300037466 Bacteria 878
100 Ga0395898_1212898 3300037466 Bacteria 685
101 Ga0395898_1333020 3300037466 Bacteria 646
102 Ga0395905_0034925 3300037471 Bacteria 4720
103 Ga0395905_0066219 3300037471 Bacteria 3383
104 Ga0395905_0205575 3300037471 Bacteria 1845
105 Ga0395905_0232557 3300037471 Bacteria 1723
106 Ga0395905_0270079 3300037471 Bacteria 1586
107 Ga0395905_0417526 3300037471 Bacteria 1237
108 Ga0395905_0820128 3300037471 Bacteria 833
109 Ga0395905_0904853 3300037471 Bacteria 785
110 Ga0395901_0000943 3300038443 Bacteria 31649
111 Ga0395901_0005142 3300038443 Bacteria 13210
112 Ga0395901_0098508 3300038443 Bacteria 3065
113 Ga0395901_0248303 3300038443 Bacteria 1854
114 Ga0395901_0649360 3300038443 Bacteria 1058
115 Ga0395901_0849158 3300038443 Bacteria 898
116 Ga0395901_1005621 3300038443 Bacteria 809
117 Ga0395901_1020690 3300038443 Bacteria 802
118 Ga0395901_1201370 3300038443 Bacteria 724
119 Ga0395901_1269839 3300038443 Bacteria 699
120 Ga0395901_1371011 3300038443 Bacteria 666
121 Ga0439448_0000737 3300042005 Bacteria 7906
122 Ga0439448_0004703 3300042005 Bacteria 3865
123 Ga0439449_0030932 3300042007 Bacteria 1995
124 Ga0439455_0007055 3300042012 Bacteria 2362
125 Ga0439455_0114495 3300042012 Bacteria 752
126 Ga0439458_0035593 3300042157 Bacteria 1197
127 Ga0439458_0085308 3300042157 Bacteria 809
128 Ga0439458_0094653 3300042157 Bacteria 771
129 Ga0466969_0047834 3300044656 Bacteria 2116
130 Ga0466969_0216079 3300044656 Bacteria 872
131 Ga0466969_0226594 3300044656 Bacteria 849
132 Ga0466969_0239247 3300044656 Bacteria 824
133 Ga0466969_0348603 3300044656 Bacteria 670
134 Ga0466972_0000359 3300044658 Bacteria 24761
135 Ga0466972_0086714 3300044658 Bacteria 1487
136 Ga0466972_0365727 3300044658 Bacteria 675
137 Ga0466965_0015260 3300044683 Bacteria 3649
138 Ga0466965_0057378 3300044683 Bacteria 1940
139 Ga0466965_0059994 3300044683 Bacteria 1899
140 Ga0466965_0131850 3300044683 Bacteria 1296
141 Ga0466966_0041014 3300044684 Bacteria 2976
142 Ga0466966_0283885 3300044684 Bacteria 995
143 Ga0466966_0623291 3300044684 Bacteria 649
144 Ga0466961_0042612 3300044693 Bacteria 2909
145 Ga0466961_0391919 3300044693 Bacteria 843
146 Ga0466961_0552525 3300044693 Bacteria 693
147 Ga0466963_0383624 3300044694 Bacteria 990
148 Ga0466964_0008270 3300044706 Bacteria 3903
149 Ga0466964_0026894 3300044706 Bacteria 2254
150 Ga0466964_0163960 3300044706 Bacteria 1041
151 Ga0466971_0069265 3300044719 Bacteria 1600
152 Ga0466971_0119666 3300044719 Bacteria 1218
153 Ga0466971_0376445 3300044719 Bacteria 690
154 Ga0466971_0431661 3300044719 Bacteria 645
155 Ga0466968_0026488 3300044735 Bacteria 2380
156 Ga0466970_0503519 3300044765 Bacteria 697
157 Ga0466957_0002970 3300044842 Bacteria 9204
158 Ga0466957_0034542 3300044842 Bacteria 3033
159 Ga0466957_0157834 3300044842 Bacteria 1471
160 Ga0466957_0229915 3300044842 Bacteria 1227
161 Ga0466957_0316348 3300044842 Bacteria 1052
162 Ga0466957_0679870 3300044842 Bacteria 725
163 Ga0466957_0796257 3300044842 Bacteria 671
164 Ga0466960_0098021 3300044901 Bacteria 1505
165 Ga0466960_0139562 3300044901 Bacteria 1286
166 Ga0466960_0206241 3300044901 Bacteria 1076
167 Ga0466959_0059019 3300045049 Bacteria 2794
168 Ga0466959_0279735 3300045049 Bacteria 1145
169 Ga0466959_0614730 3300045049 Bacteria 730
170 Ga0466958_0116044 3300045836 Bacteria 1673
171 Ga0466967_0017377 3300045976 Bacteria 5709
172 Ga0466967_0058766 3300045976 Bacteria 3400
173 Ga0466967_0628308 3300045976 Bacteria 1061
174 Ga0466967_1320043 3300045976 Bacteria 718
175 Ga0495617_000466 3300046452 Bacteria 21733
176 Ga0495617_052091 3300046452 Bacteria 1360
177 Ga0495627_000277 3300046453 Bacteria 51556
178 Ga0495627_008570 3300046453 Bacteria 3820
179 Ga0495603_0060940 3300046455 Bacteria 2228
180 Ga0495590_0000544 3300046457 Bacteria 18083
181 Ga0495590_0005865 3300046457 Bacteria 4823
182 Ga0495590_0007474 3300046457 Bacteria 4213
183 Ga0495590_0022695 3300046457 Bacteria 2219
184 Ga0495590_0040253 3300046457 Bacteria 1630
185 Ga0495591_000616 3300046458 Bacteria 26709
186 Ga0495591_076532 3300046458 Bacteria 859
187 Ga0495629_0075381 3300046459 Bacteria 2356
188 Ga0495629_0656502 3300046459 Bacteria 698
189 Ga0495638_0314406 3300046460 Bacteria 839
190 Ga0495638_0460996 3300046460 Bacteria 647
191 Ga0495653_0008977 3300046463 Bacteria 8175
192 Ga0495653_0135784 3300046463 Bacteria 1735
193 Ga0495650_0081037 3300046471 Bacteria 1251
194 Ga0495580_0075326 3300046472 Bacteria 2354
195 Ga0495582_0005379 3300046473 Bacteria 7145
196 Ga0495582_0146516 3300046473 Bacteria 1339
197 Ga0495605_0000287 3300046474 Bacteria 55659
198 Ga0495605_0011315 3300046474 Bacteria 4983
199 Ga0495605_0033408 3300046474 Bacteria 2610
200 Ga0495605_0036812 3300046474 Bacteria 2465
201 Ga0495605_0037826 3300046474 Bacteria 2424
202 Ga0495605_0049566 3300046474 Bacteria 2051
203 Ga0495605_0207583 3300046474 Bacteria 851
204 Ga0495605_0230682 3300046474 Bacteria 797
205 Ga0495605_0340202 3300046474 Bacteria 630
206 Ga0495605_0362056 3300046474 Bacteria 607
207 Ga0495664_0185343 3300046477 Bacteria 1262
208 Ga0495584_0001128 3300046491 Bacteria 16543
209 Ga0495584_0002496 3300046491 Bacteria 10423
210 Ga0495584_0005016 3300046491 Bacteria 7048
211 Ga0495584_0027215 3300046491 Bacteria 2897
212 Ga0495584_0035080 3300046491 Bacteria 2535
213 Ga0495584_0037692 3300046491 Bacteria 2444
214 Ga0495584_0061575 3300046491 Bacteria 1886
215 Ga0495585_0000238 3300046492 Bacteria 57003
216 Ga0495585_0000277 3300046492 Bacteria 51354
217 Ga0495585_0005810 3300046492 Bacteria 7737
218 Ga0495585_0010611 3300046492 Bacteria 5475
219 Ga0495585_0034106 3300046492 Bacteria 2877
220 Ga0495585_0041271 3300046492 Bacteria 2588
221 Ga0495585_0057356 3300046492 Bacteria 2149
222 Ga0495585_0063290 3300046492 Bacteria 2030
223 Ga0495585_0247524 3300046492 Bacteria 890
224 Ga0495585_0330666 3300046492 Bacteria 743
225 Ga0495585_0341967 3300046492 Bacteria 728
226 Ga0495594_0017449 3300046499 Bacteria 3793
227 Ga0495594_0019945 3300046499 Bacteria 3567
228 Ga0495594_0085397 3300046499 Bacteria 1765
229 Ga0495594_0152573 3300046499 Bacteria 1312
230 Ga0495596_0006260 3300046500 Bacteria 5507
231 Ga0495596_0006538 3300046500 Bacteria 5353
232 Ga0495596_0006811 3300046500 Bacteria 5215
233 Ga0495596_0015483 3300046500 Bacteria 3192
234 Ga0495596_0022491 3300046500 Bacteria 2566
235 Ga0495596_0025595 3300046500 Bacteria 2384
236 Ga0495596_0039440 3300046500 Bacteria 1865
237 Ga0495596_0049795 3300046500 Bacteria 1642
238 Ga0495596_0050057 3300046500 Bacteria 1637
239 Ga0495596_0068223 3300046500 Bacteria 1382
240 Ga0495596_0091137 3300046500 Bacteria 1183
241 Ga0495596_0104599 3300046500 Bacteria 1099
242 Ga0495596_0105331 3300046500 Bacteria 1095
243 Ga0495596_0198591 3300046500 Bacteria 779
244 Ga0495596_0247707 3300046500 Bacteria 691
245 Ga0495607_0001165 3300046501 Bacteria 23774
246 Ga0495607_0003003 3300046501 Bacteria 13172
247 Ga0495607_0016351 3300046501 Bacteria 4787
248 Ga0495607_0020837 3300046501 Bacteria 4134
249 Ga0495607_0048728 3300046501 Bacteria 2475
250 Ga0495607_0049050 3300046501 Bacteria 2464
251 Ga0495607_0111909 3300046501 Bacteria 1446
252 Ga0495607_0192941 3300046501 Bacteria 1013
253 Ga0495583_0000214 3300046506 Bacteria 97639
254 Ga0495583_0001239 3300046506 Bacteria 27114
255 Ga0495583_0005144 3300046506 Bacteria 9012
256 Ga0495583_0005773 3300046506 Bacteria 8276
257 Ga0495583_0007334 3300046506 Bacteria 6957
258 Ga0495583_0007491 3300046506 Bacteria 6841
259 Ga0495583_0010060 3300046506 Bacteria 5570
260 Ga0495583_0052664 3300046506 Bacteria 1850
261 Ga0495583_0061092 3300046506 Bacteria 1682
262 Ga0495583_0083175 3300046506 Bacteria 1388
263 Ga0495583_0244499 3300046506 Bacteria 720
264 Ga0495606_0008015 3300046507 Bacteria 9282
265 Ga0495606_0038321 3300046507 Bacteria 3244
266 Ga0495606_0170152 3300046507 Bacteria 1264
267 Ga0495606_0185825 3300046507 Bacteria 1195
268 Ga0495606_0256782 3300046507 Bacteria 967
269 Ga0495606_0273289 3300046507 Bacteria 927
270 Ga0495606_0416147 3300046507 Bacteria 696
271 Ga0495606_0440593 3300046507 Bacteria 669
272 Ga0495606_0444372 3300046507 Bacteria 665
273 Ga0495606_0592886 3300046507 Bacteria 545
274 Ga0495610_0007535 3300046512 Bacteria 7213
275 Ga0495610_0130613 3300046512 Bacteria 1091
276 Ga0495610_0253412 3300046512 Bacteria 696
277 Ga0495616_0001092 3300046513 Bacteria 19273
278 Ga0495616_0001292 3300046513 Bacteria 17583
279 Ga0495616_0018791 3300046513 Bacteria 3785
280 Ga0495616_0019317 3300046513 Bacteria 3719
281 Ga0495616_0022127 3300046513 Bacteria 3435
282 Ga0495616_0032926 3300046513 Bacteria 2704
283 Ga0495616_0038471 3300046513 Bacteria 2455
284 Ga0495616_0039417 3300046513 Bacteria 2420
285 Ga0495616_0051863 3300046513 Bacteria 2044
286 Ga0495616_0061424 3300046513 Bacteria 1842
287 Ga0495616_0069722 3300046513 Bacteria 1703
288 Ga0495616_0087557 3300046513 Bacteria 1479
289 Ga0495616_0098207 3300046513 Bacteria 1376
290 Ga0495616_0157230 3300046513 Bacteria 1024
291 Ga0495631_0005742 3300046518 Bacteria 6474
292 Ga0495631_0019314 3300046518 Bacteria 3196
293 Ga0495631_0019676 3300046518 Bacteria 3165
294 Ga0495631_0024666 3300046518 Bacteria 2776
295 Ga0495631_0027013 3300046518 Bacteria 2630
296 Ga0495631_0027346 3300046518 Bacteria 2611
297 Ga0495631_0050952 3300046518 Bacteria 1809
298 Ga0495631_0053945 3300046518 Bacteria 1753
299 Ga0495631_0079971 3300046518 Bacteria 1410
300 Ga0495631_0339198 3300046518 Bacteria 639
301 Ga0495632_0001074 3300046519 Bacteria 23458
302 Ga0495632_0002651 3300046519 Bacteria 13436
303 Ga0495632_0003276 3300046519 Bacteria 11566
304 Ga0495632_0007442 3300046519 Bacteria 6876
305 Ga0495632_0038256 3300046519 Bacteria 2430
306 Ga0495632_0039524 3300046519 Bacteria 2380
307 Ga0495632_0047212 3300046519 Bacteria 2136
308 Ga0495632_0162219 3300046519 Bacteria 1029
309 Ga0495637_0000515 3300046520 Bacteria 28094
310 Ga0495637_0025918 3300046520 Bacteria 2638
311 Ga0495637_0026438 3300046520 Bacteria 2605
312 Ga0495643_0001824 3300046522 Bacteria 18120
313 Ga0495643_0037273 3300046522 Bacteria 2668
314 Ga0495643_0060957 3300046522 Bacteria 2001
315 Ga0495643_0073953 3300046522 Bacteria 1785
316 Ga0495643_0112199 3300046522 Bacteria 1385
317 Ga0495643_0150663 3300046522 Bacteria 1152
318 Ga0495643_0220312 3300046522 Bacteria 900
319 Ga0495643_0426897 3300046522 Bacteria 580
320 Ga0495644_0002217 3300046523 Bacteria 7770
321 Ga0495644_0011576 3300046523 Bacteria 3395
322 Ga0495648_0000183 3300046524 Bacteria 72118
323 Ga0495648_0011887 3300046524 Bacteria 6530
324 Ga0495648_0017788 3300046524 Bacteria 5067
325 Ga0495648_0018176 3300046524 Bacteria 4993
326 Ga0495648_0024858 3300046524 Bacteria 4067
327 Ga0495648_0257745 3300046524 Bacteria 838
328 Ga0495663_0143781 3300046525 Bacteria 811
329 Ga0495666_0059601 3300046526 Bacteria 1825
330 Ga0495642_0000587 3300046528 Bacteria 18236
331 Ga0495642_0000876 3300046528 Bacteria 14202
332 Ga0495642_0001506 3300046528 Bacteria 10368
333 Ga0495642_0014586 3300046528 Bacteria 3045
334 Ga0495642_0034869 3300046528 Bacteria 2028
335 Ga0495642_0057083 3300046528 Bacteria 1613
336 Ga0495642_0107619 3300046528 Bacteria 1190
337 Ga0495642_0184796 3300046528 Bacteria 907
338 Ga0495642_0350997 3300046528 Bacteria 648
339 Ga0495652_0008714 3300046529 Bacteria 9243
340 Ga0495654_0002229 3300046530 Bacteria 12557
341 Ga0495654_0013265 3300046530 Bacteria 4413
342 Ga0495654_0037295 3300046530 Bacteria 2438
343 Ga0495654_0099843 3300046530 Bacteria 1337
344 Ga0495665_0077528 3300046531 Bacteria 1749
345 Ga0495665_0105118 3300046531 Bacteria 1481
346 Ga0495665_0350522 3300046531 Bacteria 752
347 Ga0495586_0001555 3300046535 Bacteria 12666
348 Ga0495586_0039620 3300046535 Bacteria 2533
349 Ga0495587_0090162 3300046536 Bacteria 1771
350 Ga0495609_0000007 3300046538 Bacteria 398812
351 Ga0495609_0011444 3300046538 Bacteria 4225
352 Ga0495609_0027527 3300046538 Bacteria 2597
353 Ga0495609_0068859 3300046538 Bacteria 1557
354 Ga0495609_0090192 3300046538 Bacteria 1333
355 Ga0495609_0096547 3300046538 Bacteria 1282
356 Ga0495609_0104356 3300046538 Bacteria 1226
357 Ga0495609_0111701 3300046538 Bacteria 1179
358 Ga0495609_0156274 3300046538 Bacteria 968
359 Ga0495609_0168406 3300046538 Bacteria 926
360 Ga0495597_0000907 3300046542 Bacteria 22980
361 Ga0495597_0002989 3300046542 Bacteria 10218
362 Ga0495597_0003023 3300046542 Bacteria 10143
363 Ga0495597_0006706 3300046542 Bacteria 5927
364 Ga0495597_0012640 3300046542 Bacteria 4066
365 Ga0495597_0030880 3300046542 Bacteria 2439
366 Ga0495597_0069208 3300046542 Bacteria 1524
367 Ga0495597_0397482 3300046542 Bacteria 524
368 Ga0495645_0046884 3300046543 Bacteria 3150
369 Ga0495633_0006720 3300046558 Bacteria 6769
370 Ga0495633_0007463 3300046558 Bacteria 6289
371 Ga0495633_0038614 3300046558 Bacteria 2280
372 Ga0495656_0054362 3300046615 Bacteria 1723
373 Ga0495656_0088650 3300046615 Bacteria 1411
374 Ga0495656_0113582 3300046615 Bacteria 1270
375 Ga0495656_0335370 3300046615 Bacteria 781
376 Ga0495656_0352888 3300046615 Bacteria 762
377 Ga0495668_0075330 3300046616 Bacteria 1853
378 Ga0495668_0084792 3300046616 Bacteria 1737
379 Ga0495668_0092112 3300046616 Bacteria 1660
380 Ga0495668_0108365 3300046616 Bacteria 1519
381 Ga0495668_0116869 3300046616 Bacteria 1458
382 Ga0495668_0123207 3300046616 Bacteria 1418
383 Ga0495668_0489721 3300046616 Bacteria 677
384 Ga0495668_0661465 3300046616 Bacteria 577
385 Ga0495634_0009917 3300046642 Bacteria 7000
386 Ga0495634_0579824 3300046642 Bacteria 652
387 Ga0495611_0022060 3300046648 Bacteria 2753
388 Ga0495611_0023396 3300046648 Bacteria 2680
389 Ga0495611_0036771 3300046648 Bacteria 2174
390 Ga0495625_0017251 3300046660 Bacteria 5653
391 Ga0495625_0462326 3300046660 Bacteria 782
392 Ga0495625_0650665 3300046660 Bacteria 627
393 Ga0495635_0095149 3300046663 Bacteria 2036
394 Ga0495659_0260531 3300046664 Bacteria 725
395 Ga0495661_0000549 3300046665 Bacteria 38859
396 Ga0495661_0000788 3300046665 Bacteria 30104
397 Ga0495661_0004283 3300046665 Bacteria 10356
398 Ga0495661_0006055 3300046665 Bacteria 8522
399 Ga0495661_0007313 3300046665 Bacteria 7696
400 Ga0495661_0007500 3300046665 Bacteria 7604
401 Ga0495661_0007508 3300046665 Bacteria 7599
402 Ga0495661_0053465 3300046665 Bacteria 2428
403 Ga0495661_0129199 3300046665 Bacteria 1386
404 Ga0495661_0148040 3300046665 Bacteria 1270
405 Ga0495661_0207058 3300046665 Bacteria 1023
406 Ga0495661_0211905 3300046665 Bacteria 1008
407 Ga0495661_0230063 3300046665 Bacteria 956
408 Ga0495661_0241000 3300046665 Bacteria 927
409 Ga0495661_0294219 3300046665 Bacteria 814
410 Ga0495661_0452574 3300046665 Bacteria 617
411 Ga0495588_0000147 3300046674 Bacteria 100948
412 Ga0495588_0022311 3300046674 Bacteria 3128
413 Ga0495588_0030784 3300046674 Bacteria 2698
414 Ga0495588_0042820 3300046674 Bacteria 2315
415 Ga0495588_0116588 3300046674 Bacteria 1407
416 Ga0495588_0123236 3300046674 Bacteria 1366
417 Ga0495588_0526690 3300046674 Bacteria 619
418 Ga0495623_0064545 3300046679 Bacteria 2291
419 Ga0495623_0641644 3300046679 Bacteria 548
420 Ga0495669_0000073 3300046684 Bacteria 66387
421 Ga0495669_0007961 3300046684 Bacteria 4446
422 Ga0495669_0013494 3300046684 Bacteria 3482
423 Ga0495669_0022023 3300046684 Bacteria 2768
424 Ga0495669_0053640 3300046684 Bacteria 1813
425 Ga0495669_0134218 3300046684 Bacteria 1166
426 Ga0495669_0152240 3300046684 Bacteria 1095
427 Ga0495613_0013800 3300046689 Bacteria 5993
428 Ga0495613_0148813 3300046689 Bacteria 1671
429 Ga0495624_0313791 3300046690 Bacteria 945
430 Ga0495624_0431736 3300046690 Bacteria 790
431 Ga0495670_0001254 3300046691 Bacteria 12410
432 Ga0495670_0047066 3300046691 Bacteria 2155
433 Ga0495670_0164853 3300046691 Bacteria 1165
434 Ga0495670_0231564 3300046691 Bacteria 982
435 Ga0495671_0001460 3300046692 Bacteria 15858
436 Ga0495671_0013677 3300046692 Bacteria 4386
437 Ga0495649_0001335 3300046694 Bacteria 18749
438 Ga0495649_0004497 3300046694 Bacteria 9101
439 Ga0495649_0032115 3300046694 Bacteria 2894
440 Ga0495649_0047614 3300046694 Bacteria 2331
441 Ga0495649_0062342 3300046694 Bacteria 2004
442 Ga0495649_0141837 3300046694 Bacteria 1264
443 Ga0495649_0355805 3300046694 Bacteria 739
444 Ga0495649_0586445 3300046694 Bacteria 550
445 Ga0495589_0001254 3300046794 Bacteria 15030
446 Ga0495589_0002015 3300046794 Bacteria 11503
447 Ga0495589_0002358 3300046794 Bacteria 10595
448 Ga0495589_0021525 3300046794 Bacteria 3294
449 Ga0495589_0032548 3300046794 Bacteria 2621
450 Ga0495589_0037629 3300046794 Bacteria 2423
451 Ga0495589_0073972 3300046794 Bacteria 1662
452 Ga0495589_0098554 3300046794 Bacteria 1415
453 Ga0495589_0114170 3300046794 Bacteria 1302
454 Ga0495600_0025351 3300046809 Bacteria 3822
455 Ga0495660_0000101 3300046810 Bacteria 91466
456 Ga0495660_0007239 3300046810 Bacteria 6532
457 Ga0495660_0010073 3300046810 Bacteria 5498
458 Ga0495660_0024843 3300046810 Bacteria 3408
459 Ga0495660_0029448 3300046810 Bacteria 3097
460 Ga0495660_0055250 3300046810 Bacteria 2150
461 Ga0495660_0127034 3300046810 Bacteria 1283
462 Ga0495660_0192952 3300046810 Bacteria 977
463 Ga0495660_0205199 3300046810 Bacteria 938
464 Ga0495581_0367635 3300047315 Bacteria 840
465 Ga0495604_0114051 3300047317 Bacteria 1966
466 Ga0495604_0148860 3300047317 Bacteria 1665
467 Ga0495604_0332361 3300047317 Bacteria 1013
468 Ga0495636_0008528 3300047318 Bacteria 4045
469 Ga0495672_0000135 3300047320 Bacteria 110114
470 Ga0495672_0000348 3300047320 Bacteria 59143
471 Ga0495672_0003446 3300047320 Bacteria 13529
472 Ga0495672_0042359 3300047320 Bacteria 2746
473 Ga0495672_0097209 3300047320 Bacteria 1604
474 Ga0495672_0346918 3300047320 Bacteria 690
475 Ga0495676_0000221 3300047321 Bacteria 45708
476 Ga0495680_0048458 3300047322 Bacteria 3336
477 Ga0495680_0306255 3300047322 Bacteria 1114
478 Ga0495683_0001121 3300047323 Bacteria 18461
479 Ga0495683_0016136 3300047323 Bacteria 3879
480 Ga0495683_0019747 3300047323 Bacteria 3476
481 Ga0495683_0036557 3300047323 Bacteria 2492
482 Ga0495683_0145271 3300047323 Bacteria 1108
483 Ga0495683_0156055 3300047323 Bacteria 1058
484 Ga0495683_0189716 3300047323 Bacteria 933
485 Ga0495683_0404759 3300047323 Bacteria 566
486 Ga0495687_000120 3300047443 Bacteria 120987
487 Ga0495687_000374 3300047443 Bacteria 55800
488 Ga0495687_002263 3300047443 Bacteria 15785
489 Ga0495687_005087 3300047443 Bacteria 8535
490 Ga0495687_113667 3300047443 Bacteria 990
491 Ga0495675_0007931 3300047444 Bacteria 6562
492 Ga0495675_0014225 3300047444 Bacteria 5030
493 Ga0495675_0213066 3300047444 Bacteria 1172
494 Ga0495675_0412973 3300047444 Bacteria 785
495 Ga0495677_0000045 3300047445 Bacteria 73995
496 Ga0495677_0001255 3300047445 Bacteria 10158
497 Ga0495677_0003603 3300047445 Bacteria 6008
498 Ga0495677_0003854 3300047445 Bacteria 5798
499 Ga0495677_0021651 3300047445 Bacteria 2330
500 Ga0495677_0036068 3300047445 Bacteria 1805
501 Ga0495677_0043020 3300047445 Bacteria 1655
502 Ga0495677_0091737 3300047445 Bacteria 1145
503 Ga0495677_0112414 3300047445 Bacteria 1036
504 Ga0495677_0136304 3300047445 Bacteria 941
505 Ga0495677_0148719 3300047445 Bacteria 901
506 Ga0495677_0332957 3300047445 Bacteria 599
507 Ga0495679_002165 3300047446 Bacteria 10314
508 Ga0495679_003747 3300047446 Bacteria 7231
509 Ga0495679_054991 3300047446 Bacteria 1183
510 Ga0495685_001117 3300047447 Bacteria 8204
511 Ga0495685_222885 3300047447 Bacteria 601
512 Ga0495681_0002281 3300047470 Bacteria 13792
513 Ga0495681_0004090 3300047470 Bacteria 10030
514 Ga0495681_0005907 3300047470 Bacteria 8121
515 Ga0495681_0020045 3300047470 Bacteria 3636
516 Ga0495681_0070936 3300047470 Bacteria 1578
517 Ga0495681_0074489 3300047470 Bacteria 1530
518 Ga0495681_0189641 3300047470 Bacteria 840
519 Ga0495686_0000793 3300047472 Bacteria 41237
520 Ga0495686_0001487 3300047472 Bacteria 25415
521 Ga0495686_0143291 3300047472 Bacteria 1408
522 Ga0495686_0202183 3300047472 Bacteria 1139
523 Ga0495593_0040264 3300047673 Bacteria 2516
524 Ga0495593_0152562 3300047673 Bacteria 1168
525 Ga0495602_0003238 3300048088 Bacteria 16812
526 Ga0495602_0694436 3300048088 Bacteria 691
527 Ga0495614_0011189 3300048089 Bacteria 3948
528 Ga0495614_0012606 3300048089 Bacteria 3708
529 Ga0495614_0073687 3300048089 Bacteria 1474
530 Ga0495626_0000022 3300048091 Bacteria 216166
531 Ga0495626_0000105 3300048091 Bacteria 109725
532 Ga0495626_0001496 3300048091 Bacteria 18442
533 Ga0495626_0001844 3300048091 Bacteria 15924
534 Ga0495626_0004240 3300048091 Bacteria 8859
535 Ga0495626_0005642 3300048091 Bacteria 7249
536 Ga0495626_0011488 3300048091 Bacteria 4682
537 Ga0495626_0043799 3300048091 Bacteria 2098
538 Ga0495626_0050099 3300048091 Bacteria 1930
539 Ga0495626_0177540 3300048091 Bacteria 884
540 Ga0495626_0182385 3300048091 Bacteria 869
541 Ga0495626_0211114 3300048091 Bacteria 792
542 Ga0495626_0211422 3300048091 Bacteria 791
543 Ga0495626_0216563 3300048091 Bacteria 779
544 Ga0495626_0228042 3300048091 Bacteria 754
545 Ga0495626_0342489 3300048091 Bacteria 584
546 Ga0495626_0348573 3300048091 Bacteria 578
547 Ga0496100_0950857 3300048903 Bacteria 675
548 Ga0496102_0001960 3300048905 Bacteria 17748
549 Ga0496102_0152842 3300048905 Bacteria 2169
550 Ga0496102_0204254 3300048905 Bacteria 1862
551 Ga0496102_0242840 3300048905 Bacteria 1698
552 Ga0496102_0577158 3300048905 Bacteria 1047
553 Ga0496102_0919227 3300048905 Bacteria 796
554 Ga0496103_0091411 3300048906 Bacteria 1920
555 Ga0496103_0193524 3300048906 Bacteria 1307
556 Ga0496103_0388645 3300048906 Bacteria 896
557 Ga0496104_0879099 3300048907 Bacteria 801
558 Ga0496105_0137202 3300048908 Bacteria 2015
559 Ga0496105_0264694 3300048908 Bacteria 1390
560 Ga0496106_0297712 3300048909 Bacteria 1293
561 Ga0496106_0892748 3300048909 Bacteria 702
562 Ga0496107_0131540 3300048910 Bacteria 1847
563 Ga0496108_0396245 3300048911 Bacteria 1206
564 Ga0496109_0671119 3300048912 Bacteria 974
565 Ga0496110_0003614 3300048913 Bacteria 11901
566 Ga0496110_0599530 3300048913 Bacteria 999
567 Ga0496111_0238705 3300048914 Bacteria 1350
568 Ga0496111_0557229 3300048914 Bacteria 841
569 Ga0496111_0807245 3300048914 Bacteria 679
570 Ga0496112_0955598 3300048915 Bacteria 778
571 Ga0496113_0030974 3300048916 Bacteria 3877
572 Ga0496113_0403960 3300048916 Bacteria 1097
573 Ga0496114_0449924 3300048917 Bacteria 1141
574 Ga0496122_0004630 3300048925 Bacteria 16923
575 Ga0496122_0015745 3300048925 Bacteria 7208
576 Ga0496123_0006523 3300048926 Bacteria 11271
577 Ga0496123_0100870 3300048926 Bacteria 1680
578 Ga0496124_0012160 3300048927 Bacteria 8521
579 Ga0496124_0018898 3300048927 Bacteria 6434
580 Ga0496124_0127563 3300048927 Bacteria 2025
581 Ga0496124_0151942 3300048927 Bacteria 1815
582 Ga0496124_0187301 3300048927 Bacteria 1587
583 Ga0496125_0453832 3300048928 Bacteria 733
584 Ga0501308_000350 3300049128 Bacteria 2897
585 Ga0501304_002430 3300049160 Bacteria 1294
586 Ga0495678_000190 3300049459 Bacteria 71878
587 Ga0495678_000774 3300049459 Bacteria 28808
588 Ga0495678_002527 3300049459 Bacteria 12310
589 Ga0495678_007129 3300049459 Bacteria 5840
590 Ga0495678_056319 3300049459 Bacteria 1495
591 Ga0495682_0005671 3300049460 Bacteria 5157
592 Ga0495682_0029644 3300049460 Bacteria 2027
593 Ga0495682_0036861 3300049460 Bacteria 1799
594 Ga0495682_0085336 3300049460 Bacteria 1134
595 Ga0501036_0590043 3300049572 Bacteria 922
596 Ga0501044_0595423 3300049823 Bacteria 999
597 Ga0466962_0091299 3300061719 Bacteria 1459
598 2643799524 2643221556 Bacteria 7251154
599 2644471614 2643221684 Bacteria 7145183
600 2809145767 2808606418 Bacteria 6724496
601 8047675979 8047673197 Bacteria 7395230
602 Ga0439458_0004641
603 Ga0007409J51694_1013470
604 Ga0032354_1042837
605 Ga0055525_1000018
606 Ga0055542_1015878
607 Ga0065165_1000379
608 Ga0065165_1053034
609 Ga0065715_10199869
610 Ga0070658_10134700
611 Ga0070658_11010205
612 Ga0070658_11101995
613 Ga0070680_100632139
614 Ga0070682_100333539
615 Ga0070660_100137046
616 Ga0070660_100205691
617 Ga0070660_100728141
618 Ga0070661_100043062
619 Ga0070661_101638089
620 Ga0070671_100501518
621 Ga0070659_100026607
622 Ga0070659_100208459
623 Ga0070662_100691228
624 Ga0068855_100208353
625 Ga0068855_100471400
626 Ga0068855_100539669
627 Ga0068855_101746040
628 Ga0070664_100059787
629 Ga0068856_100874905
630 Ga0068852_100024945
631 Ga0068870_10556558
632 Ga0105244_10207568
633 Ga0105243_10007642
634 Ga0105241_10216300
635 Ga0105242_10031922
636 Ga0105242_10447693
637 Ga0105239_10555113
638 Ga0157369_10480146
639 Ga0157378_10480079
640 Ga0157372_10983589
641 Ga0182008_10025031
642 Ga0182006_1028835
643 Ga0182006_1148069
644 Ga0182007_10047235
645 Ga0209563_100011
646 Ga0209677_101104
647 Ga0209148_1001117
648 Ga0207645_10112107
649 Ga0207705_10029157
650 Ga0207705_10452008
651 Ga0207654_10011758
652 Ga0207657_10209878
653 Ga0207657_10239267
654 Ga0207657_10742771
655 Ga0207649_10199624
656 Ga0207652_10899905
657 Ga0207690_10060055
658 Ga0207690_10243059
659 Ga0207706_10043544
660 Ga0207706_10088647
661 Ga0207686_10005763
662 Ga0207709_10054685
663 Ga0207679_10016424
664 Ga0207679_10021615
665 Ga0207667_10250373
666 Ga0207667_10712529
667 Ga0207667_11332366
668 Ga0207639_11033957
669 Ga0207678_10353221
670 Ga0207702_10432259
671 Ga0207674_11266380
672 Ga0207698_10645214
673 Ga0316182_1336222
674 Ga0395899_0022570
675 Ga0395899_0066738
676 Ga0395899_0128703
677 Ga0395899_0137945
678 Ga0395899_0195932
679 Ga0395899_0258860
680 Ga0395899_0309688
681 Ga0395899_0344425
682 Ga0395899_0581847
683 Ga0395899_0648258
684 Ga0395900_0000715
685 Ga0395900_0001341
686 Ga0395900_0075574
687 Ga0395900_0257808
688 Ga0395900_0283298
689 Ga0395900_0379585
690 Ga0395900_0585381
691 Ga0395900_0734566
692 Ga0395900_1216639
693 Ga0395900_1459456
694 Ga0395900_1467591
695 Ga0395898_0065139
696 Ga0395898_0368665
697 Ga0395898_0409541
698 Ga0395898_0570955
699 Ga0395898_0740416
700 Ga0395898_0807185
701 Ga0395898_1212898
702 Ga0395898_1333020
703 Ga0395905_0034925
704 Ga0395905_0066219
705 Ga0395905_0205575
706 Ga0395905_0232557
707 Ga0395905_0270079
708 Ga0395905_0417526
709 Ga0395905_0820128
710 Ga0395905_0904853
711 Ga0395901_0000943
712 Ga0395901_0005142
713 Ga0395901_0098508
714 Ga0395901_0248303
715 Ga0395901_0649360
716 Ga0395901_0849158
717 Ga0395901_1005621
718 Ga0395901_1020690
719 Ga0395901_1201370
720 Ga0395901_1269839
721 Ga0395901_1371011
722 Ga0439448_0000737
723 Ga0439448_0004703
724 Ga0439449_0030932
725 Ga0439455_0007055
726 Ga0439455_0114495
727 Ga0439458_0035593
728 Ga0439458_0085308
729 Ga0439458_0094653
730 Ga0466969_0047834
731 Ga0466969_0216079
732 Ga0466969_0226594
733 Ga0466969_0239247
734 Ga0466969_0348603
735 Ga0466972_0000359
736 Ga0466972_0086714
737 Ga0466972_0365727
738 Ga0466965_0015260
739 Ga0466965_0057378
740 Ga0466965_0059994
741 Ga0466965_0131850
742 Ga0466966_0041014
743 Ga0466966_0283885
744 Ga0466966_0623291
745 Ga0466961_0042612
746 Ga0466961_0391919
747 Ga0466961_0552525
748 Ga0466963_0383624
749 Ga0466964_0008270
750 Ga0466964_0026894
751 Ga0466964_0163960
752 Ga0466971_0069265
753 Ga0466971_0119666
754 Ga0466971_0376445
755 Ga0466971_0431661
756 Ga0466968_0026488
757 Ga0466970_0503519
758 Ga0466957_0002970
759 Ga0466957_0034542
760 Ga0466957_0157834
761 Ga0466957_0229915
762 Ga0466957_0316348
763 Ga0466957_0679870
764 Ga0466957_0796257
765 Ga0466960_0098021
766 Ga0466960_0139562
767 Ga0466960_0206241
768 Ga0466959_0059019
769 Ga0466959_0279735
770 Ga0466959_0614730
771 Ga0466958_0116044
772 Ga0466967_0017377
773 Ga0466967_0058766
774 Ga0466967_0628308
775 Ga0466967_1320043
776 Ga0495617_000466
777 Ga0495617_052091
778 Ga0495627_000277
779 Ga0495627_008570
780 Ga0495603_0060940
781 Ga0495590_0000544
782 Ga0495590_0005865
783 Ga0495590_0007474
784 Ga0495590_0022695
785 Ga0495590_0040253
786 Ga0495591_000616
787 Ga0495591_076532
788 Ga0495629_0075381
789 Ga0495629_0656502
790 Ga0495638_0314406
791 Ga0495638_0460996
792 Ga0495653_0008977
793 Ga0495653_0135784
794 Ga0495650_0081037
795 Ga0495580_0075326
796 Ga0495582_0005379
797 Ga0495582_0146516
798 Ga0495605_0000287
799 Ga0495605_0011315
800 Ga0495605_0033408
801 Ga0495605_0036812
802 Ga0495605_0037826
803 Ga0495605_0049566
804 Ga0495605_0207583
805 Ga0495605_0230682
806 Ga0495605_0340202
807 Ga0495605_0362056
808 Ga0495664_0185343
809 Ga0495584_0001128
810 Ga0495584_0002496
811 Ga0495584_0005016
812 Ga0495584_0027215
813 Ga0495584_0035080
814 Ga0495584_0037692
815 Ga0495584_0061575
816 Ga0495585_0000238
817 Ga0495585_0000277
818 Ga0495585_0005810
819 Ga0495585_0010611
820 Ga0495585_0034106
821 Ga0495585_0041271
822 Ga0495585_0057356
823 Ga0495585_0063290
824 Ga0495585_0247524
825 Ga0495585_0330666
826 Ga0495585_0341967
827 Ga0495594_0017449
828 Ga0495594_0019945
829 Ga0495594_0085397
830 Ga0495594_0152573
831 Ga0495596_0006260
832 Ga0495596_0006538
833 Ga0495596_0006811
834 Ga0495596_0015483
835 Ga0495596_0022491
836 Ga0495596_0025595
837 Ga0495596_0039440
838 Ga0495596_0049795
839 Ga0495596_0050057
840 Ga0495596_0068223
841 Ga0495596_0091137
842 Ga0495596_0104599
843 Ga0495596_0105331
844 Ga0495596_0198591
845 Ga0495596_0247707
846 Ga0495607_0001165
847 Ga0495607_0003003
848 Ga0495607_0016351
849 Ga0495607_0020837
850 Ga0495607_0048728
851 Ga0495607_0049050
852 Ga0495607_0111909
853 Ga0495607_0192941
854 Ga0495583_0000214
855 Ga0495583_0001239
856 Ga0495583_0005144
857 Ga0495583_0005773
858 Ga0495583_0007334
859 Ga0495583_0007491
860 Ga0495583_0010060
861 Ga0495583_0052664
862 Ga0495583_0061092
863 Ga0495583_0083175
864 Ga0495583_0244499
865 Ga0495606_0008015
866 Ga0495606_0038321
867 Ga0495606_0170152
868 Ga0495606_0185825
869 Ga0495606_0256782
870 Ga0495606_0273289
871 Ga0495606_0416147
872 Ga0495606_0440593
873 Ga0495606_0444372
874 Ga0495606_0592886
875 Ga0495610_0007535
876 Ga0495610_0130613
877 Ga0495610_0253412
878 Ga0495616_0001092
879 Ga0495616_0001292
880 Ga0495616_0018791
881 Ga0495616_0019317
882 Ga0495616_0022127
883 Ga0495616_0032926
884 Ga0495616_0038471
885 Ga0495616_0039417
886 Ga0495616_0051863
887 Ga0495616_0061424
888 Ga0495616_0069722
889 Ga0495616_0087557
890 Ga0495616_0098207
891 Ga0495616_0157230
892 Ga0495631_0005742
893 Ga0495631_0019314
894 Ga0495631_0019676
895 Ga0495631_0024666
896 Ga0495631_0027013
897 Ga0495631_0027346
898 Ga0495631_0050952
899 Ga0495631_0053945
900 Ga0495631_0079971
901 Ga0495631_0339198
902 Ga0495632_0001074
903 Ga0495632_0002651
904 Ga0495632_0003276
905 Ga0495632_0007442
906 Ga0495632_0038256
907 Ga0495632_0039524
908 Ga0495632_0047212
909 Ga0495632_0162219
910 Ga0495637_0000515
911 Ga0495637_0025918
912 Ga0495637_0026438
913 Ga0495643_0001824
914 Ga0495643_0037273
915 Ga0495643_0060957
916 Ga0495643_0073953
917 Ga0495643_0112199
918 Ga0495643_0150663
919 Ga0495643_0220312
920 Ga0495643_0426897
921 Ga0495644_0002217
922 Ga0495644_0011576
923 Ga0495648_0000183
924 Ga0495648_0011887
925 Ga0495648_0017788
926 Ga0495648_0018176
927 Ga0495648_0024858
928 Ga0495648_0257745
929 Ga0495663_0143781
930 Ga0495666_0059601
931 Ga0495642_0000587
932 Ga0495642_0000876
933 Ga0495642_0001506
934 Ga0495642_0014586
935 Ga0495642_0034869
936 Ga0495642_0057083
937 Ga0495642_0107619
938 Ga0495642_0184796
939 Ga0495642_0350997
940 Ga0495652_0008714
941 Ga0495654_0002229
942 Ga0495654_0013265
943 Ga0495654_0037295
944 Ga0495654_0099843
945 Ga0495665_0077528
946 Ga0495665_0105118
947 Ga0495665_0350522
948 Ga0495586_0001555
949 Ga0495586_0039620
950 Ga0495587_0090162
951 Ga0495609_0000007
952 Ga0495609_0011444
953 Ga0495609_0027527
954 Ga0495609_0068859
955 Ga0495609_0090192
956 Ga0495609_0096547
957 Ga0495609_0104356
958 Ga0495609_0111701
959 Ga0495609_0156274
960 Ga0495609_0168406
961 Ga0495597_0000907
962 Ga0495597_0002989
963 Ga0495597_0003023
964 Ga0495597_0006706
965 Ga0495597_0012640
966 Ga0495597_0030880
967 Ga0495597_0069208
968 Ga0495597_0397482
969 Ga0495645_0046884
970 Ga0495633_0006720
971 Ga0495633_0007463
972 Ga0495633_0038614
973 Ga0495656_0054362
974 Ga0495656_0088650
975 Ga0495656_0113582
976 Ga0495656_0335370
977 Ga0495656_0352888
978 Ga0495668_0075330
979 Ga0495668_0084792
980 Ga0495668_0092112
981 Ga0495668_0108365
982 Ga0495668_0116869
983 Ga0495668_0123207
984 Ga0495668_0489721
985 Ga0495668_0661465
986 Ga0495634_0009917
987 Ga0495634_0579824
988 Ga0495611_0022060
989 Ga0495611_0023396
990 Ga0495611_0036771
991 Ga0495625_0017251
992 Ga0495625_0462326
993 Ga0495625_0650665
994 Ga0495635_0095149
995 Ga0495659_0260531
996 Ga0495661_0000549
997 Ga0495661_0000788
998 Ga0495661_0004283
999 Ga0495661_0006055
1000 Ga0495661_0007313
1001 Ga0495661_0007500
1002 Ga0495661_0007508
1003 Ga0495661_0053465
1004 Ga0495661_0129199
1005 Ga0495661_0148040
1006 Ga0495661_0207058
1007 Ga0495661_0211905
1008 Ga0495661_0230063
1009 Ga0495661_0241000
1010 Ga0495661_0294219
1011 Ga0495661_0452574
1012 Ga0495588_0000147
1013 Ga0495588_0022311
1014 Ga0495588_0030784
1015 Ga0495588_0042820
1016 Ga0495588_0116588
1017 Ga0495588_0123236
1018 Ga0495588_0526690
1019 Ga0495623_0064545
1020 Ga0495623_0641644
1021 Ga0495669_0000073
1022 Ga0495669_0007961
1023 Ga0495669_0013494
1024 Ga0495669_0022023
1025 Ga0495669_0053640
1026 Ga0495669_0134218
1027 Ga0495669_0152240
1028 Ga0495613_0013800
1029 Ga0495613_0148813
1030 Ga0495624_0313791
1031 Ga0495624_0431736
1032 Ga0495670_0001254
1033 Ga0495670_0047066
1034 Ga0495670_0164853
1035 Ga0495670_0231564
1036 Ga0495671_0001460
1037 Ga0495671_0013677
1038 Ga0495649_0001335
1039 Ga0495649_0004497
1040 Ga0495649_0032115
1041 Ga0495649_0047614
1042 Ga0495649_0062342
1043 Ga0495649_0141837
1044 Ga0495649_0355805
1045 Ga0495649_0586445
1046 Ga0495589_0001254
1047 Ga0495589_0002015
1048 Ga0495589_0002358
1049 Ga0495589_0021525
1050 Ga0495589_0032548
1051 Ga0495589_0037629
1052 Ga0495589_0073972
1053 Ga0495589_0098554
1054 Ga0495589_0114170
1055 Ga0495600_0025351
1056 Ga0495660_0000101
1057 Ga0495660_0007239
1058 Ga0495660_0010073
1059 Ga0495660_0024843
1060 Ga0495660_0029448
1061 Ga0495660_0055250
1062 Ga0495660_0127034
1063 Ga0495660_0192952
1064 Ga0495660_0205199
1065 Ga0495581_0367635
1066 Ga0495604_0114051
1067 Ga0495604_0148860
1068 Ga0495604_0332361
1069 Ga0495636_0008528
1070 Ga0495672_0000135
1071 Ga0495672_0000348
1072 Ga0495672_0003446
1073 Ga0495672_0042359
1074 Ga0495672_0097209
1075 Ga0495672_0346918
1076 Ga0495676_0000221
1077 Ga0495680_0048458
1078 Ga0495680_0306255
1079 Ga0495683_0001121
1080 Ga0495683_0016136
1081 Ga0495683_0019747
1082 Ga0495683_0036557
1083 Ga0495683_0145271
1084 Ga0495683_0156055
1085 Ga0495683_0189716
1086 Ga0495683_0404759
1087 Ga0495687_000120
1088 Ga0495687_000374
1089 Ga0495687_002263
1090 Ga0495687_005087
1091 Ga0495687_113667
1092 Ga0495675_0007931
1093 Ga0495675_0014225
1094 Ga0495675_0213066
1095 Ga0495675_0412973
1096 Ga0495677_0000045
1097 Ga0495677_0001255
1098 Ga0495677_0003603
1099 Ga0495677_0003854
1100 Ga0495677_0021651
1101 Ga0495677_0036068
1102 Ga0495677_0043020
1103 Ga0495677_0091737
1104 Ga0495677_0112414
1105 Ga0495677_0136304
1106 Ga0495677_0148719
1107 Ga0495677_0332957
1108 Ga0495679_002165
1109 Ga0495679_003747
1110 Ga0495679_054991
1111 Ga0495685_001117
1112 Ga0495685_222885
1113 Ga0495681_0002281
1114 Ga0495681_0004090
1115 Ga0495681_0005907
1116 Ga0495681_0020045
1117 Ga0495681_0070936
1118 Ga0495681_0074489
1119 Ga0495681_0189641
1120 Ga0495686_0000793
1121 Ga0495686_0001487
1122 Ga0495686_0143291
1123 Ga0495686_0202183
1124 Ga0495593_0040264
1125 Ga0495593_0152562
1126 Ga0495602_0003238
1127 Ga0495602_0694436
1128 Ga0495614_0011189
1129 Ga0495614_0012606
1130 Ga0495614_0073687
1131 Ga0495626_0000022
1132 Ga0495626_0000105
1133 Ga0495626_0001496
1134 Ga0495626_0001844
1135 Ga0495626_0004240
1136 Ga0495626_0005642
1137 Ga0495626_0011488
1138 Ga0495626_0043799
1139 Ga0495626_0050099
1140 Ga0495626_0177540
1141 Ga0495626_0182385
1142 Ga0495626_0211114
1143 Ga0495626_0211422
1144 Ga0495626_0216563
1145 Ga0495626_0228042
1146 Ga0495626_0342489
1147 Ga0495626_0348573
1148 Ga0496100_0950857
1149 Ga0496102_0001960
1150 Ga0496102_0152842
1151 Ga0496102_0204254
1152 Ga0496102_0242840
1153 Ga0496102_0577158
1154 Ga0496102_0919227
1155 Ga0496103_0091411
1156 Ga0496103_0193524
1157 Ga0496103_0388645
1158 Ga0496104_0879099
1159 Ga0496105_0137202
1160 Ga0496105_0264694
1161 Ga0496106_0297712
1162 Ga0496106_0892748
1163 Ga0496107_0131540
1164 Ga0496108_0396245
1165 Ga0496109_0671119
1166 Ga0496110_0003614
1167 Ga0496110_0599530
1168 Ga0496111_0238705
1169 Ga0496111_0557229
1170 Ga0496111_0807245
1171 Ga0496112_0955598
1172 Ga0496113_0030974
1173 Ga0496113_0403960
1174 Ga0496114_0449924
1175 Ga0496122_0004630
1176 Ga0496122_0015745
1177 Ga0496123_0006523
1178 Ga0496123_0100870
1179 Ga0496124_0012160
1180 Ga0496124_0018898
1181 Ga0496124_0127563
1182 Ga0496124_0151942
1183 Ga0496124_0187301
1184 Ga0496125_0453832
1185 Ga0501308_000350
1186 Ga0501304_002430
1187 Ga0495678_000190
1188 Ga0495678_000774
1189 Ga0495678_002527
1190 Ga0495678_007129
1191 Ga0495678_056319
1192 Ga0495682_0005671
1193 Ga0495682_0029644
1194 Ga0495682_0036861
1195 Ga0495682_0085336
1196 Ga0501036_0590043
1197 Ga0501044_0595423
1198 Ga0466962_0091299
1199 2643799524
1200 2644471614
1201 2809145767
1202 8047675979

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01230

HIT

HIT domain

11

96

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
2oik-assembly2.cif.gz_D crystal structure of a histidine triad (hit) protein (mfla_2506) from methylobacillus flagellatus kt at 1.65 a resolution 0.8024 5 144
2oik-assembly2.cif.gz_D crystal structure of a histidine triad (hit) protein (mfla_2506) from methylobacillus flagellatus kt at 1.65 a resolution 0.7747 5 144
3nrd-assembly1.cif.gz_A crystal structure of a histidine triad (hit) protein (smc02904) from sinorhizobium meliloti 1021 at 2.06 a resolution 0.7402 21 136
3ohe-assembly1.cif.gz_B crystal structure of a histidine triad protein (maqu_1709) from marinobacter aquaeolei vt8 at 1.20 a resolution 0.718 20 141
3i4s-assembly1.cif.gz_B crystal structure of histidine triad protein blr8122 from bradyrhizobium japonicum 0.7173 1 144
ID Description Score Start End Superfamily
af_P49775_3_108_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8602 18 104 3.30.428.10
af_A0A140LH01_2_105_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8472 16 103 3.30.428.10
3ksvA01 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8316 4 103 3.30.428.10
af_Q0IQH7_1_86_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8039 41 114 3.30.428.10
1y23D01 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8019 7 104 3.30.428.10
ID Description Score Start End GO Terms
AF-A0A4Q3HSV5-F1-model_v4 deleted 0.9761 3 102
AF-A0A4Q3HSV5-F1-model_v4 deleted 0.9565 3 102
AF-A0A3D5CX46-F1-model_v4 HIT family protein 0.946 5 103 GO:0003824
AF-A0A257QHA6-F1-model_v4 HIT domain-containing protein 0.9411 18 103 GO:0003824
AF-A0A3D5CX46-F1-model_v4 HIT family protein 0.9365 5 103 GO:0003824

Map