F468090

General Info

Members Datasets Scaffolds Average Seq Length
601 224 601 427

Family's Representative Sequence

Representative Sequence 3300046472|Ga0495580_0033949|Ga0495580_0033949_737_2080
Length 447
Sequence MRAKTLAAVAITLGLGAAAACRSAGPATPERKPAENRELNPIAESYVKLVLALGQHDADYVDAYYGPPEWKPDPSAPRRPLPDIQAEAVSLLERLTSASPGGDEMAHLRFQYLFRQISALRARAQMVSGRKLSFDEESRALYDATAPVNSEEHFRELSERLSRLLPGDPGDSLGSRYEAFRAAFVIPPDRLDRVFQAAVSAARERTRKHLKLPDAESFKVEYVTGKSWSGYNWYQGGYRSLIQVNTDLPIYIDRAVDLAAHEGYPGHHVYNVLLEKNLVRDRGWVEFSVYPLFSPQSLIAEGSANFGIDVAFPGDERLAFERDVLYPLAGLDPSLAAKYTEVRELTEGLSYAGNEAARRYLNGEIDAKAAADWLERYALMARPRAEQRVRFIDQYRSYVINYNLGKDLVRGYIESRGGTADHPEKRWEEFGMLLSSPRLPGDLKPAR

Samples

Sample ID Description Type Environment
1 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
65 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
66 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
67 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
101 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
142 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
146 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
147 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
148 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
149 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
150 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
151 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
152 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
153 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
154 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
155 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
156 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
157 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
158 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
159 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
160 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
161 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
162 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
163 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
164 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
165 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
166 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
167 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
168 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
169 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
170 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
171 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
172 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
173 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
174 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
175 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
176 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
177 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
178 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
179 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
180 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
181 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
182 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
183 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
184 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
185 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
186 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
196 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
197 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
198 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
199 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
200 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
201 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
202 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
203 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
204 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
205 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
206 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
207 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
208 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
209 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
210 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
211 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
212 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
213 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
214 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
215 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
216 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
217 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
218 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
219 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
220 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
221 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
222 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
223 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
224 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.16
Nodule 0
Rhizoplane 4.33
Rhizosphere 93.18
Stem 0
Stem Tuber 0
Unclassified 0.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065714_10075646 3300005288 Bacteria 2882
2 Ga0065704_10002562 3300005289 Bacteria 6136
3 Ga0065712_10000173 3300005290 Bacteria 30975
4 Ga0065712_10002276 3300005290 Bacteria 8803
5 Ga0065712_10075446 3300005290 Bacteria 3861
6 Ga0065712_10124079 3300005290 Bacteria 1629
7 Ga0065715_10000280 3300005293 Bacteria 16864
8 Ga0065715_10002535 3300005293 Bacteria 6357
9 Ga0065715_10106275 3300005293 Bacteria 2839
10 Ga0065715_10115291 3300005293 Bacteria 2420
11 Ga0065707_10009182 3300005295 Bacteria 4824
12 Ga0070676_10002232 3300005328 Bacteria 9885
13 Ga0070676_10164251 3300005328 Bacteria 1431
14 Ga0070683_100000698 3300005329 Bacteria 24394
15 Ga0070683_100004931 3300005329 Bacteria 11066
16 Ga0070683_100022034 3300005329 Bacteria 5688
17 Ga0070690_100037875 3300005330 Bacteria 3040
18 Ga0070690_100090228 3300005330 Bacteria 2017
19 Ga0070690_100133411 3300005330 Unclassified 1679
20 Ga0070670_100001817 3300005331 Bacteria 17382
21 Ga0070670_100002545 3300005331 Bacteria 15044
22 Ga0070670_100006347 3300005331 Bacteria 10006
23 Ga0070670_100008954 3300005331 Bacteria 8551
24 Ga0070670_100033332 3300005331 Bacteria 4435
25 Ga0070677_10014276 3300005333 Bacteria 2794
26 Ga0070677_10046460 3300005333 Bacteria 1736
27 Ga0070677_10092860 3300005333 Bacteria 1316
28 Ga0068869_100002035 3300005334 Bacteria 12146
29 Ga0068869_100043834 3300005334 Bacteria 3215
30 Ga0068869_100066190 3300005334 Bacteria 2662
31 Ga0068869_100189104 3300005334 Bacteria 1618
32 Ga0070666_10030359 3300005335 Bacteria 3560
33 Ga0070680_100176757 3300005336 Bacteria 1797
34 Ga0068868_100025104 3300005338 Bacteria 4527
35 Ga0070660_100128094 3300005339 Bacteria 2030
36 Ga0070689_100028948 3300005340 Bacteria 4189
37 Ga0070689_100037218 3300005340 Bacteria 3721
38 Ga0070689_100156730 3300005340 Bacteria 1839
39 Ga0070691_10017381 3300005341 Bacteria 3309
40 Ga0070687_100013994 3300005343 Bacteria 3593
41 Ga0070687_100029638 3300005343 Bacteria 2666
42 Ga0070687_100065050 3300005343 Bacteria 1939
43 Ga0070661_100003066 3300005344 Bacteria 11492
44 Ga0070692_10013314 3300005345 Bacteria 3830
45 Ga0070668_100097518 3300005347 Bacteria 2325
46 Ga0070669_100005634 3300005353 Bacteria 9043
47 Ga0070669_100019769 3300005353 Bacteria 4812
48 Ga0070669_100020190 3300005353 Bacteria 4758
49 Ga0070669_100027985 3300005353 Bacteria 4058
50 Ga0070669_100039685 3300005353 Bacteria 3421
51 Ga0070669_100058100 3300005353 Bacteria 2839
52 Ga0070675_100000001 3300005354 Bacteria 448137
53 Ga0070675_100002958 3300005354 Bacteria 12818
54 Ga0070675_100003568 3300005354 Bacteria 11825
55 Ga0070675_100006135 3300005354 Bacteria 9213
56 Ga0070675_100018904 3300005354 Bacteria 5488
57 Ga0070675_100027617 3300005354 Bacteria 4561
58 Ga0070675_100041389 3300005354 Bacteria 3764
59 Ga0070675_100065653 3300005354 Bacteria 3001
60 Ga0070675_100078776 3300005354 Bacteria 2745
61 Ga0070675_100104078 3300005354 Bacteria 2394
62 Ga0070675_100104997 3300005354 Bacteria 2384
63 Ga0070671_100019646 3300005355 Bacteria 5501
64 Ga0070671_100040520 3300005355 Bacteria 3869
65 Ga0070674_100000032 3300005356 Bacteria 64311
66 Ga0070674_100001783 3300005356 Bacteria 11675
67 Ga0070674_100036881 3300005356 Bacteria 3285
68 Ga0070674_100048258 3300005356 Bacteria 2922
69 Ga0070673_100004841 3300005364 Bacteria 8564
70 Ga0070673_100005045 3300005364 Bacteria 8421
71 Ga0070673_100038252 3300005364 Bacteria 3662
72 Ga0070673_100038577 3300005364 Bacteria 3648
73 Ga0070673_100062164 3300005364 Bacteria 2966
74 Ga0070673_100099603 3300005364 Bacteria 2391
75 Ga0070673_100210012 3300005364 Bacteria 1681
76 Ga0070688_100003806 3300005365 Bacteria 7823
77 Ga0070688_100017782 3300005365 Bacteria 4087
78 Ga0070688_100024876 3300005365 Bacteria 3539
79 Ga0070667_100008279 3300005367 Bacteria 8618
80 Ga0070667_100040961 3300005367 Bacteria 3885
81 Ga0070667_100073842 3300005367 Bacteria 2909
82 Ga0070667_100213713 3300005367 Bacteria 1715
83 Ga0070701_10016676 3300005438 Bacteria 3419
84 Ga0070701_10020202 3300005438 Bacteria 3159
85 Ga0070701_10111233 3300005438 Bacteria 1530
86 Ga0070705_100000775 3300005440 Bacteria 18053
87 Ga0070705_100010537 3300005440 Bacteria 4631
88 Ga0070694_100007561 3300005444 Bacteria 6633
89 Ga0070694_100016356 3300005444 Bacteria 4669
90 Ga0070694_100060398 3300005444 Bacteria 2585
91 Ga0070694_100167163 3300005444 Bacteria 1618
92 Ga0070708_100025381 3300005445 Bacteria 5066
93 Ga0070708_100081846 3300005445 Bacteria 2924
94 Ga0070678_100020222 3300005456 Bacteria 4363
95 Ga0070678_100052387 3300005456 Bacteria 2963
96 Ga0070678_100078415 3300005456 Bacteria 2495
97 Ga0070678_100180529 3300005456 Bacteria 1727
98 Ga0070662_100007770 3300005457 Bacteria 6968
99 Ga0070662_100047662 3300005457 Bacteria 3084
100 Ga0070681_10331273 3300005458 Bacteria 1432
101 Ga0068867_100000578 3300005459 Bacteria 24270
102 Ga0068867_100033134 3300005459 Bacteria 3739
103 Ga0068867_100041702 3300005459 Bacteria 3354
104 Ga0070685_10023632 3300005466 Bacteria 3368
105 Ga0070685_10159560 3300005466 Unclassified 1436
106 Ga0070707_100146731 3300005468 Bacteria 2296
107 Ga0070698_100001133 3300005471 Bacteria 29490
108 Ga0070698_100017547 3300005471 Bacteria 7543
109 Ga0070698_100197733 3300005471 Bacteria 1946
110 Ga0070699_100000125 3300005518 Bacteria 70893
111 Ga0070699_100029178 3300005518 Bacteria 4757
112 Ga0070699_100037796 3300005518 Bacteria 4179
113 Ga0070684_100002600 3300005535 Bacteria 13326
114 Ga0070697_100082466 3300005536 Bacteria 2650
115 Ga0070672_100015081 3300005543 Bacteria 5493
116 Ga0070672_100106820 3300005543 Bacteria 2277
117 Ga0070686_100027132 3300005544 Bacteria 3464
118 Ga0070695_100000040 3300005545 Bacteria 49538
119 Ga0070695_100037605 3300005545 Bacteria 3051
120 Ga0070696_100006647 3300005546 Bacteria 7724
121 Ga0070696_100016747 3300005546 Bacteria 4943
122 Ga0070696_100029867 3300005546 Bacteria 3728
123 Ga0070696_100075987 3300005546 Bacteria 2371
124 Ga0070696_100216999 3300005546 Unclassified 1434
125 Ga0070693_100026339 3300005547 Bacteria 3139
126 Ga0070693_100033923 3300005547 Unclassified 2821
127 Ga0070665_100000192 3300005548 Bacteria 108722
128 Ga0070665_100108499 3300005548 Bacteria 2778
129 Ga0070665_100297512 3300005548 Unclassified 1616
130 Ga0070704_100014038 3300005549 Bacteria 4992
131 Ga0070704_100043081 3300005549 Bacteria 3126
132 Ga0070664_100004110 3300005564 Bacteria 11692
133 Ga0070664_100007452 3300005564 Bacteria 8835
134 Ga0070664_100039831 3300005564 Bacteria 3961
135 Ga0068857_100016879 3300005577 Bacteria 6396
136 Ga0068857_100031138 3300005577 Bacteria 4714
137 Ga0070702_100098578 3300005615 Bacteria 1788
138 Ga0068852_100023772 3300005616 Bacteria 4940
139 Ga0068852_100057813 3300005616 Bacteria 3357
140 Ga0068859_100006708 3300005617 Bacteria 11694
141 Ga0068859_100009529 3300005617 Bacteria 9805
142 Ga0068859_100040701 3300005617 Bacteria 4666
143 Ga0068859_100125648 3300005617 Bacteria 2634
144 Ga0068859_100314843 3300005617 Bacteria 1659
145 Ga0068864_100037806 3300005618 Bacteria 4121
146 Ga0068864_100145680 3300005618 Unclassified 2141
147 Ga0068864_100158522 3300005618 Bacteria 2056
148 Ga0068864_100273119 3300005618 Bacteria 1576
149 Ga0068866_10048849 3300005718 Bacteria 2141
150 Ga0068861_100017626 3300005719 Bacteria 5075
151 Ga0068861_100019579 3300005719 Bacteria 4834
152 Ga0068861_100036701 3300005719 Bacteria 3640
153 Ga0068861_100075521 3300005719 Bacteria 2624
154 Ga0068861_100254252 3300005719 Bacteria 1501
155 Ga0068870_10002885 3300005840 Bacteria 7243
156 Ga0068870_10018405 3300005840 Bacteria 3373
157 Ga0068863_100006263 3300005841 Bacteria 11688
158 Ga0068863_100054102 3300005841 Bacteria 3804
159 Ga0068863_100176016 3300005841 Bacteria 2053
160 Ga0068863_100232070 3300005841 Unclassified 1780
161 Ga0068858_100009371 3300005842 Bacteria 9342
162 Ga0068858_100073175 3300005842 Bacteria 3181
163 Ga0068860_100015767 3300005843 Bacteria 7377
164 Ga0068860_100041735 3300005843 Bacteria 4382
165 Ga0068860_100042097 3300005843 Bacteria 4364
166 Ga0068862_100022008 3300005844 Bacteria 5332
167 Ga0068862_100026042 3300005844 Bacteria 4916
168 Ga0068862_100054051 3300005844 Bacteria 3438
169 Ga0068862_100108746 3300005844 Bacteria 2432
170 Ga0070717_10081617 3300006028 Bacteria 2715
171 Ga0075363_100050703 3300006048 Bacteria 2212
172 Ga0075364_10004069 3300006051 Bacteria 8391
173 Ga0075364_10015143 3300006051 Bacteria 4775
174 Ga0075364_10043289 3300006051 Bacteria 2927
175 Ga0075367_10012355 3300006178 Bacteria 4550
176 Ga0075366_10018398 3300006195 Bacteria 4032
177 Ga0068871_100192167 3300006358 Bacteria 1759
178 Ga0075428_100000166 3300006844 Bacteria 60871
179 Ga0075428_100000712 3300006844 Bacteria 34383
180 Ga0075428_100003413 3300006844 Bacteria 17374
181 Ga0075428_100004770 3300006844 Bacteria 15012
182 Ga0075428_100005989 3300006844 Bacteria 13502
183 Ga0075428_100013108 3300006844 Bacteria 9219
184 Ga0075428_100028630 3300006844 Bacteria 6164
185 Ga0075428_100125333 3300006844 Bacteria 2795
186 Ga0075430_100000691 3300006846 Bacteria 25696
187 Ga0075430_100001481 3300006846 Bacteria 19138
188 Ga0075430_100006691 3300006846 Bacteria 9724
189 Ga0075430_100011371 3300006846 Bacteria 7553
190 Ga0075430_100035134 3300006846 Bacteria 4254
191 Ga0075430_100129671 3300006846 Bacteria 2102
192 Ga0075431_100001885 3300006847 Bacteria 19887
193 Ga0075431_100021127 3300006847 Bacteria 6651
194 Ga0075431_100021230 3300006847 Bacteria 6637
195 Ga0075431_100035531 3300006847 Bacteria 5131
196 Ga0075431_100063640 3300006847 Bacteria 3807
197 Ga0075431_100109646 3300006847 Bacteria 2849
198 Ga0075433_10001456 3300006852 Bacteria 17484
199 Ga0075433_10003206 3300006852 Bacteria 12616
200 Ga0075433_10005012 3300006852 Bacteria 10372
201 Ga0075433_10035761 3300006852 Bacteria 4275
202 Ga0075433_10056365 3300006852 Bacteria 3432
203 Ga0075434_100003306 3300006871 Bacteria 14407
204 Ga0075434_100027168 3300006871 Bacteria 5616
205 Ga0075434_100111278 3300006871 Bacteria 2749
206 Ga0075429_100007109 3300006880 Bacteria 9720
207 Ga0075429_100024850 3300006880 Bacteria 5200
208 Ga0075429_100028011 3300006880 Bacteria 4890
209 Ga0075429_100028295 3300006880 Bacteria 4867
210 Ga0075429_100028828 3300006880 Bacteria 4821
211 Ga0075429_100045912 3300006880 Bacteria 3801
212 Ga0068865_100001886 3300006881 Bacteria 12325
213 Ga0068865_100023056 3300006881 Bacteria 4070
214 Ga0068865_100048854 3300006881 Unclassified 2914
215 Ga0097620_100006708 3300006931 Bacteria 11694
216 Ga0097620_100009529 3300006931 Bacteria 9805
217 Ga0097620_100040704 3300006931 Bacteria 4666
218 Ga0097620_100125647 3300006931 Bacteria 2634
219 Ga0097620_100314855 3300006931 Bacteria 1659
220 Ga0075435_100001599 3300007076 Bacteria 14624
221 Ga0075435_100010023 3300007076 Bacteria 6908
222 Ga0075435_100039348 3300007076 Bacteria 3772
223 Ga0075435_100106039 3300007076 Bacteria 2333
224 Ga0075435_100137373 3300007076 Bacteria 2049
225 Ga0075435_100257905 3300007076 Unclassified 1485
226 Ga0105244_10029742 3300009036 Bacteria 2914
227 Ga0111539_10000118 3300009094 Bacteria 88106
228 Ga0111539_10007840 3300009094 Bacteria 13638
229 Ga0111539_10015750 3300009094 Bacteria 9394
230 Ga0111539_10033958 3300009094 Bacteria 6190
231 Ga0111539_10033990 3300009094 Bacteria 6186
232 Ga0111539_10042125 3300009094 Bacteria 5486
233 Ga0111539_10057023 3300009094 Bacteria 4641
234 Ga0111539_10075129 3300009094 Bacteria 3981
235 Ga0111539_10196510 3300009094 Bacteria 2353
236 Ga0111539_10215981 3300009094 Unclassified 2234
237 Ga0105245_10076674 3300009098 Bacteria 3046
238 Ga0114129_10000324 3300009147 Bacteria 56067
239 Ga0114129_10000833 3300009147 Bacteria 39896
240 Ga0114129_10003679 3300009147 Bacteria 21574
241 Ga0114129_10016193 3300009147 Bacteria 10610
242 Ga0114129_10021996 3300009147 Bacteria 9050
243 Ga0114129_10034123 3300009147 Bacteria 7187
244 Ga0114129_10052656 3300009147 Bacteria 5713
245 Ga0114129_10069644 3300009147 Bacteria 4903
246 Ga0114129_10076433 3300009147 Bacteria 4662
247 Ga0114129_10083928 3300009147 Bacteria 4423
248 Ga0114129_10122367 3300009147 Bacteria 3581
249 Ga0114129_10218355 3300009147 Bacteria 2574
250 Ga0114129_10254252 3300009147 Bacteria 2357
251 Ga0105243_10014270 3300009148 Bacteria 6011
252 Ga0105243_10015475 3300009148 Bacteria 5765
253 Ga0105243_10104398 3300009148 Bacteria 2359
254 Ga0105241_10053819 3300009174 Bacteria 3079
255 Ga0105242_10017434 3300009176 Bacteria 5597
256 Ga0105242_10019296 3300009176 Bacteria 5341
257 Ga0105242_10107146 3300009176 Bacteria 2377
258 Ga0105242_10242750 3300009176 Bacteria 1620
259 Ga0105248_10049547 3300009177 Bacteria 4711
260 Ga0105248_10055240 3300009177 Bacteria 4453
261 Ga0105248_10238807 3300009177 Bacteria 2046
262 Ga0105238_10019308 3300009551 Bacteria 6943
263 Ga0105249_10007783 3300009553 Bacteria 9337
264 Ga0105249_10219084 3300009553 Bacteria 1872
265 Ga0105246_10021530 3300011119 Bacteria 4149
266 Ga0157374_10143867 3300013296 Bacteria 2316
267 Ga0157378_10014960 3300013297 Bacteria 6793
268 Ga0157378_10126030 3300013297 Bacteria 2365
269 Ga0163162_10010498 3300013306 Bacteria 9007
270 Ga0163162_10019877 3300013306 Bacteria 6595
271 Ga0163162_10041884 3300013306 Bacteria 4582
272 Ga0157372_10608759 3300013307 Unclassified 1273
273 Ga0157375_10008200 3300013308 Bacteria 9147
274 Ga0157375_10105312 3300013308 Bacteria 2910
275 Ga0157375_10231171 3300013308 Bacteria 2008
276 Ga0163163_10006898 3300014325 Bacteria 9969
277 Ga0163163_10042464 3300014325 Unclassified 4454
278 Ga0163163_10082987 3300014325 Bacteria 3209
279 Ga0157380_10000799 3300014326 Bacteria 19789
280 Ga0157380_10037009 3300014326 Bacteria 3780
281 Ga0157380_10060407 3300014326 Bacteria 3029
282 Ga0157380_10272980 3300014326 Bacteria 1543
283 Ga0157377_10038989 3300014745 Bacteria 2626
284 Ga0157377_10052576 3300014745 Bacteria 2300
285 Ga0157377_10075774 3300014745 Bacteria 1955
286 Ga0157377_10090086 3300014745 Bacteria 1809
287 Ga0157379_10083078 3300014968 Bacteria 2871
288 Ga0157376_10031563 3300014969 Bacteria 4244
289 Ga0157376_10036029 3300014969 Bacteria 4005
290 Ga0163161_10095417 3300017792 Bacteria 2206
291 Ga0213876_10019093 3300021384 Bacteria 3620
292 Ga0207697_10023261 3300025315 Bacteria 2537
293 Ga0207682_10004881 3300025893 Bacteria 5531
294 Ga0207682_10019869 3300025893 Bacteria 2634
295 Ga0207645_10000611 3300025907 Bacteria 29564
296 Ga0207645_10005408 3300025907 Bacteria 9262
297 Ga0207645_10007025 3300025907 Bacteria 8015
298 Ga0207645_10035702 3300025907 Bacteria 3191
299 Ga0207645_10089849 3300025907 Bacteria 1975
300 Ga0207643_10000068 3300025908 Bacteria 69282
301 Ga0207643_10024226 3300025908 Bacteria 3349
302 Ga0207643_10043513 3300025908 Bacteria 2534
303 Ga0207705_10158958 3300025909 Bacteria 1697
304 Ga0207707_10074606 3300025912 Bacteria 2959
305 Ga0207695_10255746 3300025913 Bacteria 1650
306 Ga0207662_10006169 3300025918 Bacteria 6450
307 Ga0207662_10021244 3300025918 Bacteria 3708
308 Ga0207662_10098175 3300025918 Bacteria 1812
309 Ga0207649_10101100 3300025920 Bacteria 1908
310 Ga0207681_10004748 3300025923 Bacteria 8360
311 Ga0207681_10008076 3300025923 Bacteria 6440
312 Ga0207681_10012428 3300025923 Bacteria 5255
313 Ga0207681_10023640 3300025923 Bacteria 3934
314 Ga0207681_10037398 3300025923 Bacteria 3208
315 Ga0207681_10119390 3300025923 Bacteria 1931
316 Ga0207694_10061573 3300025924 Bacteria 2921
317 Ga0207650_10100574 3300025925 Unclassified 2225
318 Ga0207650_10174502 3300025925 Unclassified 1710
319 Ga0207659_10000004 3300025926 Bacteria 476977
320 Ga0207659_10001166 3300025926 Bacteria 15673
321 Ga0207659_10001597 3300025926 Bacteria 13448
322 Ga0207659_10002915 3300025926 Bacteria 10188
323 Ga0207659_10003941 3300025926 Bacteria 8960
324 Ga0207659_10024361 3300025926 Bacteria 4054
325 Ga0207659_10027165 3300025926 Bacteria 3871
326 Ga0207659_10084945 3300025926 Bacteria 2350
327 Ga0207659_10097547 3300025926 Bacteria 2208
328 Ga0207687_10001731 3300025927 Bacteria 15029
329 Ga0207706_10024638 3300025933 Bacteria 5393
330 Ga0207706_10052666 3300025933 Bacteria 3593
331 Ga0207706_10063424 3300025933 Bacteria 3253
332 Ga0207706_10074505 3300025933 Bacteria 2985
333 Ga0207686_10004977 3300025934 Bacteria 7155
334 Ga0207709_10004516 3300025935 Bacteria 8024
335 Ga0207670_10072279 3300025936 Bacteria 2388
336 Ga0207670_10116883 3300025936 Bacteria 1932
337 Ga0207669_10038374 3300025937 Bacteria 2757
338 Ga0207704_10003884 3300025938 Bacteria 6792
339 Ga0207704_10085049 3300025938 Bacteria 2058
340 Ga0207691_10003313 3300025940 Bacteria 15693
341 Ga0207691_10007779 3300025940 Bacteria 10321
342 Ga0207691_10011105 3300025940 Bacteria 8646
343 Ga0207691_10014455 3300025940 Bacteria 7527
344 Ga0207691_10033132 3300025940 Bacteria 4812
345 Ga0207691_10125348 3300025940 Bacteria 2273
346 Ga0207691_10213633 3300025940 Bacteria 1675
347 Ga0207711_10138131 3300025941 Bacteria 2191
348 Ga0207689_10000219 3300025942 Bacteria 50693
349 Ga0207689_10002433 3300025942 Bacteria 17334
350 Ga0207689_10035829 3300025942 Bacteria 4120
351 Ga0207689_10220038 3300025942 Bacteria 1569
352 Ga0207661_10003578 3300025944 Bacteria 10808
353 Ga0207679_10017428 3300025945 Bacteria 4791
354 Ga0207679_10199719 3300025945 Bacteria 1669
355 Ga0207651_10000813 3300025960 Bacteria 13454
356 Ga0207651_10005227 3300025960 Bacteria 6634
357 Ga0207651_10040819 3300025960 Bacteria 3074
358 Ga0207712_10057685 3300025961 Bacteria 2740
359 Ga0207668_10136328 3300025972 Unclassified 1881
360 Ga0207658_10056418 3300025986 Bacteria 2915
361 Ga0207658_10132617 3300025986 Bacteria 2004
362 Ga0207677_10088764 3300026023 Bacteria 2243
363 Ga0207677_10090352 3300026023 Bacteria 2225
364 Ga0207703_10023860 3300026035 Bacteria 4810
365 Ga0207703_10026979 3300026035 Bacteria 4524
366 Ga0207639_10000003 3300026041 Bacteria 806887
367 Ga0207678_10032344 3300026067 Bacteria 4558
368 Ga0207678_10156071 3300026067 Unclassified 1948
369 Ga0207708_10000831 3300026075 Bacteria 23303
370 Ga0207708_10015853 3300026075 Bacteria 5657
371 Ga0207708_10024085 3300026075 Bacteria 4603
372 Ga0207708_10027304 3300026075 Bacteria 4321
373 Ga0207708_10049384 3300026075 Bacteria 3203
374 Ga0207708_10093326 3300026075 Bacteria 2323
375 Ga0207641_10038176 3300026088 Bacteria 4014
376 Ga0207641_10041274 3300026088 Bacteria 3866
377 Ga0207641_10116122 3300026088 Bacteria 2381
378 Ga0207641_10197885 3300026088 Unclassified 1851
379 Ga0207648_10001252 3300026089 Bacteria 28387
380 Ga0207648_10001542 3300026089 Bacteria 25362
381 Ga0207648_10013802 3300026089 Bacteria 7494
382 Ga0207648_10044752 3300026089 Bacteria 3884
383 Ga0207648_10067817 3300026089 Bacteria 3109
384 Ga0207676_10024559 3300026095 Bacteria 4461
385 Ga0207676_10047741 3300026095 Bacteria 3320
386 Ga0207676_10059160 3300026095 Bacteria 3025
387 Ga0207676_10164233 3300026095 Bacteria 1927
388 Ga0207674_10012643 3300026116 Bacteria 9436
389 Ga0207674_10029631 3300026116 Bacteria 5761
390 Ga0207674_10285819 3300026116 Bacteria 1598
391 Ga0207675_100017435 3300026118 Bacteria 6704
392 Ga0207675_100019206 3300026118 Bacteria 6377
393 Ga0207675_100028322 3300026118 Bacteria 5216
394 Ga0207675_100047723 3300026118 Bacteria 3997
395 Ga0207675_100059346 3300026118 Bacteria 3570
396 Ga0207675_100061892 3300026118 Bacteria 3494
397 Ga0207675_100062479 3300026118 Bacteria 3478
398 Ga0207683_10018323 3300026121 Bacteria 5973
399 Ga0207683_10028333 3300026121 Bacteria 4842
400 Ga0207683_10038335 3300026121 Bacteria 4176
401 Ga0207683_10043518 3300026121 Bacteria 3924
402 Ga0207683_10044843 3300026121 Bacteria 3866
403 Ga0207683_10098491 3300026121 Bacteria 2609
404 Ga0207428_10000020 3300027907 Bacteria 276713
405 Ga0207428_10001886 3300027907 Bacteria 21325
406 Ga0207428_10010619 3300027907 Bacteria 8214
407 Ga0207428_10019347 3300027907 Bacteria 5806
408 Ga0207428_10022164 3300027907 Bacteria 5363
409 Ga0207428_10063354 3300027907 Bacteria 2921
410 Ga0268266_10000298 3300028379 Bacteria 79989
411 Ga0268266_10013999 3300028379 Bacteria 6905
412 Ga0268265_10006601 3300028380 Bacteria 7853
413 Ga0268265_10043975 3300028380 Bacteria 3323
414 Ga0268265_10092745 3300028380 Bacteria 2418
415 Ga0268265_10194635 3300028380 Bacteria 1754
416 Ga0268264_10019905 3300028381 Bacteria 5483
417 Ga0268264_10041798 3300028381 Bacteria 3793
418 Ga0268264_10118343 3300028381 Bacteria 2331
419 Ga0265322_10000639 3300028654 Bacteria 13189
420 Ga0307408_100026245 3300031548 Bacteria 3999
421 Ga0307408_100035117 3300031548 Bacteria 3516
422 Ga0307408_100172186 3300031548 Bacteria 1729
423 Ga0307410_10065761 3300031852 Bacteria 2495
424 Ga0307410_10169692 3300031852 Bacteria 1643
425 Ga0307412_10024430 3300031911 Bacteria 3730
426 Ga0307412_10051844 3300031911 Bacteria 2714
427 Ga0307414_10019710 3300032004 Bacteria 4187
428 Ga0307414_10155021 3300032004 Bacteria 1812
429 Ga0307411_10032503 3300032005 Bacteria 3224
430 Ga0373962_0011384 3300035242 Bacteria 2230
431 Ga0373931_0082431 3300035691 Bacteria 1778
432 Ga0373925_0143143 3300037068 Bacteria 1873
433 Ga0436365_0342535 3300039437 Bacteria 9232
434 Ga0451807_1409687 3300041486 Bacteria 3972
435 Ga0439450_005388 3300042008 Bacteria 2247
436 Ga0439446_0016449 3300042156 Unclassified 2060
437 Ga0439435_0000832 3300042436 Bacteria 5263
438 Ga0439435_0001042 3300042436 Bacteria 4883
439 Ga0439464_0001219 3300042439 Bacteria 5980
440 Ga0439464_0043222 3300042439 Bacteria 1288
441 Ga0451577_0001886 3300042876 Bacteria 26682
442 Ga0451577_0018663 3300042876 Bacteria 6386
443 Ga0453684_0048467 3300044712 Bacteria 5617
444 Ga0453684_0122372 3300044712 Bacteria 3139
445 Ga0451576_0075730 3300045051 Bacteria 3502
446 Ga0451576_0119145 3300045051 Bacteria 2748
447 Ga0495603_0023454 3300046455 Bacteria 3733
448 Ga0495580_0000238 3300046472 Bacteria 43561
449 Ga0495580_0033949 3300046472 Bacteria 3674
450 Ga0495594_0017685 3300046499 Bacteria 3769
451 Ga0495594_0045760 3300046499 Bacteria 2403
452 Ga0495620_0002828 3300046515 Bacteria 9974
453 Ga0495643_0056426 3300046522 Bacteria 2096
454 Ga0495642_0012598 3300046528 Bacteria 3260
455 Ga0495621_0010739 3300046539 Bacteria 2812
456 Ga0495633_0039990 3300046558 Bacteria 2236
457 Ga0495659_0003162 3300046664 Bacteria 5282
458 Ga0495659_0007707 3300046664 Bacteria 3413
459 Ga0495588_0017613 3300046674 Bacteria 3474
460 Ga0495658_0030637 3300046683 Bacteria 2923
461 Ga0495636_0011354 3300047318 Bacteria 3525
462 Ga0496101_0148416 3300048904 Bacteria 1792
463 Ga0496102_0127333 3300048905 Bacteria 2381
464 Ga0496104_0004276 3300048907 Bacteria 12412
465 Ga0496104_0012209 3300048907 Bacteria 7719
466 Ga0496106_0065422 3300048909 Bacteria 2768
467 Ga0496106_0065669 3300048909 Unclassified 2762
468 Ga0496108_0021366 3300048911 Bacteria 5319
469 Ga0496108_0044331 3300048911 Bacteria 3713
470 Ga0496109_0003251 3300048912 Bacteria 13544
471 Ga0496109_0046351 3300048912 Bacteria 3949
472 Ga0496109_0349419 3300048912 Bacteria 1397
473 Ga0496109_0390920 3300048912 Bacteria 1314
474 Ga0496110_0005783 3300048913 Bacteria 9718
475 Ga0496110_0222179 3300048913 Bacteria 1718
476 Ga0496111_0037789 3300048914 Bacteria 3456
477 Ga0496111_0121058 3300048914 Bacteria 1933
478 Ga0496112_0002553 3300048915 Bacteria 14706
479 Ga0496112_0005550 3300048915 Bacteria 10933
480 Ga0496112_0020671 3300048915 Bacteria 6244
481 Ga0496112_0056377 3300048915 Bacteria 3867
482 Ga0496112_0203238 3300048915 Bacteria 1940
483 Ga0496113_0028592 3300048916 Bacteria 4012
484 Ga0496113_0043730 3300048916 Bacteria 3316
485 Ga0496113_0093334 3300048916 Bacteria 2323
486 Ga0496113_0291467 3300048916 Bacteria 1306
487 Ga0501298_007062 3300049521 Bacteria 1855
488 Ga0501031_0031041 3300049568 Bacteria 3487
489 Ga0501031_0202008 3300049568 Unclassified 1297
490 Ga0501033_0090233 3300049570 Bacteria 2242
491 Ga0501034_0006898 3300049571 Bacteria 12139
492 Ga0501036_0010973 3300049572 Bacteria 7491
493 Ga0501036_0032522 3300049572 Bacteria 4408
494 Ga0501036_0060610 3300049572 Bacteria 3206
495 Ga0501036_0256283 3300049572 Bacteria 1466
496 Ga0501039_0195151 3300049575 Bacteria 1592
497 Ga0501039_0279501 3300049575 Bacteria 1312
498 Ga0501040_0007772 3300049576 Bacteria 6941
499 Ga0501040_0108464 3300049576 Bacteria 1941
500 Ga0501040_0203735 3300049576 Bacteria 1405
501 Ga0501041_0016156 3300049577 Bacteria 4435
502 Ga0501041_0073736 3300049577 Bacteria 2097
503 Ga0501041_0088922 3300049577 Bacteria 1907
504 Ga0501042_0013763 3300049578 Bacteria 5511
505 Ga0501042_0029340 3300049578 Bacteria 3879
506 Ga0501042_0072879 3300049578 Unclassified 2457
507 Ga0501048_0204120 3300049582 Bacteria 1401
508 Ga0501067_0115710 3300049583 Bacteria 1491
509 Ga0501069_0034817 3300049585 Bacteria 2773
510 Ga0501072_0003442 3300049588 Bacteria 11922
511 Ga0501072_0045916 3300049588 Bacteria 3436
512 Ga0501072_0060066 3300049588 Bacteria 2998
513 Ga0501072_0229166 3300049588 Bacteria 1480
514 Ga0501075_0005648 3300049591 Bacteria 8560
515 Ga0501075_0006007 3300049591 Bacteria 8320
516 Ga0501076_0007938 3300049592 Bacteria 7743
517 Ga0501076_0109408 3300049592 Bacteria 2233
518 Ga0501076_0132692 3300049592 Unclassified 2020
519 Ga0501077_0066959 3300049593 Bacteria 2278
520 Ga0501248_000264 3300049678 Bacteria 2682
521 Ga0501079_0012293 3300049741 Bacteria 6532
522 Ga0501079_0016364 3300049741 Bacteria 5666
523 Ga0501079_0188449 3300049741 Bacteria 1610
524 Ga0501080_0072635 3300049742 Bacteria 3201
525 Ga0501080_0351159 3300049742 Bacteria 1332
526 Ga0501081_0004648 3300049743 Bacteria 8828
527 Ga0501081_0029395 3300049743 Bacteria 3714
528 Ga0501081_0037449 3300049743 Bacteria 3309
529 Ga0501083_0103992 3300049744 Bacteria 1871
530 Ga0501045_0058227 3300049824 Bacteria 2829
531 Ga0501045_0068050 3300049824 Bacteria 2616
532 Ga0501045_0097303 3300049824 Bacteria 2177
533 nmdc:mga00v17_20975_c1 3300050491 Bacteria 3751
534 nmdc:mga00v17_39966_c1 3300050491 Bacteria 2811
535 nmdc:mga00v17_9552_c1 3300050491 Bacteria 5255
536 nmdc:mga0yw44_11869_c1 3300050492 Bacteria 4519
537 nmdc:mga0yw44_29928_c1 3300050492 Bacteria 3149
538 nmdc:mga06z11_24140_c1 3300050494 Bacteria 2865
539 nmdc:mga07m45_42159_c1 3300050496 Bacteria 2558
540 nmdc:mga05p37_133328_c1 3300050507 Bacteria 3047
541 nmdc:mga05p37_1896_c1 3300050507 Bacteria 24360
542 nmdc:mga05p37_2154_c1 3300050507 Bacteria 22954
543 nmdc:mga05p37_26140_c1 3300050507 Bacteria 7098
544 nmdc:mga05p37_3758_c1 3300050507 Bacteria 17772
545 nmdc:mga05p37_39178_c1 3300050507 Bacteria 5816
546 nmdc:mga05p37_39349_c1 3300050507 Bacteria 5805
547 nmdc:mga05p37_5747_c1 3300050507 Bacteria 14590
548 nmdc:mga05p37_81426_c1 3300050507 Bacteria 3988
549 nmdc:mga09592_137294_c1 3300050508 Bacteria 2106
550 nmdc:mga09592_260253_c1 3300050508 Bacteria 1504
551 nmdc:mga09592_5395_c1 3300050508 Bacteria 10399
552 nmdc:mga09592_73952_c1 3300050508 Bacteria 2896
553 nmdc:mga0qj67_191287_c1 3300050509 Bacteria 1663
554 nmdc:mga0qj67_20201_c1 3300050509 Bacteria 5098
555 nmdc:mga0qj67_43388_c1 3300050509 Unclassified 3541
556 nmdc:mga0qj67_57090_c1 3300050509 Bacteria 3095
557 nmdc:mga06r32_102054_c1 3300050510 Bacteria 2816
558 nmdc:mga06r32_50460_c1 3300050510 Bacteria 3980
559 nmdc:mga06r32_52227_c1 3300050510 Bacteria 3915
560 nmdc:mga06r32_5275_c1 3300050510 Bacteria 11624
561 nmdc:mga08y16_105253_c1 3300050511 Bacteria 2938
562 nmdc:mga08y16_131_c1 3300050511 Bacteria 64623
563 nmdc:mga08y16_14551_c1 3300050511 Bacteria 8274
564 nmdc:mga08y16_152316_c1 3300050511 Bacteria 2403
565 nmdc:mga08y16_20_c1 3300050511 Bacteria 276739
566 nmdc:mga08y16_26915_c1 3300050511 Bacteria 6060
567 nmdc:mga08y16_310439_c1 3300050511 Bacteria 1624
568 nmdc:mga08y16_78864_c1 3300050511 Bacteria 3433
569 nmdc:mga08y16_870_c1 3300050511 Bacteria 29078
570 nmdc:mga0n895_112051_c1 3300050512 Bacteria 2745
571 nmdc:mga0n895_12672_c1 3300050512 Bacteria 7570
572 nmdc:mga0n895_16759_c1 3300050512 Bacteria 6733
573 nmdc:mga0n895_222479_c1 3300050512 Bacteria 1916
574 nmdc:mga0n895_36489_c1 3300050512 Bacteria 4747
575 nmdc:mga0n895_57073_c1 3300050512 Bacteria 3848
576 nmdc:mga0n895_72713_c1 3300050512 Bacteria 3412
577 nmdc:mga0n895_9942_c1 3300050512 Bacteria 8368
578 nmdc:mga0rr50_10388_c1 3300050513 Bacteria 5904
579 nmdc:mga0rr50_23321_c1 3300050513 Bacteria 4265
580 nmdc:mga0rr50_63219_c1 3300050513 Bacteria 2795
581 nmdc:mga0a205_13094_c1 3300050515 Bacteria 7704
582 nmdc:mga0a205_215911_c1 3300050515 Bacteria 1805
583 nmdc:mga0a205_27213_c1 3300050515 Bacteria 5461
584 nmdc:mga0a205_45457_c1 3300050515 Bacteria 4233
585 nmdc:mga0a205_46889_c1 3300050515 Bacteria 4168
586 nmdc:mga0a205_6319_c1 3300050515 Bacteria 10697
587 nmdc:mga0a205_7991_c1 3300050515 Bacteria 9611
588 nmdc:mga0a205_82090_c1 3300050515 Bacteria 3114
589 nmdc:mga0a205_84_c1 3300050515 Bacteria 51647
590 Ga0501084_0023287 3300054114 Bacteria 5171
591 Ga0501084_0144690 3300054114 Archaea 2002
592 Ga0590071_000063 3300059421 Bacteria 28610
593 Ga0590071_000099 3300059421 Bacteria 24341
594 Ga0590074_000652 3300059423 Bacteria 5231
595 Ga0590074_006103 3300059423 Bacteria 2000
596 Ga0590075_000007 3300059424 Bacteria 63273
597 Ga0590075_000144 3300059424 Bacteria 18953
598 Ga0590075_001801 3300059424 Bacteria 5232
599 Ga0590077_000417 3300059426 Bacteria 11932
600 Ga0590077_000973 3300059426 Bacteria 7295
601 Ga0530510_0061610 3300061734 Bacteria 2716

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049576 Ga0501040_0203735 Ga0501040_0203735_19_1218 382
2 3300046522 Ga0495643_0056426 Ga0495643_0056426_127_1350 387
3 3300005577 Ga0068857_100016879 Ga0068857_1000168793 388
4 3300026116 Ga0207674_10012643 Ga0207674_1001264311 388
5 3300049575 Ga0501039_0195151 Ga0501039_0195151_302_1471 388
6 3300005445 Ga0070708_100081846 Ga0070708_1000818462 390
7 3300005331 Ga0070670_100001817 Ga0070670_1000018176 393
8 3300005353 Ga0070669_100020190 Ga0070669_1000201903 393
9 3300025907 Ga0207645_10089849 Ga0207645_100898492 393
10 3300025923 Ga0207681_10023640 Ga0207681_100236403 393
11 3300026089 Ga0207648_10067817 Ga0207648_100678173 393
12 3300049575 Ga0501039_0279501 Ga0501039_0279501_89_1291 396
13 3300049824 Ga0501045_0058227 Ga0501045_0058227_1603_2805 396
14 3300049824 Ga0501045_0097303 Ga0501045_0097303_971_2164 397
15 3300005336 Ga0070680_100176757 Ga0070680_1001767571 399
16 3300005458 Ga0070681_10331273 Ga0070681_103312731 399
17 3300025912 Ga0207707_10074606 Ga0207707_100746062 399
18 3300031852 Ga0307410_10065761 Ga0307410_100657611 399
19 3300049568 Ga0501031_0202008 Ga0501031_0202008_40_1245 399
20 3300049570 Ga0501033_0090233 Ga0501033_0090233_910_2115 399
21 3300049572 Ga0501036_0010973 Ga0501036_0010973_1115_2320 399
22 3300049576 Ga0501040_0007772 Ga0501040_0007772_1011_2216 399
23 3300049577 Ga0501041_0016156 Ga0501041_0016156_152_1357 399
24 3300049578 Ga0501042_0072879 Ga0501042_0072879_910_2115 399
25 3300049588 Ga0501072_0060066 Ga0501072_0060066_97_1302 399
26 3300049591 Ga0501075_0006007 Ga0501075_0006007_3960_5165 399
27 3300049592 Ga0501076_0109408 Ga0501076_0109408_790_1995 399
28 3300049741 Ga0501079_0012293 Ga0501079_0012293_2450_3655 399
29 3300049742 Ga0501080_0351159 Ga0501080_0351159_14_1219 399
30 3300049743 Ga0501081_0004648 Ga0501081_0004648_352_1557 399
31 3300054114 Ga0501084_0023287 Ga0501084_0023287_2854_4059 399
32 3300061734 Ga0530510_0061610 Ga0530510_0061610_363_1568 399
33 3300005334 Ga0068869_100189104 Ga0068869_1001891042 400
34 3300009094 Ga0111539_10057023 Ga0111539_100570232 400
35 3300009098 Ga0105245_10076674 Ga0105245_100766742 400
36 3300009148 Ga0105243_10104398 Ga0105243_101043981 400
37 3300009176 Ga0105242_10242750 Ga0105242_102427502 400
38 3300009553 Ga0105249_10219084 Ga0105249_102190842 400
39 3300013306 Ga0163162_10041884 Ga0163162_100418842 400
40 3300013308 Ga0157375_10008200 Ga0157375_100082001 400
41 3300013308 Ga0157375_10105312 Ga0157375_101053122 400
42 3300025908 Ga0207643_10043513 Ga0207643_100435132 400
43 3300025933 Ga0207706_10024638 Ga0207706_100246384 400
44 3300028654 Ga0265322_10000639 Ga0265322_100006397 400
45 3300042876 Ga0451577_0018663 Ga0451577_0018663_1841_3232 400
46 3300044712 Ga0453684_0122372 Ga0453684_0122372_1628_3019 400
47 3300049568 Ga0501031_0031041 Ga0501031_0031041_2074_3279 400
48 3300049582 Ga0501048_0204120 Ga0501048_0204120_39_1244 400
49 3300049588 Ga0501072_0229166 Ga0501072_0229166_83_1288 400
50 3300049741 Ga0501079_0188449 Ga0501079_0188449_199_1485 400
51 3300049742 Ga0501080_0072635 Ga0501080_0072635_1736_2941 400
52 3300050508 nmdc:mga09592_260253_c1 nmdc:mga09592_260253_c1_14_1219 400
53 3300050511 nmdc:mga08y16_78864_c1 nmdc:mga08y16_78864_c1_1786_2997 400
54 3300005293 Ga0065715_10106275 Ga0065715_101062753 401
55 3300005295 Ga0065707_10009182 Ga0065707_100091825 401
56 3300005334 Ga0068869_100043834 Ga0068869_1000438343 401
57 3300005339 Ga0070660_100128094 Ga0070660_1001280941 401
58 3300005340 Ga0070689_100037218 Ga0070689_1000372182 401
59 3300005343 Ga0070687_100029638 Ga0070687_1000296382 401
60 3300005353 Ga0070669_100039685 Ga0070669_1000396852 401
61 3300005354 Ga0070675_100104997 Ga0070675_1001049973 401
62 3300005355 Ga0070671_100040520 Ga0070671_1000405205 401
63 3300005364 Ga0070673_100005045 Ga0070673_1000050455 401
64 3300005365 Ga0070688_100017782 Ga0070688_1000177823 401
65 3300005367 Ga0070667_100073842 Ga0070667_1000738423 401
66 3300005438 Ga0070701_10020202 Ga0070701_100202023 401
67 3300005440 Ga0070705_100010537 Ga0070705_1000105372 401
68 3300005444 Ga0070694_100060398 Ga0070694_1000603983 401
69 3300005456 Ga0070678_100052387 Ga0070678_1000523873 401
70 3300005459 Ga0068867_100033134 Ga0068867_1000331344 401
71 3300005471 Ga0070698_100017547 Ga0070698_1000175472 401
72 3300005544 Ga0070686_100027132 Ga0070686_1000271323 401
73 3300005547 Ga0070693_100026339 Ga0070693_1000263393 401
74 3300005549 Ga0070704_100043081 Ga0070704_1000430813 401
75 3300005616 Ga0068852_100023772 Ga0068852_1000237726 401
76 3300005842 Ga0068858_100073175 Ga0068858_1000731752 401
77 3300005843 Ga0068860_100041735 Ga0068860_1000417352 401
78 3300005844 Ga0068862_100054051 Ga0068862_1000540513 401
79 3300006028 Ga0070717_10081617 Ga0070717_100816171 401
80 3300007076 Ga0075435_100001599 Ga0075435_10000159910 401
81 3300007076 Ga0075435_100010023 Ga0075435_1000100235 401
82 3300009176 Ga0105242_10019296 Ga0105242_100192965 401
83 3300025907 Ga0207645_10007025 Ga0207645_100070252 401
84 3300025913 Ga0207695_10255746 Ga0207695_102557462 401
85 3300025918 Ga0207662_10006169 Ga0207662_100061694 401
86 3300025933 Ga0207706_10074505 Ga0207706_100745053 401
87 3300025940 Ga0207691_10007779 Ga0207691_100077796 401
88 3300025942 Ga0207689_10035829 Ga0207689_100358292 401
89 3300026023 Ga0207677_10090352 Ga0207677_100903522 401
90 3300026075 Ga0207708_10024085 Ga0207708_100240854 401
91 3300026089 Ga0207648_10013802 Ga0207648_100138022 401
92 3300026118 Ga0207675_100047723 Ga0207675_1000477233 401
93 3300028380 Ga0268265_10092745 Ga0268265_100927452 401
94 3300028381 Ga0268264_10118343 Ga0268264_101183432 401
95 3300037068 Ga0373925_0143143 Ga0373925_0143143_230_1447 401
96 3300046455 Ga0495603_0023454 Ga0495603_0023454_2083_3315 401
97 3300046499 Ga0495594_0017685 Ga0495594_0017685_1861_3093 401
98 3300046674 Ga0495588_0017613 Ga0495588_0017613_2185_3417 401
99 3300050492 nmdc:mga0yw44_29928_c1 nmdc:mga0yw44_29928_c1_711_1925 401
100 3300005329 Ga0070683_100000698 Ga0070683_1000006989 402
101 3300005354 Ga0070675_100000001 Ga0070675_10000000183 402
102 3300006051 Ga0075364_10043289 Ga0075364_100432892 402
103 3300009036 Ga0105244_10029742 Ga0105244_100297423 402
104 3300009148 Ga0105243_10015475 Ga0105243_100154755 402
105 3300009176 Ga0105242_10017434 Ga0105242_100174343 402
106 3300011119 Ga0105246_10021530 Ga0105246_100215303 402
107 3300014326 Ga0157380_10037009 Ga0157380_100370093 402
108 3300025909 Ga0207705_10158958 Ga0207705_101589581 402
109 3300025926 Ga0207659_10000004 Ga0207659_1000000481 402
110 3300026075 Ga0207708_10000831 Ga0207708_100008318 402
111 3300027907 Ga0207428_10000020 Ga0207428_10000020134 402
112 3300046515 Ga0495620_0002828 Ga0495620_0002828_5912_7120 402
113 3300049571 Ga0501034_0006898 Ga0501034_0006898_6857_8074 402
114 3300050491 nmdc:mga00v17_39966_c1 nmdc:mga00v17_39966_c1_516_1733 402
115 3300050511 nmdc:mga08y16_20_c1 nmdc:mga08y16_20_c1_168562_169770 402
116 3300005293 Ga0065715_10115291 Ga0065715_101152912 403
117 3300005547 Ga0070693_100033923 Ga0070693_1000339232 403
118 3300006844 Ga0075428_100013108 Ga0075428_1000131083 403
119 3300006846 Ga0075430_100001481 Ga0075430_10000148113 403
120 3300006852 Ga0075433_10056365 Ga0075433_100563652 403
121 3300006880 Ga0075429_100045912 Ga0075429_1000459125 403
122 3300009094 Ga0111539_10033990 Ga0111539_100339905 403
123 3300009147 Ga0114129_10034123 Ga0114129_100341232 403
124 3300009147 Ga0114129_10218355 Ga0114129_102183552 403
125 3300013307 Ga0157372_10608759 Ga0157372_106087591 403
126 3300032005 Ga0307411_10032503 Ga0307411_100325033 403
127 3300042008 Ga0439450_005388 Ga0439450_005388_90_1304 403
128 3300042436 Ga0439435_0001042 Ga0439435_0001042_79_1293 403
129 3300046683 Ga0495658_0030637 Ga0495658_0030637_576_1868 403
130 3300048912 Ga0496109_0349419 Ga0496109_0349419_153_1367 403
131 3300048913 Ga0496110_0222179 Ga0496110_0222179_367_1581 403
132 3300048914 Ga0496111_0037789 Ga0496111_0037789_2161_3408 403
133 3300048915 Ga0496112_0056377 Ga0496112_0056377_678_1892 403
134 3300050507 nmdc:mga05p37_26140_c1 nmdc:mga05p37_26140_c1_976_2196 403
135 3300050515 nmdc:mga0a205_45457_c1 nmdc:mga0a205_45457_c1_2316_3557 403
136 3300005328 Ga0070676_10164251 Ga0070676_101642511 404
137 3300005330 Ga0070690_100090228 Ga0070690_1000902282 404
138 3300005335 Ga0070666_10030359 Ga0070666_100303591 404
139 3300005438 Ga0070701_10111233 Ga0070701_101112331 404
140 3300005543 Ga0070672_100015081 Ga0070672_1000150812 404
141 3300005548 Ga0070665_100108499 Ga0070665_1001084993 404
142 3300005564 Ga0070664_100007452 Ga0070664_1000074521 404
143 3300005617 Ga0068859_100006708 Ga0068859_1000067083 404
144 3300005719 Ga0068861_100019579 Ga0068861_1000195791 404
145 3300006880 Ga0075429_100007109 Ga0075429_1000071093 404
146 3300006881 Ga0068865_100023056 Ga0068865_1000230563 404
147 3300006931 Ga0097620_100006708 Ga0097620_1000067083 404
148 3300013297 Ga0157378_10014960 Ga0157378_100149606 404
149 3300014326 Ga0157380_10060407 Ga0157380_100604072 404
150 3300014326 Ga0157380_10272980 Ga0157380_102729802 404
151 3300017792 Ga0163161_10095417 Ga0163161_100954172 404
152 3300025940 Ga0207691_10003313 Ga0207691_1000331311 404
153 3300025945 Ga0207679_10199719 Ga0207679_101997192 404
154 3300026023 Ga0207677_10088764 Ga0207677_100887642 404
155 3300026075 Ga0207708_10015853 Ga0207708_100158536 404
156 3300028380 Ga0268265_10043975 Ga0268265_100439753 404
157 3300035242 Ga0373962_0011384 Ga0373962_0011384_976_2199 404
158 3300042439 Ga0439464_0043222 Ga0439464_0043222_18_1241 404
159 3300048912 Ga0496109_0390920 Ga0496109_0390920_38_1261 404
160 3300048916 Ga0496113_0291467 Ga0496113_0291467_12_1235 404
161 3300049824 Ga0501045_0068050 Ga0501045_0068050_924_2204 404
162 3300005356 Ga0070674_100001783 Ga0070674_1000017838 405
163 3300009147 Ga0114129_10000833 Ga0114129_1000083326 405
164 3300009551 Ga0105238_10019308 Ga0105238_100193086 405
165 3300014745 Ga0157377_10090086 Ga0157377_100900862 405
166 3300025893 Ga0207682_10019869 Ga0207682_100198692 405
167 3300025924 Ga0207694_10061573 Ga0207694_100615733 405
168 3300026067 Ga0207678_10156071 Ga0207678_101560712 405
169 3300050507 nmdc:mga05p37_1896_c1 nmdc:mga05p37_1896_c1_10374_11597 405
170 3300006847 Ga0075431_100109646 Ga0075431_1001096462 406
171 3300042156 Ga0439446_0016449 Ga0439446_0016449_570_1847 406
172 3300049521 Ga0501298_007062 Ga0501298_007062_172_1506 406
173 3300049678 Ga0501248_000264 Ga0501248_000264_587_1921 406
174 3300050510 nmdc:mga06r32_50460_c1 nmdc:mga06r32_50460_c1_2190_3464 406
175 3300005293 Ga0065715_10002535 Ga0065715_100025356 407
176 3300005333 Ga0070677_10092860 Ga0070677_100928601 407
177 3300005345 Ga0070692_10013314 Ga0070692_100133144 407
178 3300026118 Ga0207675_100059346 Ga0207675_1000593462 407
179 3300050512 nmdc:mga0n895_57073_c1 nmdc:mga0n895_57073_c1_866_2119 407
180 3300050515 nmdc:mga0a205_215911_c1 nmdc:mga0a205_215911_c1_520_1779 407
181 3300005290 Ga0065712_10124079 Ga0065712_101240792 408
182 3300005331 Ga0070670_100033332 Ga0070670_1000333325 408
183 3300005356 Ga0070674_100036881 Ga0070674_1000368812 408
184 3300050512 nmdc:mga0n895_72713_c1 nmdc:mga0n895_72713_c1_1788_3113 408
185 3300042436 Ga0439435_0000832 Ga0439435_0000832_1011_2267 409
186 3300050509 nmdc:mga0qj67_191287_c1 nmdc:mga0qj67_191287_c1_82_1380 409
187 3300059423 Ga0590074_006103 Ga0590074_006103_629_1948 409
188 3300059424 Ga0590075_001801 Ga0590075_001801_1065_2384 409
189 3300059426 Ga0590077_000417 Ga0590077_000417_620_1939 409
190 3300006844 Ga0075428_100000712 Ga0075428_10000071210 410
191 3300006852 Ga0075433_10005012 Ga0075433_100050126 410
192 3300006871 Ga0075434_100027168 Ga0075434_1000271686 410
193 3300006880 Ga0075429_100028828 Ga0075429_1000288284 410
194 3300009177 Ga0105248_10238807 Ga0105248_102388072 410
195 3300021384 Ga0213876_10019093 Ga0213876_100190932 410
196 3300027907 Ga0207428_10001886 Ga0207428_100018868 410
197 3300031548 Ga0307408_100172186 Ga0307408_1001721861 410
198 3300042876 Ga0451577_0001886 Ga0451577_0001886_12395_13657 410
199 3300044712 Ga0453684_0048467 Ga0453684_0048467_918_2180 410
200 3300045051 Ga0451576_0075730 Ga0451576_0075730_1862_3124 410
201 3300048909 Ga0496106_0065422 Ga0496106_0065422_1255_2541 410
202 3300048912 Ga0496109_0046351 Ga0496109_0046351_22_1308 410
203 3300049572 Ga0501036_0032522 Ga0501036_0032522_1602_2867 410
204 3300049578 Ga0501042_0029340 Ga0501042_0029340_966_2231 410
205 3300049588 Ga0501072_0045916 Ga0501072_0045916_1748_3013 410
206 3300050509 nmdc:mga0qj67_43388_c1 nmdc:mga0qj67_43388_c1_1951_3204 410
207 3300050515 nmdc:mga0a205_84_c1 nmdc:mga0a205_84_c1_50126_51376 410
208 3300005445 Ga0070708_100025381 Ga0070708_1000253816 411
209 3300007076 Ga0075435_100137373 Ga0075435_1001373732 411
210 3300009176 Ga0105242_10107146 Ga0105242_101071461 411
211 3300025942 Ga0207689_10220038 Ga0207689_102200381 411
212 3300005289 Ga0065704_10002562 Ga0065704_100025623 412
213 3300005329 Ga0070683_100022034 Ga0070683_1000220346 412
214 3300005330 Ga0070690_100037875 Ga0070690_1000378753 412
215 3300005331 Ga0070670_100006347 Ga0070670_1000063474 412
216 3300005334 Ga0068869_100066190 Ga0068869_1000661902 412
217 3300005340 Ga0070689_100028948 Ga0070689_1000289484 412
218 3300005340 Ga0070689_100156730 Ga0070689_1001567302 412
219 3300005343 Ga0070687_100013994 Ga0070687_1000139943 412
220 3300005343 Ga0070687_100065050 Ga0070687_1000650502 412
221 3300005347 Ga0070668_100097518 Ga0070668_1000975182 412
222 3300005354 Ga0070675_100003568 Ga0070675_1000035685 412
223 3300005354 Ga0070675_100027617 Ga0070675_1000276174 412
224 3300005354 Ga0070675_100078776 Ga0070675_1000787761 412
225 3300005364 Ga0070673_100210012 Ga0070673_1002100122 412
226 3300005365 Ga0070688_100024876 Ga0070688_1000248762 412
227 3300005367 Ga0070667_100213713 Ga0070667_1002137132 412
228 3300005444 Ga0070694_100167163 Ga0070694_1001671632 412
229 3300005457 Ga0070662_100047662 Ga0070662_1000476622 412
230 3300005459 Ga0068867_100041702 Ga0068867_1000417024 412
231 3300005577 Ga0068857_100031138 Ga0068857_1000311384 412
232 3300005615 Ga0070702_100098578 Ga0070702_1000985781 412
233 3300005617 Ga0068859_100009529 Ga0068859_1000095293 412
234 3300005617 Ga0068859_100040701 Ga0068859_1000407012 412
235 3300005618 Ga0068864_100145680 Ga0068864_1001456801 412
236 3300005618 Ga0068864_100273119 Ga0068864_1002731191 412
237 3300005719 Ga0068861_100017626 Ga0068861_1000176262 412
238 3300005840 Ga0068870_10002885 Ga0068870_100028856 412
239 3300005842 Ga0068858_100009371 Ga0068858_1000093718 412
240 3300005843 Ga0068860_100015767 Ga0068860_1000157672 412
241 3300005844 Ga0068862_100022008 Ga0068862_1000220083 412
242 3300006931 Ga0097620_100009529 Ga0097620_1000095293 412
243 3300006931 Ga0097620_100040704 Ga0097620_1000407042 412
244 3300007076 Ga0075435_100106039 Ga0075435_1001060393 412
245 3300009094 Ga0111539_10196510 Ga0111539_101965102 412
246 3300009094 Ga0111539_10215981 Ga0111539_102159812 412
247 3300009147 Ga0114129_10052656 Ga0114129_100526565 412
248 3300009147 Ga0114129_10076433 Ga0114129_100764332 412
249 3300014325 Ga0163163_10042464 Ga0163163_100424642 412
250 3300025907 Ga0207645_10035702 Ga0207645_100357023 412
251 3300025918 Ga0207662_10021244 Ga0207662_100212443 412
252 3300025918 Ga0207662_10098175 Ga0207662_100981752 412
253 3300025923 Ga0207681_10008076 Ga0207681_100080764 412
254 3300025925 Ga0207650_10100574 Ga0207650_101005741 412
255 3300025926 Ga0207659_10001597 Ga0207659_100015973 412
256 3300025926 Ga0207659_10024361 Ga0207659_100243614 412
257 3300025933 Ga0207706_10063424 Ga0207706_100634242 412
258 3300025936 Ga0207670_10116883 Ga0207670_101168832 412
259 3300025961 Ga0207712_10057685 Ga0207712_100576851 412
260 3300025972 Ga0207668_10136328 Ga0207668_101363282 412
261 3300025986 Ga0207658_10132617 Ga0207658_101326172 412
262 3300026035 Ga0207703_10023860 Ga0207703_100238602 412
263 3300026075 Ga0207708_10049384 Ga0207708_100493842 412
264 3300026075 Ga0207708_10093326 Ga0207708_100933262 412
265 3300026089 Ga0207648_10001542 Ga0207648_100015424 412
266 3300026095 Ga0207676_10059160 Ga0207676_100591602 412
267 3300026095 Ga0207676_10164233 Ga0207676_101642332 412
268 3300026116 Ga0207674_10029631 Ga0207674_100296314 412
269 3300026118 Ga0207675_100028322 Ga0207675_1000283222 412
270 3300027907 Ga0207428_10063354 Ga0207428_100633543 412
271 3300028380 Ga0268265_10006601 Ga0268265_100066014 412
272 3300028381 Ga0268264_10019905 Ga0268264_100199054 412
273 3300046472 Ga0495580_0000238 Ga0495580_0000238_9560_10906 412
274 3300046558 Ga0495633_0039990 Ga0495633_0039990_264_1556 412
275 3300046664 Ga0495659_0003162 Ga0495659_0003162_3090_4388 412
276 3300049577 Ga0501041_0073736 Ga0501041_0073736_714_2000 412
277 3300049578 Ga0501042_0013763 Ga0501042_0013763_2697_3983 412
278 3300049583 Ga0501067_0115710 Ga0501067_0115710_116_1426 412
279 3300049585 Ga0501069_0034817 Ga0501069_0034817_524_1834 412
280 3300049591 Ga0501075_0005648 Ga0501075_0005648_2721_4007 412
281 3300049741 Ga0501079_0016364 Ga0501079_0016364_1430_2716 412
282 3300049743 Ga0501081_0037449 Ga0501081_0037449_72_1358 412
283 3300050511 nmdc:mga08y16_152316_c1 nmdc:mga08y16_152316_c1_936_2234 412
284 3300050511 nmdc:mga08y16_310439_c1 nmdc:mga08y16_310439_c1_208_1476 412
285 3300050513 nmdc:mga0rr50_10388_c1 nmdc:mga0rr50_10388_c1_3801_5084 412
286 3300005331 Ga0070670_100008954 Ga0070670_1000089543 413
287 3300005341 Ga0070691_10017381 Ga0070691_100173814 413
288 3300005354 Ga0070675_100065653 Ga0070675_1000656533 413
289 3300005545 Ga0070695_100037605 Ga0070695_1000376053 413
290 3300005564 Ga0070664_100039831 Ga0070664_1000398312 413
291 3300005841 Ga0068863_100176016 Ga0068863_1001760162 413
292 3300005841 Ga0068863_100232070 Ga0068863_1002320702 413
293 3300005844 Ga0068862_100108746 Ga0068862_1001087462 413
294 3300006048 Ga0075363_100050703 Ga0075363_1000507032 413
295 3300006051 Ga0075364_10004069 Ga0075364_100040696 413
296 3300006051 Ga0075364_10015143 Ga0075364_100151434 413
297 3300006178 Ga0075367_10012355 Ga0075367_100123552 413
298 3300006195 Ga0075366_10018398 Ga0075366_100183982 413
299 3300006844 Ga0075428_100005989 Ga0075428_1000059894 413
300 3300006846 Ga0075430_100035134 Ga0075430_1000351342 413
301 3300006847 Ga0075431_100021127 Ga0075431_1000211272 413
302 3300006871 Ga0075434_100003306 Ga0075434_1000033068 413
303 3300007076 Ga0075435_100257905 Ga0075435_1002579051 413
304 3300009094 Ga0111539_10015750 Ga0111539_100157505 413
305 3300009147 Ga0114129_10003679 Ga0114129_100036799 413
306 3300009147 Ga0114129_10069644 Ga0114129_100696443 413
307 3300009148 Ga0105243_10014270 Ga0105243_100142703 413
308 3300009174 Ga0105241_10053819 Ga0105241_100538193 413
309 3300009177 Ga0105248_10049547 Ga0105248_100495476 413
310 3300013297 Ga0157378_10126030 Ga0157378_101260302 413
311 3300013306 Ga0163162_10010498 Ga0163162_100104988 413
312 3300014325 Ga0163163_10082987 Ga0163163_100829872 413
313 3300025926 Ga0207659_10027165 Ga0207659_100271652 413
314 3300025927 Ga0207687_10001731 Ga0207687_100017314 413
315 3300025940 Ga0207691_10125348 Ga0207691_101253482 413
316 3300025940 Ga0207691_10213633 Ga0207691_102136332 413
317 3300025960 Ga0207651_10005227 Ga0207651_100052273 413
318 3300026041 Ga0207639_10000003 Ga0207639_10000003537 413
319 3300026088 Ga0207641_10197885 Ga0207641_101978852 413
320 3300026095 Ga0207676_10047741 Ga0207676_100477413 413
321 3300026121 Ga0207683_10018323 Ga0207683_100183232 413
322 3300027907 Ga0207428_10010619 Ga0207428_100106195 413
323 3300035691 Ga0373931_0082431 Ga0373931_0082431_413_1678 413
324 3300045051 Ga0451576_0119145 Ga0451576_0119145_212_1519 413
325 3300046539 Ga0495621_0010739 Ga0495621_0010739_1484_2791 413
326 3300046664 Ga0495659_0007707 Ga0495659_0007707_856_2175 413
327 3300048904 Ga0496101_0148416 Ga0496101_0148416_362_1687 413
328 3300048915 Ga0496112_0203238 Ga0496112_0203238_219_1532 413
329 3300049572 Ga0501036_0060610 Ga0501036_0060610_1778_3022 413
330 3300049576 Ga0501040_0108464 Ga0501040_0108464_644_1891 413
331 3300049577 Ga0501041_0088922 Ga0501041_0088922_367_1611 413
332 3300049588 Ga0501072_0003442 Ga0501072_0003442_2021_3265 413
333 3300049593 Ga0501077_0066959 Ga0501077_0066959_938_2182 413
334 3300050491 nmdc:mga00v17_20975_c1 nmdc:mga00v17_20975_c1_569_1861 413
335 3300050491 nmdc:mga00v17_9552_c1 nmdc:mga00v17_9552_c1_1931_3223 413
336 3300050492 nmdc:mga0yw44_11869_c1 nmdc:mga0yw44_11869_c1_1003_2295 413
337 3300050494 nmdc:mga06z11_24140_c1 nmdc:mga06z11_24140_c1_747_2039 413
338 3300050496 nmdc:mga07m45_42159_c1 nmdc:mga07m45_42159_c1_911_2203 413
339 3300050507 nmdc:mga05p37_3758_c1 nmdc:mga05p37_3758_c1_6545_7855 413
340 3300050507 nmdc:mga05p37_39178_c1 nmdc:mga05p37_39178_c1_4382_5686 413
341 3300050509 nmdc:mga0qj67_57090_c1 nmdc:mga0qj67_57090_c1_212_1510 413
342 3300050510 nmdc:mga06r32_52227_c1 nmdc:mga06r32_52227_c1_42_1340 413
343 3300050511 nmdc:mga08y16_14551_c1 nmdc:mga08y16_14551_c1_1659_2978 413
344 3300050512 nmdc:mga0n895_112051_c1 nmdc:mga0n895_112051_c1_642_1967 413
345 3300050512 nmdc:mga0n895_12672_c1 nmdc:mga0n895_12672_c1_1215_2531 413
346 3300050512 nmdc:mga0n895_9942_c1 nmdc:mga0n895_9942_c1_2898_4208 413
347 3300050513 nmdc:mga0rr50_23321_c1 nmdc:mga0rr50_23321_c1_381_1697 413
348 3300050515 nmdc:mga0a205_27213_c1 nmdc:mga0a205_27213_c1_2654_3964 413
349 3300005328 Ga0070676_10002232 Ga0070676_100022326 414
350 3300005334 Ga0068869_100002035 Ga0068869_1000020357 414
351 3300005353 Ga0070669_100005634 Ga0070669_1000056346 414
352 3300005354 Ga0070675_100002958 Ga0070675_1000029585 414
353 3300005354 Ga0070675_100006135 Ga0070675_1000061355 414
354 3300005356 Ga0070674_100048258 Ga0070674_1000482582 414
355 3300005364 Ga0070673_100004841 Ga0070673_1000048414 414
356 3300005364 Ga0070673_100038577 Ga0070673_1000385773 414
357 3300005438 Ga0070701_10016676 Ga0070701_100166763 414
358 3300005459 Ga0068867_100000578 Ga0068867_1000005786 414
359 3300005617 Ga0068859_100125648 Ga0068859_1001256482 414
360 3300005617 Ga0068859_100314843 Ga0068859_1003148431 414
361 3300005618 Ga0068864_100158522 Ga0068864_1001585222 414
362 3300005718 Ga0068866_10048849 Ga0068866_100488492 414
363 3300005719 Ga0068861_100036701 Ga0068861_1000367012 414
364 3300005843 Ga0068860_100042097 Ga0068860_1000420973 414
365 3300006358 Ga0068871_100192167 Ga0068871_1001921672 414
366 3300006844 Ga0075428_100004770 Ga0075428_10000477013 414
367 3300006846 Ga0075430_100006691 Ga0075430_1000066914 414
368 3300006847 Ga0075431_100021230 Ga0075431_1000212306 414
369 3300006852 Ga0075433_10003206 Ga0075433_100032063 414
370 3300006880 Ga0075429_100028011 Ga0075429_1000280112 414
371 3300006881 Ga0068865_100001886 Ga0068865_1000018867 414
372 3300006931 Ga0097620_100125647 Ga0097620_1001256472 414
373 3300006931 Ga0097620_100314855 Ga0097620_1003148551 414
374 3300009094 Ga0111539_10033958 Ga0111539_100339582 414
375 3300009147 Ga0114129_10021996 Ga0114129_100219965 414
376 3300014745 Ga0157377_10052576 Ga0157377_100525761 414
377 3300025907 Ga0207645_10005408 Ga0207645_100054083 414
378 3300025923 Ga0207681_10004748 Ga0207681_100047487 414
379 3300025926 Ga0207659_10001166 Ga0207659_100011665 414
380 3300025926 Ga0207659_10002915 Ga0207659_100029157 414
381 3300025934 Ga0207686_10004977 Ga0207686_100049773 414
382 3300025935 Ga0207709_10004516 Ga0207709_100045162 414
383 3300025936 Ga0207670_10072279 Ga0207670_100722792 414
384 3300025937 Ga0207669_10038374 Ga0207669_100383742 414
385 3300025938 Ga0207704_10003884 Ga0207704_100038843 414
386 3300025940 Ga0207691_10011105 Ga0207691_100111055 414
387 3300025942 Ga0207689_10002433 Ga0207689_1000243310 414
388 3300025960 Ga0207651_10000813 Ga0207651_100008139 414
389 3300025960 Ga0207651_10040819 Ga0207651_100408192 414
390 3300026035 Ga0207703_10026979 Ga0207703_100269793 414
391 3300026075 Ga0207708_10027304 Ga0207708_100273043 414
392 3300026089 Ga0207648_10001252 Ga0207648_1000125212 414
393 3300026116 Ga0207674_10285819 Ga0207674_102858191 414
394 3300026118 Ga0207675_100017435 Ga0207675_1000174352 414
395 3300026121 Ga0207683_10038335 Ga0207683_100383354 414
396 3300028381 Ga0268264_10041798 Ga0268264_100417984 414
397 3300031548 Ga0307408_100035117 Ga0307408_1000351172 414
398 3300031852 Ga0307410_10169692 Ga0307410_101696922 414
399 3300031911 Ga0307412_10051844 Ga0307412_100518442 414
400 3300046472 Ga0495580_0033949 Ga0495580_0033949_737_2080 414
401 3300049744 Ga0501083_0103992 Ga0501083_0103992_503_1810 414
402 3300050515 nmdc:mga0a205_6319_c1 nmdc:mga0a205_6319_c1_8528_9829 414
403 3300005290 Ga0065712_10002276 Ga0065712_100022769 415
404 3300005329 Ga0070683_100004931 Ga0070683_1000049313 415
405 3300005333 Ga0070677_10014276 Ga0070677_100142762 415
406 3300005344 Ga0070661_100003066 Ga0070661_1000030667 415
407 3300005353 Ga0070669_100019769 Ga0070669_1000197693 415
408 3300005353 Ga0070669_100058100 Ga0070669_1000581002 415
409 3300005354 Ga0070675_100018904 Ga0070675_1000189043 415
410 3300005354 Ga0070675_100104078 Ga0070675_1001040782 415
411 3300005355 Ga0070671_100019646 Ga0070671_1000196465 415
412 3300005356 Ga0070674_100000032 Ga0070674_10000003246 415
413 3300005364 Ga0070673_100038252 Ga0070673_1000382522 415
414 3300005364 Ga0070673_100062164 Ga0070673_1000621642 415
415 3300005364 Ga0070673_100099603 Ga0070673_1000996032 415
416 3300005456 Ga0070678_100078415 Ga0070678_1000784152 415
417 3300005456 Ga0070678_100180529 Ga0070678_1001805291 415
418 3300005535 Ga0070684_100002600 Ga0070684_1000026008 415
419 3300005564 Ga0070664_100004110 Ga0070664_1000041103 415
420 3300005616 Ga0068852_100057813 Ga0068852_1000578132 415
421 3300005840 Ga0068870_10018405 Ga0068870_100184052 415
422 3300006844 Ga0075428_100000166 Ga0075428_1000001669 415
423 3300006844 Ga0075428_100003413 Ga0075428_10000341311 415
424 3300006844 Ga0075428_100028630 Ga0075428_1000286304 415
425 3300006846 Ga0075430_100000691 Ga0075430_10000069110 415
426 3300006846 Ga0075430_100011371 Ga0075430_1000113712 415
427 3300006847 Ga0075431_100001885 Ga0075431_1000018859 415
428 3300006847 Ga0075431_100035531 Ga0075431_1000355312 415
429 3300006847 Ga0075431_100063640 Ga0075431_1000636401 415
430 3300006852 Ga0075433_10001456 Ga0075433_1000145616 415
431 3300006880 Ga0075429_100028295 Ga0075429_1000282954 415
432 3300009094 Ga0111539_10007840 Ga0111539_100078406 415
433 3300009094 Ga0111539_10075129 Ga0111539_100751293 415
434 3300009553 Ga0105249_10007783 Ga0105249_100077836 415
435 3300013306 Ga0163162_10019877 Ga0163162_100198773 415
436 3300013308 Ga0157375_10231171 Ga0157375_102311712 415
437 3300014325 Ga0163163_10006898 Ga0163163_100068985 415
438 3300014326 Ga0157380_10000799 Ga0157380_100007996 415
439 3300014968 Ga0157379_10083078 Ga0157379_100830782 415
440 3300025907 Ga0207645_10000611 Ga0207645_1000061125 415
441 3300025908 Ga0207643_10000068 Ga0207643_1000006820 415
442 3300025908 Ga0207643_10024226 Ga0207643_100242262 415
443 3300025920 Ga0207649_10101100 Ga0207649_101011002 415
444 3300025923 Ga0207681_10012428 Ga0207681_100124283 415
445 3300025923 Ga0207681_10037398 Ga0207681_100373981 415
446 3300025925 Ga0207650_10174502 Ga0207650_101745022 415
447 3300025926 Ga0207659_10003941 Ga0207659_100039415 415
448 3300025926 Ga0207659_10084945 Ga0207659_100849452 415
449 3300025933 Ga0207706_10052666 Ga0207706_100526661 415
450 3300025938 Ga0207704_10085049 Ga0207704_100850492 415
451 3300025940 Ga0207691_10033132 Ga0207691_100331322 415
452 3300025942 Ga0207689_10000219 Ga0207689_100002196 415
453 3300025944 Ga0207661_10003578 Ga0207661_100035784 415
454 3300025945 Ga0207679_10017428 Ga0207679_100174283 415
455 3300026067 Ga0207678_10032344 Ga0207678_100323444 415
456 3300026088 Ga0207641_10116122 Ga0207641_101161222 415
457 3300026089 Ga0207648_10044752 Ga0207648_100447524 415
458 3300026118 Ga0207675_100019206 Ga0207675_1000192064 415
459 3300026121 Ga0207683_10043518 Ga0207683_100435182 415
460 3300026121 Ga0207683_10098491 Ga0207683_100984912 415
461 3300027907 Ga0207428_10019347 Ga0207428_100193475 415
462 3300028380 Ga0268265_10194635 Ga0268265_101946352 415
463 3300048905 Ga0496102_0127333 Ga0496102_0127333_842_2164 415
464 3300048907 Ga0496104_0004276 Ga0496104_0004276_2270_3619 415
465 3300048911 Ga0496108_0044331 Ga0496108_0044331_21_1370 415
466 3300048913 Ga0496110_0005783 Ga0496110_0005783_496_1845 415
467 3300048915 Ga0496112_0005550 Ga0496112_0005550_393_1742 415
468 3300048915 Ga0496112_0020671 Ga0496112_0020671_3421_4743 415
469 3300048916 Ga0496113_0028592 Ga0496113_0028592_2049_3371 415
470 3300049592 Ga0501076_0007938 Ga0501076_0007938_544_1860 415
471 3300050507 nmdc:mga05p37_133328_c1 nmdc:mga05p37_133328_c1_1650_2993 415
472 3300050507 nmdc:mga05p37_5747_c1 nmdc:mga05p37_5747_c1_13248_14564 415
473 3300050508 nmdc:mga09592_137294_c1 nmdc:mga09592_137294_c1_733_2067 415
474 3300050508 nmdc:mga09592_73952_c1 nmdc:mga09592_73952_c1_1181_2497 415
475 3300050510 nmdc:mga06r32_102054_c1 nmdc:mga06r32_102054_c1_965_2281 415
476 3300050511 nmdc:mga08y16_105253_c1 nmdc:mga08y16_105253_c1_1432_2766 415
477 3300050512 nmdc:mga0n895_16759_c1 nmdc:mga0n895_16759_c1_4915_6249 415
478 3300050512 nmdc:mga0n895_222479_c1 nmdc:mga0n895_222479_c1_458_1807 415
479 3300050515 nmdc:mga0a205_13094_c1 nmdc:mga0a205_13094_c1_3009_4343 415
480 3300059421 Ga0590071_000063 Ga0590071_000063_11788_13116 415
481 3300059423 Ga0590074_000652 Ga0590074_000652_2471_3799 415
482 3300059424 Ga0590075_000007 Ga0590075_000007_55793_57121 415
483 3300005290 Ga0065712_10075446 Ga0065712_100754462 416
484 3300005333 Ga0070677_10046460 Ga0070677_100464601 416
485 3300005338 Ga0068868_100025104 Ga0068868_1000251045 416
486 3300005367 Ga0070667_100008279 Ga0070667_1000082799 416
487 3300005440 Ga0070705_100000775 Ga0070705_1000007752 416
488 3300005444 Ga0070694_100007561 Ga0070694_1000075615 416
489 3300005456 Ga0070678_100020222 Ga0070678_1000202222 416
490 3300005457 Ga0070662_100007770 Ga0070662_1000077703 416
491 3300005471 Ga0070698_100001133 Ga0070698_10000113315 416
492 3300005518 Ga0070699_100000125 Ga0070699_10000012520 416
493 3300005518 Ga0070699_100029178 Ga0070699_1000291784 416
494 3300005536 Ga0070697_100082466 Ga0070697_1000824662 416
495 3300005545 Ga0070695_100000040 Ga0070695_10000004019 416
496 3300005546 Ga0070696_100006647 Ga0070696_1000066476 416
497 3300005546 Ga0070696_100016747 Ga0070696_1000167473 416
498 3300005546 Ga0070696_100075987 Ga0070696_1000759872 416
499 3300005719 Ga0068861_100254252 Ga0068861_1002542522 416
500 3300005841 Ga0068863_100006263 Ga0068863_1000062638 416
501 3300006852 Ga0075433_10035761 Ga0075433_100357613 416
502 3300006880 Ga0075429_100024850 Ga0075429_1000248503 416
503 3300007076 Ga0075435_100039348 Ga0075435_1000393483 416
504 3300009094 Ga0111539_10042125 Ga0111539_100421253 416
505 3300009147 Ga0114129_10016193 Ga0114129_100161938 416
506 3300009147 Ga0114129_10083928 Ga0114129_100839283 416
507 3300009147 Ga0114129_10122367 Ga0114129_101223674 416
508 3300014745 Ga0157377_10038989 Ga0157377_100389893 416
509 3300025893 Ga0207682_10004881 Ga0207682_100048812 416
510 3300025926 Ga0207659_10097547 Ga0207659_100975472 416
511 3300026088 Ga0207641_10038176 Ga0207641_100381763 416
512 3300026118 Ga0207675_100062479 Ga0207675_1000624793 416
513 3300026121 Ga0207683_10044843 Ga0207683_100448433 416
514 3300027907 Ga0207428_10022164 Ga0207428_100221643 416
515 3300031548 Ga0307408_100026245 Ga0307408_1000262453 416
516 3300039437 Ga0436365_0342535 Ga0436365_0342535_1815_3122 416
517 3300041486 Ga0451807_1409687 Ga0451807_1409687_1582_2916 416
518 3300048916 Ga0496113_0093334 Ga0496113_0093334_299_1606 416
519 3300049572 Ga0501036_0256283 Ga0501036_0256283_98_1399 416
520 3300049592 Ga0501076_0132692 Ga0501076_0132692_423_1703 416
521 3300049743 Ga0501081_0029395 Ga0501081_0029395_202_1521 416
522 3300050507 nmdc:mga05p37_39349_c1 nmdc:mga05p37_39349_c1_4300_5595 416
523 3300050507 nmdc:mga05p37_81426_c1 nmdc:mga05p37_81426_c1_1312_2628 416
524 3300050511 nmdc:mga08y16_26915_c1 nmdc:mga08y16_26915_c1_4096_5403 416
525 3300050513 nmdc:mga0rr50_63219_c1 nmdc:mga0rr50_63219_c1_453_1769 416
526 3300050515 nmdc:mga0a205_46889_c1 nmdc:mga0a205_46889_c1_899_2206 416
527 3300050515 nmdc:mga0a205_7991_c1 nmdc:mga0a205_7991_c1_5128_6444 416
528 3300054114 Ga0501084_0144690 Ga0501084_0144690_264_1583 416
529 3300005466 Ga0070685_10023632 Ga0070685_100236323 417
530 3300005471 Ga0070698_100197733 Ga0070698_1001977332 417
531 3300005548 Ga0070665_100000192 Ga0070665_10000019273 417
532 3300006846 Ga0075430_100129671 Ga0075430_1001296711 417
533 3300009094 Ga0111539_10000118 Ga0111539_100001185 417
534 3300009147 Ga0114129_10000324 Ga0114129_1000032410 417
535 3300014969 Ga0157376_10031563 Ga0157376_100315634 417
536 3300028379 Ga0268266_10000298 Ga0268266_100002989 417
537 3300042439 Ga0439464_0001219 Ga0439464_0001219_2867_4303 417
538 3300050507 nmdc:mga05p37_2154_c1 nmdc:mga05p37_2154_c1_3156_4592 417
539 3300050508 nmdc:mga09592_5395_c1 nmdc:mga09592_5395_c1_3155_4591 417
540 3300050509 nmdc:mga0qj67_20201_c1 nmdc:mga0qj67_20201_c1_784_2103 417
541 3300050510 nmdc:mga06r32_5275_c1 nmdc:mga06r32_5275_c1_8600_10036 417
542 3300050511 nmdc:mga08y16_131_c1 nmdc:mga08y16_131_c1_45990_47426 417
543 3300059421 Ga0590071_000099 Ga0590071_000099_8452_9801 417
544 3300059424 Ga0590075_000144 Ga0590075_000144_4685_6034 417
545 3300059426 Ga0590077_000973 Ga0590077_000973_705_2054 417
546 3300031911 Ga0307412_10024430 Ga0307412_100244302 418
547 3300032004 Ga0307414_10019710 Ga0307414_100197102 418
548 3300032004 Ga0307414_10155021 Ga0307414_101550212 418
549 3300046499 Ga0495594_0045760 Ga0495594_0045760_657_2012 418
550 3300005444 Ga0070694_100016356 Ga0070694_1000163566 419
551 3300005468 Ga0070707_100146731 Ga0070707_1001467312 419
552 3300005518 Ga0070699_100037796 Ga0070699_1000377965 419
553 3300005546 Ga0070696_100029867 Ga0070696_1000298672 419
554 3300005549 Ga0070704_100014038 Ga0070704_1000140385 419
555 3300006844 Ga0075428_100125333 Ga0075428_1001253332 419
556 3300006871 Ga0075434_100111278 Ga0075434_1001112782 419
557 3300009147 Ga0114129_10254252 Ga0114129_102542522 419
558 3300046528 Ga0495642_0012598 Ga0495642_0012598_959_2296 419
559 3300047318 Ga0495636_0011354 Ga0495636_0011354_1903_3240 419
560 3300050511 nmdc:mga08y16_870_c1 nmdc:mga08y16_870_c1_11560_12879 419
561 3300050512 nmdc:mga0n895_36489_c1 nmdc:mga0n895_36489_c1_1273_2598 419
562 3300050515 nmdc:mga0a205_82090_c1 nmdc:mga0a205_82090_c1_912_2237 419
563 3300005288 Ga0065714_10075646 Ga0065714_100756463 426
564 3300005290 Ga0065712_10000173 Ga0065712_100001737 426
565 3300005293 Ga0065715_10000280 Ga0065715_1000028010 426
566 3300005330 Ga0070690_100133411 Ga0070690_1001334111 426
567 3300005331 Ga0070670_100002545 Ga0070670_10000254510 426
568 3300005353 Ga0070669_100027985 Ga0070669_1000279852 426
569 3300005354 Ga0070675_100041389 Ga0070675_1000413892 426
570 3300005365 Ga0070688_100003806 Ga0070688_1000038062 426
571 3300005367 Ga0070667_100040961 Ga0070667_1000409614 426
572 3300005466 Ga0070685_10159560 Ga0070685_101595601 426
573 3300005543 Ga0070672_100106820 Ga0070672_1001068203 426
574 3300005546 Ga0070696_100216999 Ga0070696_1002169991 426
575 3300005548 Ga0070665_100297512 Ga0070665_1002975122 426
576 3300005618 Ga0068864_100037806 Ga0068864_1000378062 426
577 3300005719 Ga0068861_100075521 Ga0068861_1000755212 426
578 3300005841 Ga0068863_100054102 Ga0068863_1000541022 426
579 3300005844 Ga0068862_100026042 Ga0068862_1000260422 426
580 3300006881 Ga0068865_100048854 Ga0068865_1000488543 426
581 3300009177 Ga0105248_10055240 Ga0105248_100552402 426
582 3300013296 Ga0157374_10143867 Ga0157374_101438672 426
583 3300014745 Ga0157377_10075774 Ga0157377_100757741 426
584 3300014969 Ga0157376_10036029 Ga0157376_100360292 426
585 3300025315 Ga0207697_10023261 Ga0207697_100232612 426
586 3300025923 Ga0207681_10119390 Ga0207681_101193901 426
587 3300025940 Ga0207691_10014455 Ga0207691_100144552 426
588 3300025941 Ga0207711_10138131 Ga0207711_101381313 426
589 3300025986 Ga0207658_10056418 Ga0207658_100564182 426
590 3300026088 Ga0207641_10041274 Ga0207641_100412743 426
591 3300026095 Ga0207676_10024559 Ga0207676_100245595 426
592 3300026118 Ga0207675_100061892 Ga0207675_1000618922 426
593 3300026121 Ga0207683_10028333 Ga0207683_100283335 426
594 3300028379 Ga0268266_10013999 Ga0268266_100139996 426
595 3300048907 Ga0496104_0012209 Ga0496104_0012209_2398_3678 426
596 3300048909 Ga0496106_0065669 Ga0496106_0065669_80_1363 426
597 3300048911 Ga0496108_0021366 Ga0496108_0021366_2967_4247 426
598 3300048912 Ga0496109_0003251 Ga0496109_0003251_1792_3072 426
599 3300048914 Ga0496111_0121058 Ga0496111_0121058_402_1682 426
600 3300048915 Ga0496112_0002553 Ga0496112_0002553_6619_7899 426
601 3300048916 Ga0496113_0043730 Ga0496113_0043730_729_2009 426

Structural Annotation

Top 5 Hits

ID Description Score Start End
3o0y-assembly4.cif.gz_A the crystal structure of the putative lipoprotein from colwellia psychrerythraea 0.5426 47 420
3o0y-assembly4.cif.gz_A the crystal structure of the putative lipoprotein from colwellia psychrerythraea 0.4854 47 420
3u24-assembly1.cif.gz_A the structure of a putative lipoprotein of unknown function from shewanella oneidensis. 0.4833 43 411
3u24-assembly1.cif.gz_A the structure of a putative lipoprotein of unknown function from shewanella oneidensis. 0.4318 43 411
7c8k-assembly1.cif.gz_A structural basis for cross-species recognition of covid-19 virus spike receptor binding domain to bat ace2 0.4086 15 420
ID Description Score Start End Superfamily
af_O60125_78_194_1.20.58.120 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;BAG domain 0.6629 15 106 1.20.58.120
af_F1QGM6_424_509_1.20.58.120 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;BAG domain 0.6493 10 106 1.20.58.120
af_P23894_64_157_3.30.2010.10 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.6243 164 239 3.30.2010.10
af_F1QGM6_424_509_1.20.58.120 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;BAG domain 0.6096 10 106 1.20.58.120
af_A8JNS4_461_549_1.20.58.120 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;BAG domain 0.6086 15 109 1.20.58.120
ID Description Score Start End GO Terms
AF-A0A3N5QWJ9-F1-model_v4 DUF885 domain-containing protein 0.9781 18 380
AF-A0A2V5QUP7-F1-model_v4 DUF885 domain-containing protein 0.973 32 420
AF-A0A3C1YQW9-F1-model_v4 DUF885 domain-containing protein 0.9728 18 289
AF-A0A847SIM1-F1-model_v4 DUF885 domain-containing protein 0.9727 18 420
AF-A0A434AGZ9-F1-model_v4 DUF885 domain-containing protein 0.9704 18 420

Feature Viewer

pLDDT pTM Quality
93.58 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map