F468098
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 601 | 415 | 1202 | 214 |
Family's Representative Sequence
| Representative Sequence | 3300047323|Ga0495683_0032650|Ga0495683_0032650_313_1056 |
| Length | 247 |
| Sequence | MAVASAALIRFTSCDRPEHFMNNLMQASFGVVDFWTFFLGTLFIVLLPGPNSLYVLSVAAQRGVRQGYLGACGVFVGDWILMILSACGAASLLKTSPVLFMAVKFIGAAYLGWIGLQMLIGCWRRLRAGSDVDAXXXAARMLAPVVRGVHPFKKALAISLLNPKAILFFISFFVQFVDPHFHSSLVSFGMLGLICQLLSFTYLTALIFLGTRLAAVFQRRRRLSAGLSAGVGALFMGFGLKLATATL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 5 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 6 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 7 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 8 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 9 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 10 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 11 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 12 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 14 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 15 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 16 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 17 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 18 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 19 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 20 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 22 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 23 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 24 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 25 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 26 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 36 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 37 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 38 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 39 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 40 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 41 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 42 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 43 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 44 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 45 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 46 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 47 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 48 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 63 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 64 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 65 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 66 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 68 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 69 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 70 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 78 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 79 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 82 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 83 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 85 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 87 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 90 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 93 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 114 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 116 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 117 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 118 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 119 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 120 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 121 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 122 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 123 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 124 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 125 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 126 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 127 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 128 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 129 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 130 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 131 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 132 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 133 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 134 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 135 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 136 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 137 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 138 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 139 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 140 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 141 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 142 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 143 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 144 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 145 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 146 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 147 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 148 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 149 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 150 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 151 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 152 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 153 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 154 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 155 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 156 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 157 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 158 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 159 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 160 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 161 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 162 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 163 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 164 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 165 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 166 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 167 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 168 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 169 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 170 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 171 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 172 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 173 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 174 | 3300044666 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E | Metagenome | Unclassified |
| 175 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 176 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 177 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 178 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 179 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 180 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 181 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 182 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 183 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 184 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 185 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 186 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 187 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 188 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 189 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 257 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 258 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 259 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 260 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 261 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 262 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 263 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 264 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 265 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 266 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 267 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 268 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 269 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 270 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 271 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 272 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 273 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 276 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 277 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 292 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 293 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 294 | 3300049687 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought | Metagenome | Rhizosphere |
| 295 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 296 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 297 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 298 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 299 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 300 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 301 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 305 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 306 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 307 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 311 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 312 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 313 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 314 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 315 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 316 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 317 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 319 | 2513237150 | Cupriavidus taiwanensis STM6018 | Isolate | Nodule |
| 320 | 2513237165 | Cupriavidus neocaledonicus STM6070 | Isolate | Nodule |
| 321 | 2547132103 | Chromobacterium sp. C-61 | Isolate | Rhizosphere |
| 322 | 2547132512 | Azospira oryzae 6a3 | Isolate | Unclassified |
| 323 | 2582581312 | Streptomyces atratus OK008 | Isolate | Rhizosphere |
| 324 | 2582581313 | Streptomyces mirabilis OV308 | Isolate | Rhizosphere |
| 325 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 326 | 2596583598 | Ralstonia sp. UNCCL144 | Isolate | Unclassified |
| 327 | 2599185178 | Ralstonia sp. NFACC01 | Isolate | Rhizoplane |
| 328 | 2600255292 | Janthinobacterium lividum NFR18 | Isolate | Rhizoplane |
| 329 | 2616644941 | Streptomyces atratus OK807 | Isolate | Rhizosphere |
| 330 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 331 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 332 | 2643221587 | Streptomyces sp. Root66D1 | Isolate | Unclassified |
| 333 | 2643221601 | Kitasatospora sp. Root187 | Isolate | Unclassified |
| 334 | 2643221604 | Nocardioides sp. Root190 | Isolate | Unclassified |
| 335 | 2643221617 | Nocardioides sp. Root79 | Isolate | Unclassified |
| 336 | 2643221620 | Nocardioides sp. Root240 | Isolate | Unclassified |
| 337 | 2643221631 | Kitasatospora sp. Root107 | Isolate | Unclassified |
| 338 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 339 | 2643221641 | Nocardioides sp. Root122 | Isolate | Unclassified |
| 340 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 341 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 342 | 2643221665 | Acinetobacter sp. Root1280 | Isolate | Unclassified |
| 343 | 2643221677 | Streptomyces sp. Root1304 | Isolate | Unclassified |
| 344 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 345 | 2738541305 | Nocardioides sp. CF167 | Isolate | Unclassified |
| 346 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 347 | 2739367898 | Nocardioides sp. CF479 | Isolate | Unclassified |
| 348 | 2744054655 | Acinetobacter sp. BMW17 | Isolate | Unclassified |
| 349 | 2784746763 | Streptomyces ossamyceticus SAI-001 | Isolate | Unclassified |
| 350 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 351 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 352 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 353 | 2808606375 | Streptomyces sp. SLBN-31 | Isolate | Unclassified |
| 354 | 2808606982 | Streptomyces sp. SLBN-118 | Isolate | Unclassified |
| 355 | 2811994874 | Nocardioides sp. SLBN-35 | Isolate | Unclassified |
| 356 | 2811994879 | Streptomyces sp. 4-17 | Isolate | Unclassified |
| 357 | 2834641062 | Cupriavidus gilardii JZ4 | Isolate | Unclassified |
| 358 | 2843690924 | Chromobacterium rhizoryzae JP2-74 | Isolate | Rhizosphere |
| 359 | 2846033681 | Chromobacterium sinusclupearum MWU13-2610 | Isolate | Rhizosphere |
| 360 | 2846037992 | Chromobacterium alticapitis MWU14-2602 | Isolate | Rhizosphere |
| 361 | 2852635781 | Streptomyces sp. AK010 | Isolate | Rhizosphere |
| 362 | 2857547612 | Janthinobacterium sp. R-74502 | Isolate | Unclassified |
| 363 | 2858688981 | Cupriavidus sp. UYMMa02A | Isolate | Unclassified |
| 364 | 2861520306 | Phytomonospora endophytica DSM 45386 | Isolate | Unclassified |
| 365 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 366 | 2862290372 | Streptomyces triticagri NEAU-YY421 | Isolate | Rhizosphere |
| 367 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 368 | 2862507626 | Streptomyces sp. NWU339 | Isolate | Unclassified |
| 369 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 370 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 371 | 2867428634 | Streptomyces sp. RP5T | Isolate | Unclassified |
| 372 | 2873151551 | Streptomyces silaceus ACCC40021 | Isolate | Rhizosphere |
| 373 | 2875391855 | Streptomyces cavourensis 1AS2a | Isolate | Rhizosphere |
| 374 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 375 | 2884693830 | Nonomuraea phyllanthi WYY166 | Isolate | Unclassified |
| 376 | 2885080285 | Janthinobacterium sp. AD80 | Isolate | Rhizosphere |
| 377 | 2885266251 | Ralstonia sp. SET104 | Isolate | Nodule |
| 378 | 2887478801 | Catellatospora paridis NEAU-CL2 | Isolate | Rhizosphere |
| 379 | 2891395885 | Microbispora catharanthi CR1-09 | Isolate | Unclassified |
| 380 | 2891554331 | Microbispora sp. CL1-1 | Isolate | Unclassified |
| 381 | 2891633521 | Azoarcus rhizosphaerae CC-YHH848 | Isolate | Rhizosphere |
| 382 | 2895427314 | Nonomuraea sp. PA05 | Isolate | Unclassified |
| 383 | 2895442618 | Nonomuraea phyllanthi PA1-10 | Isolate | Unclassified |
| 384 | 2900577576 | Ralstonia sp. TCR112 | Isolate | Rhizosphere |
| 385 | 2918501144 | Streptomyces sp. PvR006 | Isolate | Rhizosphere |
| 386 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 387 | 2919688452 | Pararheinheimera soli 4138 | Isolate | Unclassified |
| 388 | 2928058823 | Ralstonia sp. 1138 | Isolate | Unclassified |
| 389 | 2928515477 | Acinetobacter bereziniae 1375 | Isolate | Rhizosphere |
| 390 | 2932410948 | Janthinobacterium lividum 2829 | Isolate | Rhizosphere |
| 391 | 2932416698 | Janthinobacterium lividum 2830 | Isolate | Rhizosphere |
| 392 | 2935390628 | Streptomyces sp. PvR034 | Isolate | Rhizosphere |
| 393 | 2939602548 | Pantoea dispersa 1175 | Isolate | Rhizosphere |
| 394 | 2946064051 | Streptomyces luteogriseus W4I19-1 | Isolate | Rhizosphere |
| 395 | 2954380949 | Streptomyces ciscaucasicus W1I15 | Isolate | Rhizosphere |
| 396 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 397 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 398 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 399 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 400 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 401 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 402 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 403 | 2954759201 | Streptomyces sp. SAI-208 | Isolate | Rhizosphere |
| 404 | 2995463766 | Streptacidiphilus fuscans NEAU-YB345 | Isolate | Unclassified |
| 405 | 2998344455 | Vogesella urethralis SLBN-145 | Isolate | Rhizosphere |
| 406 | 3006393351 | Streptomyces sp. SID4985 | Isolate | Unclassified |
| 407 | 644736347 | Cupriavidus taiwanensis LMG 19424 | Isolate | Nodule |
| 408 | 8001781756 | Catellatospora tritici NEAU-YM18 | Isolate | Rhizosphere |
| 409 | 8003400568 | Cupriavidus gilardii USM5 | Isolate | Rhizosphere |
| 410 | 8008558824 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 411 | 8008574985 | Streptomyces sp. Jing01 | Isolate | Rhizosphere |
| 412 | 8033232454 | Acinetobacter radioresistens SA188 | Isolate | Unclassified |
| 413 | 8048406513 | Streptomyces heilongjiangensis NEAU-W2 | Isolate | Unclassified |
| 414 | 8055172936 | Sphaerisporangium perillae NEAU-ZS1 | Isolate | Unclassified |
| 415 | 8057568493 | Actinorhabdospora filicis NBRC 111898 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 82.53 |
| Metatranscriptomes | 1 |
| Isolates | 16.47 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.81 |
| Nodule | 1.5 |
| Rhizoplane | 1.16 |
| Rhizosphere | 66.39 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.33 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495683_0032650 | 3300047323 | Bacteria | 2651 |
| 2 | JGI24741J21665_1000679 | 3300001915 | Bacteria | 10254 |
| 3 | JGI24740J21852_10029859 | 3300001979 | Bacteria | 1784 |
| 4 | JGI24740J21852_10030041 | 3300001979 | Bacteria | 1775 |
| 5 | JGI25156J39149_1018101 | 3300002705 | Bacteria | 1313 |
| 6 | JGI25156J39149_1024588 | 3300002705 | Bacteria | 983 |
| 7 | JGI25154J39366_1000136 | 3300002738 | Bacteria | 57760 |
| 8 | JGI25151J46595_10004611 | 3300003187 | Bacteria | 7254 |
| 9 | JGI25151J46595_10026146 | 3300003187 | Bacteria | 2360 |
| 10 | JGI25151J46595_10035285 | 3300003187 | Bacteria | 1901 |
| 11 | JGI25153J46596_10054376 | 3300003215 | Bacteria | 1127 |
| 12 | rootH1_10007098 | 3300003316 | Bacteria | 1112 |
| 13 | rootH1_10037411 | 3300003316 | Bacteria | 5055 |
| 14 | rootH1_10054269 | 3300003323 | Bacteria | 1325 |
| 15 | JGI25160J50197_1020461 | 3300003354 | Bacteria | 1995 |
| 16 | Ga0006562J51391_1026270 | 3300003578 | Bacteria | 873 |
| 17 | Ga0006562J51391_1041146 | 3300003578 | Bacteria | 1090 |
| 18 | Ga0055539_1000061 | 3300003752 | Bacteria | 144457 |
| 19 | Ga0055532_1000042 | 3300003758 | Bacteria | 195195 |
| 20 | Ga0055525_1000480 | 3300003759 | Bacteria | 21423 |
| 21 | Ga0055525_1000616 | 3300003759 | Bacteria | 14804 |
| 22 | Ga0055527_1000169 | 3300003760 | Bacteria | 45013 |
| 23 | Ga0055535_1000031 | 3300003761 | Bacteria | 195195 |
| 24 | Ga0055542_1001292 | 3300003762 | Bacteria | 13371 |
| 25 | Ga0055529_1000075 | 3300003763 | Bacteria | 156291 |
| 26 | Ga0055526_1026693 | 3300003771 | Bacteria | 1811 |
| 27 | Ga0055524_1002307 | 3300003775 | Bacteria | 9936 |
| 28 | Ga0055524_1008846 | 3300003775 | Bacteria | 4147 |
| 29 | Ga0055536_1000108 | 3300003781 | Bacteria | 73142 |
| 30 | Ga0055534_1010636 | 3300003784 | Bacteria | 1913 |
| 31 | Ga0055531_10000011 | 3300003794 | Bacteria | 195010 |
| 32 | Ga0055541_1002919 | 3300003841 | Bacteria | 3299 |
| 33 | Ga0055541_1015165 | 3300003841 | Bacteria | 1033 |
| 34 | Ga0058692_1000025 | 3300003856 | Bacteria | 217356 |
| 35 | Ga0058692_1001325 | 3300003856 | Bacteria | 9285 |
| 36 | Ga0070683_100003993 | 3300005329 | Bacteria | 12083 |
| 37 | Ga0070680_100082043 | 3300005336 | Bacteria | 2661 |
| 38 | Ga0070682_100213578 | 3300005337 | Bacteria | 1369 |
| 39 | Ga0070661_100002111 | 3300005344 | Bacteria | 13690 |
| 40 | Ga0070661_100407762 | 3300005344 | Bacteria | 1076 |
| 41 | Ga0070659_100028665 | 3300005366 | Bacteria | 4302 |
| 42 | Ga0070709_10025818 | 3300005434 | Bacteria | 3473 |
| 43 | Ga0070663_100000086 | 3300005455 | Bacteria | 41783 |
| 44 | Ga0070684_100004378 | 3300005535 | Bacteria | 10735 |
| 45 | Ga0070684_100256708 | 3300005535 | Bacteria | 1598 |
| 46 | Ga0070664_100000210 | 3300005564 | Bacteria | 41664 |
| 47 | Ga0068857_100323692 | 3300005577 | Bacteria | 1424 |
| 48 | Ga0068854_100000176 | 3300005578 | Bacteria | 43579 |
| 49 | Ga0068856_100000539 | 3300005614 | Bacteria | 41776 |
| 50 | Ga0068856_100813534 | 3300005614 | Bacteria | 954 |
| 51 | Ga0068852_100293395 | 3300005616 | Bacteria | 1572 |
| 52 | Ga0081539_10000709 | 3300005985 | Bacteria | 66741 |
| 53 | Ga0075363_100152709 | 3300006048 | Bacteria | 1304 |
| 54 | Ga0075364_10043348 | 3300006051 | Bacteria | 2925 |
| 55 | Ga0075367_10390260 | 3300006178 | Bacteria | 880 |
| 56 | Ga0075366_10002780 | 3300006195 | Bacteria | 9062 |
| 57 | Ga0075366_10060088 | 3300006195 | Bacteria | 2258 |
| 58 | Ga0075370_10077364 | 3300006353 | Bacteria | 1909 |
| 59 | Ga0075370_10344754 | 3300006353 | Bacteria | 889 |
| 60 | Ga0075430_100136085 | 3300006846 | Bacteria | 2047 |
| 61 | Ga0075431_100077526 | 3300006847 | Bacteria | 3430 |
| 62 | Ga0099826_10000029 | 3300006948 | Bacteria | 128855 |
| 63 | Ga0105251_10018652 | 3300009011 | Bacteria | 3683 |
| 64 | Ga0105251_10035794 | 3300009011 | Bacteria | 2447 |
| 65 | Ga0105251_10145367 | 3300009011 | Bacteria | 1072 |
| 66 | Ga0105244_10000076 | 3300009036 | Bacteria | 110824 |
| 67 | Ga0105240_10454623 | 3300009093 | Bacteria | 1432 |
| 68 | Ga0111539_11030966 | 3300009094 | Bacteria | 956 |
| 69 | Ga0105245_10100173 | 3300009098 | Bacteria | 2680 |
| 70 | Ga0114129_10377697 | 3300009147 | Bacteria | 1872 |
| 71 | Ga0105243_10288804 | 3300009148 | Bacteria | 1481 |
| 72 | Ga0105243_11016140 | 3300009148 | Bacteria | 833 |
| 73 | Ga0105249_10004632 | 3300009553 | Bacteria | 11881 |
| 74 | Ga0105239_10195606 | 3300010375 | Bacteria | 2264 |
| 75 | Ga0105246_10245508 | 3300011119 | Bacteria | 1418 |
| 76 | Ga0157373_10129255 | 3300013100 | Bacteria | 1776 |
| 77 | Ga0157371_10006566 | 3300013102 | Bacteria | 9565 |
| 78 | Ga0157369_10007469 | 3300013105 | Bacteria | 12585 |
| 79 | Ga0157369_10596192 | 3300013105 | Bacteria | 1141 |
| 80 | Ga0157372_10006060 | 3300013307 | Bacteria | 12846 |
| 81 | Ga0157372_10017379 | 3300013307 | Bacteria | 7720 |
| 82 | Ga0157372_10034019 | 3300013307 | Bacteria | 5599 |
| 83 | Ga0157372_11297528 | 3300013307 | Bacteria | 840 |
| 84 | Ga0182008_10000119 | 3300014497 | Bacteria | 59427 |
| 85 | Ga0182006_1000067 | 3300015261 | Bacteria | 147932 |
| 86 | Ga0182007_10000123 | 3300015262 | Bacteria | 53953 |
| 87 | Ga0182005_1000002 | 3300015265 | Bacteria | 908499 |
| 88 | Ga0163161_10020619 | 3300017792 | Bacteria | 4628 |
| 89 | Ga0163161_10550756 | 3300017792 | Bacteria | 945 |
| 90 | Ga0206352_10334922 | 3300020078 | Bacteria | 1820 |
| 91 | Ga0206353_10552251 | 3300020082 | Bacteria | 2105 |
| 92 | Ga0213872_10001107 | 3300021361 | Bacteria | 18438 |
| 93 | Ga0213872_10006231 | 3300021361 | Bacteria | 6024 |
| 94 | Ga0213872_10088999 | 3300021361 | Bacteria | 1383 |
| 95 | Ga0209784_100003 | 3300025224 | Bacteria | 1379451 |
| 96 | Ga0209784_100686 | 3300025224 | Bacteria | 9430 |
| 97 | Ga0209566_100002 | 3300025225 | Bacteria | 2614868 |
| 98 | Ga0209566_100330 | 3300025225 | Bacteria | 42404 |
| 99 | Ga0209566_102470 | 3300025225 | Bacteria | 3401 |
| 100 | Ga0209674_100094 | 3300025226 | Bacteria | 169506 |
| 101 | Ga0209674_104116 | 3300025226 | Bacteria | 2451 |
| 102 | Ga0209672_100096 | 3300025228 | Bacteria | 112947 |
| 103 | Ga0209147_100002 | 3300025229 | Bacteria | 2158988 |
| 104 | Ga0209563_100004 | 3300025230 | Bacteria | 1814108 |
| 105 | Ga0209258_100002 | 3300025242 | Bacteria | 2158988 |
| 106 | Ga0209646_1000019 | 3300025246 | Bacteria | 475248 |
| 107 | Ga0209026_1011832 | 3300025250 | Bacteria | 1547 |
| 108 | Ga0209677_100071 | 3300025253 | Bacteria | 139425 |
| 109 | Ga0209148_1000118 | 3300025254 | Bacteria | 188330 |
| 110 | Ga0209759_1004997 | 3300025256 | Bacteria | 4776 |
| 111 | Ga0209759_1012625 | 3300025256 | Bacteria | 2328 |
| 112 | Ga0209565_1000084 | 3300025263 | Bacteria | 153894 |
| 113 | Ga0209565_1010070 | 3300025263 | Bacteria | 2360 |
| 114 | Ga0209455_1000009 | 3300025272 | Bacteria | 1042273 |
| 115 | Ga0209673_1034247 | 3300025273 | Bacteria | 1537 |
| 116 | Ga0209130_1006165 | 3300025284 | Bacteria | 3954 |
| 117 | Ga0209675_1000464 | 3300025291 | Bacteria | 31142 |
| 118 | Ga0209676_1000012 | 3300025292 | Bacteria | 841431 |
| 119 | Ga0209025_1000214 | 3300025294 | Bacteria | 138780 |
| 120 | Ga0209025_1001025 | 3300025294 | Bacteria | 41120 |
| 121 | Ga0209025_1007952 | 3300025294 | Bacteria | 7760 |
| 122 | Ga0209025_1032342 | 3300025294 | Bacteria | 2448 |
| 123 | Ga0209564_1022535 | 3300025295 | Bacteria | 2222 |
| 124 | Ga0209564_1025321 | 3300025295 | Bacteria | 2000 |
| 125 | Ga0209564_1026027 | 3300025295 | Bacteria | 1947 |
| 126 | Ga0209758_1006507 | 3300025297 | Bacteria | 8345 |
| 127 | Ga0209758_1023388 | 3300025297 | Bacteria | 2796 |
| 128 | Ga0209050_1009066 | 3300025298 | Bacteria | 5170 |
| 129 | Ga0209256_1000468 | 3300025299 | Bacteria | 60770 |
| 130 | Ga0209256_1001006 | 3300025299 | Bacteria | 33408 |
| 131 | Ga0207426_1004524 | 3300025302 | Bacteria | 6728 |
| 132 | Ga0207426_1008470 | 3300025302 | Bacteria | 4148 |
| 133 | Ga0207426_1016632 | 3300025302 | Bacteria | 2634 |
| 134 | Ga0209051_1002325 | 3300025303 | Bacteria | 13807 |
| 135 | Ga0209051_1012366 | 3300025303 | Bacteria | 4135 |
| 136 | Ga0209257_1000017 | 3300025304 | Bacteria | 866287 |
| 137 | Ga0207655_1000030 | 3300025728 | Bacteria | 413221 |
| 138 | Ga0207655_1001093 | 3300025728 | Bacteria | 26680 |
| 139 | Ga0207655_1001907 | 3300025728 | Bacteria | 17900 |
| 140 | Ga0207713_1032021 | 3300025735 | Bacteria | 2315 |
| 141 | Ga0207699_10021514 | 3300025906 | Bacteria | 3478 |
| 142 | Ga0207695_10003065 | 3300025913 | Bacteria | 23956 |
| 143 | Ga0207695_10483383 | 3300025913 | Bacteria | 1120 |
| 144 | Ga0207660_10402059 | 3300025917 | Bacteria | 1103 |
| 145 | Ga0207690_10001107 | 3300025932 | Bacteria | 17169 |
| 146 | Ga0207709_10744361 | 3300025935 | Bacteria | 787 |
| 147 | Ga0207704_10345353 | 3300025938 | Bacteria | 1157 |
| 148 | Ga0207661_10000747 | 3300025944 | Bacteria | 21096 |
| 149 | Ga0207679_10000240 | 3300025945 | Bacteria | 41798 |
| 150 | Ga0207679_10014167 | 3300025945 | Bacteria | 5236 |
| 151 | Ga0207712_10004502 | 3300025961 | Bacteria | 8805 |
| 152 | Ga0207640_10000049 | 3300025981 | Bacteria | 97025 |
| 153 | Ga0207678_10000353 | 3300026067 | Bacteria | 41741 |
| 154 | Ga0207702_10000550 | 3300026078 | Bacteria | 41779 |
| 155 | Ga0207702_10715809 | 3300026078 | Bacteria | 987 |
| 156 | Ga0207641_10098511 | 3300026088 | Bacteria | 2571 |
| 157 | Ga0207674_10283821 | 3300026116 | Bacteria | 1604 |
| 158 | Ga0209371_1000036 | 3300027312 | Bacteria | 367250 |
| 159 | Ga0209371_1002657 | 3300027312 | Bacteria | 9739 |
| 160 | Ga0209371_1011550 | 3300027312 | Bacteria | 2616 |
| 161 | Ga0209282_1001593 | 3300027666 | Bacteria | 12556 |
| 162 | Ga0268266_11082022 | 3300028379 | Bacteria | 776 |
| 163 | Ga0307517_10002842 | 3300028786 | Bacteria | 27511 |
| 164 | Ga0307515_10000497 | 3300028794 | Bacteria | 94190 |
| 165 | Ga0307515_10054430 | 3300028794 | Bacteria | 5875 |
| 166 | Ga0307515_10088171 | 3300028794 | Bacteria | 3926 |
| 167 | Ga0307515_10234736 | 3300028794 | Bacteria | 1618 |
| 168 | Ga0265338_10285782 | 3300028800 | Bacteria | 1204 |
| 169 | Ga0268256_1000040 | 3300030500 | Bacteria | 348002 |
| 170 | Ga0268256_1002353 | 3300030500 | Bacteria | 9739 |
| 171 | Ga0307511_10000238 | 3300030521 | Bacteria | 56455 |
| 172 | Ga0307512_10015539 | 3300030522 | Bacteria | 7051 |
| 173 | Ga0265332_10000013 | 3300031238 | Bacteria | 250095 |
| 174 | Ga0265325_10057382 | 3300031241 | Bacteria | 1985 |
| 175 | Ga0265327_10122603 | 3300031251 | Unclassified | 1230 |
| 176 | Ga0265316_10290426 | 3300031344 | Bacteria | 1193 |
| 177 | Ga0307513_10069290 | 3300031456 | Bacteria | 3691 |
| 178 | Ga0307509_10013379 | 3300031507 | Bacteria | 9719 |
| 179 | Ga0307509_10020287 | 3300031507 | Bacteria | 7544 |
| 180 | Ga0307509_10033994 | 3300031507 | Bacteria | 5605 |
| 181 | Ga0307408_100000114 | 3300031548 | Bacteria | 89451 |
| 182 | Ga0307508_10016710 | 3300031616 | Bacteria | 6676 |
| 183 | Ga0307514_10006271 | 3300031649 | Bacteria | 10408 |
| 184 | Ga0307514_10079711 | 3300031649 | Bacteria | 2426 |
| 185 | Ga0307514_10114363 | 3300031649 | Bacteria | 1902 |
| 186 | Ga0307514_10154087 | 3300031649 | Bacteria | 1536 |
| 187 | Ga0307516_10003058 | 3300031730 | Bacteria | 21831 |
| 188 | Ga0307516_10018858 | 3300031730 | Bacteria | 7161 |
| 189 | Ga0307518_10114000 | 3300031838 | Bacteria | 1922 |
| 190 | Ga0307410_10322209 | 3300031852 | Bacteria | 1227 |
| 191 | Ga0307410_10364955 | 3300031852 | Bacteria | 1158 |
| 192 | Ga0307406_10173533 | 3300031901 | Bacteria | 1563 |
| 193 | Ga0307414_10004465 | 3300032004 | Bacteria | 7598 |
| 194 | Ga0307414_10209347 | 3300032004 | Bacteria | 1592 |
| 195 | Ga0307411_10000823 | 3300032005 | Bacteria | 11600 |
| 196 | Ga0307507_10117085 | 3300033179 | Bacteria | 2149 |
| 197 | Ga0307510_10004320 | 3300033180 | Bacteria | 16724 |
| 198 | Ga0307510_10007211 | 3300033180 | Bacteria | 13244 |
| 199 | Ga0307510_10015697 | 3300033180 | Bacteria | 8958 |
| 200 | Ga0373948_0010565 | 3300034817 | Bacteria | 1615 |
| 201 | Ga0373940_0008308 | 3300035088 | Bacteria | 2376 |
| 202 | Ga0373939_0000029 | 3300035114 | Bacteria | 52306 |
| 203 | Ga0373960_0002621 | 3300035121 | Bacteria | 4068 |
| 204 | Ga0373931_0008333 | 3300035691 | Bacteria | 4910 |
| 205 | Ga0395900_0066377 | 3300037418 | Bacteria | 3707 |
| 206 | Ga0395900_0079576 | 3300037418 | Bacteria | 3368 |
| 207 | Ga0395900_0097583 | 3300037418 | Bacteria | 3019 |
| 208 | Ga0395900_0388450 | 3300037418 | Bacteria | 1362 |
| 209 | Ga0395898_0028535 | 3300037466 | Bacteria | 5591 |
| 210 | Ga0395905_0001795 | 3300037471 | Bacteria | 24890 |
| 211 | Ga0395905_0087003 | 3300037471 | Bacteria | 2930 |
| 212 | Ga0395901_0225283 | 3300038443 | Bacteria | 1959 |
| 213 | Ga0395901_0305528 | 3300038443 | Bacteria | 1649 |
| 214 | Ga0436361_0007228 | 3300039447 | Bacteria | 1845 |
| 215 | Ga0436361_0028828 | 3300039447 | Bacteria | 968 |
| 216 | Ga0436361_0505573 | 3300039447 | Bacteria | 1738 |
| 217 | Ga0436361_0662050 | 3300039447 | Unclassified | 3482 |
| 218 | Ga0436361_0802016 | 3300039447 | Bacteria | 24229 |
| 219 | Ga0436361_0921973 | 3300039447 | Bacteria | 1083 |
| 220 | Ga0436361_0922237 | 3300039447 | Bacteria | 22454 |
| 221 | Ga0439436_0003137 | 3300041404 | Bacteria | 5010 |
| 222 | Ga0439439_0001872 | 3300041406 | Bacteria | 4342 |
| 223 | Ga0439439_0004865 | 3300041406 | Bacteria | 3044 |
| 224 | Ga0451837_1229693 | 3300041494 | Bacteria | 1228 |
| 225 | Ga0451843_1180629 | 3300041509 | Bacteria | 910 |
| 226 | Ga0451853_0516285 | 3300041512 | Bacteria | 1075 |
| 227 | Ga0451853_0887708 | 3300041512 | Bacteria | 1145 |
| 228 | Ga0439433_0001405 | 3300041999 | Bacteria | 4954 |
| 229 | Ga0439449_0014625 | 3300042007 | Bacteria | 2949 |
| 230 | Ga0439449_0037525 | 3300042007 | Bacteria | 1802 |
| 231 | Ga0439455_0000348 | 3300042012 | Bacteria | 5982 |
| 232 | Ga0439457_001796 | 3300042014 | Bacteria | 6338 |
| 233 | Ga0439457_018010 | 3300042014 | Bacteria | 1567 |
| 234 | Ga0450917_000376 | 3300042120 | Bacteria | 3350 |
| 235 | Ga0450888_000028 | 3300042126 | Bacteria | 10038 |
| 236 | Ga0450890_003595 | 3300042127 | Bacteria | 2056 |
| 237 | Ga0450891_000149 | 3300042129 | Bacteria | 6505 |
| 238 | Ga0450892_000225 | 3300042130 | Bacteria | 6792 |
| 239 | Ga0450894_000045 | 3300042131 | Bacteria | 18255 |
| 240 | Ga0450896_009320 | 3300042133 | Bacteria | 1366 |
| 241 | Ga0450899_000042 | 3300042135 | Bacteria | 9738 |
| 242 | Ga0450900_012816 | 3300042136 | Bacteria | 1103 |
| 243 | Ga0450903_000542 | 3300042138 | Bacteria | 7873 |
| 244 | Ga0450903_010568 | 3300042138 | Bacteria | 1492 |
| 245 | Ga0450906_003844 | 3300042145 | Bacteria | 3194 |
| 246 | Ga0439458_0001470 | 3300042157 | Bacteria | 5937 |
| 247 | Ga0439459_0054317 | 3300042438 | Bacteria | 889 |
| 248 | Ga0450893_0001575 | 3300042532 | Bacteria | 3500 |
| 249 | Ga0451577_0149432 | 3300042876 | Bacteria | 2101 |
| 250 | Ga0451577_0288609 | 3300042876 | Bacteria | 1487 |
| 251 | Ga0451577_0679423 | 3300042876 | Bacteria | 933 |
| 252 | Ga0466969_0026071 | 3300044656 | Bacteria | 3000 |
| 253 | Ga0466969_0074981 | 3300044656 | Bacteria | 1622 |
| 254 | Ga0466972_0080702 | 3300044658 | Bacteria | 1549 |
| 255 | Ga0466977_0008418 | 3300044666 | Bacteria | 5721 |
| 256 | Ga0453683_0064929 | 3300044673 | Bacteria | 2282 |
| 257 | Ga0466965_0137220 | 3300044683 | Bacteria | 1271 |
| 258 | Ga0466966_0039685 | 3300044684 | Bacteria | 3032 |
| 259 | Ga0466966_0173147 | 3300044684 | Bacteria | 1311 |
| 260 | Ga0466961_0000765 | 3300044693 | Bacteria | 20117 |
| 261 | Ga0466961_0014177 | 3300044693 | Bacteria | 5115 |
| 262 | Ga0466961_0145682 | 3300044693 | Bacteria | 1481 |
| 263 | Ga0466961_0206610 | 3300044693 | Bacteria | 1213 |
| 264 | Ga0466961_0320073 | 3300044693 | Bacteria | 946 |
| 265 | Ga0466963_0068156 | 3300044694 | Bacteria | 2389 |
| 266 | Ga0466963_0363597 | 3300044694 | Bacteria | 1019 |
| 267 | Ga0466964_0100956 | 3300044706 | Bacteria | 1272 |
| 268 | Ga0453684_0000657 | 3300044712 | Bacteria | 124222 |
| 269 | Ga0453684_0000826 | 3300044712 | Bacteria | 104663 |
| 270 | Ga0453684_0027032 | 3300044712 | Bacteria | 8252 |
| 271 | Ga0453684_0916520 | 3300044712 | Bacteria | 937 |
| 272 | Ga0466971_0019939 | 3300044719 | Bacteria | 2980 |
| 273 | Ga0466971_0226851 | 3300044719 | Bacteria | 886 |
| 274 | Ga0466970_0006415 | 3300044765 | Bacteria | 5883 |
| 275 | Ga0466970_0008543 | 3300044765 | Bacteria | 5157 |
| 276 | Ga0466970_0034858 | 3300044765 | Bacteria | 2665 |
| 277 | Ga0466970_0165540 | 3300044765 | Bacteria | 1224 |
| 278 | Ga0466957_0382457 | 3300044842 | Bacteria | 960 |
| 279 | Ga0466959_0004532 | 3300045049 | Bacteria | 9319 |
| 280 | Ga0466959_0122595 | 3300045049 | Bacteria | 1846 |
| 281 | Ga0451576_0003274 | 3300045051 | Bacteria | 22482 |
| 282 | Ga0451576_0015862 | 3300045051 | Bacteria | 8334 |
| 283 | Ga0451576_0280189 | 3300045051 | Bacteria | 1743 |
| 284 | Ga0451576_0560495 | 3300045051 | Bacteria | 1200 |
| 285 | Ga0466958_0067631 | 3300045836 | Bacteria | 2183 |
| 286 | Ga0466958_0491299 | 3300045836 | Bacteria | 796 |
| 287 | Ga0466967_0016519 | 3300045976 | Bacteria | 5825 |
| 288 | Ga0466967_0057144 | 3300045976 | Bacteria | 3443 |
| 289 | Ga0466967_0903863 | 3300045976 | Bacteria | 878 |
| 290 | Ga0495592_0037407 | 3300046454 | Bacteria | 3654 |
| 291 | Ga0495592_0185898 | 3300046454 | Bacteria | 1411 |
| 292 | Ga0495603_0007330 | 3300046455 | Bacteria | 6632 |
| 293 | Ga0495603_0007840 | 3300046455 | Bacteria | 6438 |
| 294 | Ga0495603_0033176 | 3300046455 | Bacteria | 3106 |
| 295 | Ga0495603_0069558 | 3300046455 | Bacteria | 2070 |
| 296 | Ga0495590_0123847 | 3300046457 | Bacteria | 927 |
| 297 | Ga0495629_0007540 | 3300046459 | Bacteria | 8020 |
| 298 | Ga0495629_0008794 | 3300046459 | Bacteria | 7425 |
| 299 | Ga0495629_0030418 | 3300046459 | Bacteria | 3827 |
| 300 | Ga0495629_0134359 | 3300046459 | Bacteria | 1722 |
| 301 | Ga0495629_0270034 | 3300046459 | Bacteria | 1168 |
| 302 | Ga0495638_0051398 | 3300046460 | Bacteria | 2570 |
| 303 | Ga0495651_0033152 | 3300046462 | Bacteria | 4028 |
| 304 | Ga0495651_0177013 | 3300046462 | Bacteria | 1513 |
| 305 | Ga0495653_0070603 | 3300046463 | Bacteria | 2613 |
| 306 | Ga0495650_0000056 | 3300046471 | Bacteria | 307565 |
| 307 | Ga0495650_0002634 | 3300046471 | Bacteria | 14043 |
| 308 | Ga0495580_0055666 | 3300046472 | Bacteria | 2786 |
| 309 | Ga0495605_0033687 | 3300046474 | Bacteria | 2598 |
| 310 | Ga0495605_0095038 | 3300046474 | Bacteria | 1376 |
| 311 | Ga0495662_0001795 | 3300046476 | Bacteria | 10744 |
| 312 | Ga0495662_0004825 | 3300046476 | Bacteria | 6758 |
| 313 | Ga0495662_0009839 | 3300046476 | Bacteria | 4697 |
| 314 | Ga0495662_0010977 | 3300046476 | Bacteria | 4430 |
| 315 | Ga0495662_0028001 | 3300046476 | Bacteria | 2721 |
| 316 | Ga0495584_0122503 | 3300046491 | Bacteria | 1317 |
| 317 | Ga0495585_0164829 | 3300046492 | Bacteria | 1148 |
| 318 | Ga0495594_0009975 | 3300046499 | Bacteria | 4918 |
| 319 | Ga0495594_0011844 | 3300046499 | Bacteria | 4537 |
| 320 | Ga0495594_0030329 | 3300046499 | Bacteria | 2925 |
| 321 | Ga0495596_0023925 | 3300046500 | Bacteria | 2476 |
| 322 | Ga0495607_0089016 | 3300046501 | Bacteria | 1676 |
| 323 | Ga0495606_0001978 | 3300046507 | Bacteria | 25275 |
| 324 | Ga0495608_0075832 | 3300046511 | Bacteria | 2191 |
| 325 | Ga0495610_0039594 | 3300046512 | Bacteria | 2382 |
| 326 | Ga0495616_0042417 | 3300046513 | Bacteria | 2316 |
| 327 | Ga0495618_0212259 | 3300046514 | Bacteria | 1223 |
| 328 | Ga0495628_0065534 | 3300046516 | Bacteria | 2840 |
| 329 | Ga0495630_0118545 | 3300046517 | Bacteria | 2007 |
| 330 | Ga0495630_0240170 | 3300046517 | Bacteria | 1384 |
| 331 | Ga0495643_0078160 | 3300046522 | Bacteria | 1728 |
| 332 | Ga0495648_0231871 | 3300046524 | Bacteria | 903 |
| 333 | Ga0495666_0001499 | 3300046526 | Bacteria | 11413 |
| 334 | Ga0495652_0058218 | 3300046529 | Bacteria | 3273 |
| 335 | Ga0495665_0012858 | 3300046531 | Bacteria | 4530 |
| 336 | Ga0495586_0217432 | 3300046535 | Bacteria | 1085 |
| 337 | Ga0495587_0001425 | 3300046536 | Bacteria | 15904 |
| 338 | Ga0495609_0038915 | 3300046538 | Bacteria | 2142 |
| 339 | Ga0495645_0009259 | 3300046543 | Bacteria | 6886 |
| 340 | Ga0495645_0044479 | 3300046543 | Bacteria | 3238 |
| 341 | Ga0495645_0147370 | 3300046543 | Bacteria | 1638 |
| 342 | Ga0495633_0001151 | 3300046558 | Bacteria | 21225 |
| 343 | Ga0495667_0023067 | 3300046559 | Bacteria | 4192 |
| 344 | Ga0495656_0142997 | 3300046615 | Bacteria | 1149 |
| 345 | Ga0495668_0000103 | 3300046616 | Bacteria | 135853 |
| 346 | Ga0495634_0002605 | 3300046642 | Bacteria | 14837 |
| 347 | Ga0495634_0137943 | 3300046642 | Bacteria | 1550 |
| 348 | Ga0495625_0000643 | 3300046660 | Bacteria | 50299 |
| 349 | Ga0495625_0013459 | 3300046660 | Bacteria | 6574 |
| 350 | Ga0495625_0383906 | 3300046660 | Bacteria | 881 |
| 351 | Ga0495635_0005300 | 3300046663 | Bacteria | 8973 |
| 352 | Ga0495661_0051196 | 3300046665 | Bacteria | 2495 |
| 353 | Ga0495661_0094528 | 3300046665 | Bacteria | 1694 |
| 354 | Ga0495588_0027301 | 3300046674 | Bacteria | 2853 |
| 355 | Ga0495588_0030163 | 3300046674 | Bacteria | 2724 |
| 356 | Ga0495588_0205182 | 3300046674 | Bacteria | 1041 |
| 357 | Ga0495657_0004044 | 3300046675 | Bacteria | 11759 |
| 358 | Ga0495657_0061541 | 3300046675 | Bacteria | 2482 |
| 359 | Ga0495623_0099321 | 3300046679 | Bacteria | 1775 |
| 360 | Ga0495623_0195779 | 3300046679 | Bacteria | 1165 |
| 361 | Ga0495646_0011392 | 3300046680 | Bacteria | 5646 |
| 362 | Ga0495646_0014474 | 3300046680 | Bacteria | 5016 |
| 363 | Ga0495658_0020216 | 3300046683 | Bacteria | 3491 |
| 364 | Ga0495669_0265186 | 3300046684 | Bacteria | 825 |
| 365 | Ga0495613_0024695 | 3300046689 | Bacteria | 4477 |
| 366 | Ga0495613_0085682 | 3300046689 | Bacteria | 2285 |
| 367 | Ga0495670_0017680 | 3300046691 | Bacteria | 3511 |
| 368 | Ga0495671_0040339 | 3300046692 | Bacteria | 2354 |
| 369 | Ga0495671_0130589 | 3300046692 | Bacteria | 1225 |
| 370 | Ga0495671_0351320 | 3300046692 | Bacteria | 707 |
| 371 | Ga0495649_0079256 | 3300046694 | Bacteria | 1757 |
| 372 | Ga0495589_0011121 | 3300046794 | Bacteria | 4670 |
| 373 | Ga0495589_0120458 | 3300046794 | Bacteria | 1263 |
| 374 | Ga0495589_0168587 | 3300046794 | Bacteria | 1041 |
| 375 | Ga0495600_0021500 | 3300046809 | Bacteria | 4132 |
| 376 | Ga0495600_0307741 | 3300046809 | Bacteria | 998 |
| 377 | Ga0495581_0005898 | 3300047315 | Bacteria | 7105 |
| 378 | Ga0495581_0036491 | 3300047315 | Bacteria | 2844 |
| 379 | Ga0495604_0000264 | 3300047317 | Bacteria | 46714 |
| 380 | Ga0495604_0000590 | 3300047317 | Bacteria | 31463 |
| 381 | Ga0495604_0020111 | 3300047317 | Bacteria | 5335 |
| 382 | Ga0495636_0004733 | 3300047318 | Bacteria | 5340 |
| 383 | Ga0495636_0011296 | 3300047318 | Bacteria | 3533 |
| 384 | Ga0495636_0021870 | 3300047318 | Bacteria | 2583 |
| 385 | Ga0495674_0602085 | 3300047319 | Bacteria | 870 |
| 386 | Ga0495676_0013764 | 3300047321 | Bacteria | 7254 |
| 387 | Ga0495676_0036088 | 3300047321 | Bacteria | 4131 |
| 388 | Ga0495683_0034182 | 3300047323 | Bacteria | 2586 |
| 389 | Ga0495683_0101669 | 3300047323 | Bacteria | 1381 |
| 390 | Ga0495687_002653 | 3300047443 | Bacteria | 13957 |
| 391 | Ga0495687_036832 | 3300047443 | Bacteria | 2184 |
| 392 | Ga0495687_173310 | 3300047443 | Bacteria | 712 |
| 393 | Ga0495675_0009963 | 3300047444 | Bacteria | 5926 |
| 394 | Ga0495675_0278198 | 3300047444 | Bacteria | 998 |
| 395 | Ga0495685_002027 | 3300047447 | Bacteria | 6294 |
| 396 | Ga0495685_003406 | 3300047447 | Bacteria | 5076 |
| 397 | Ga0495685_005251 | 3300047447 | Bacteria | 4218 |
| 398 | Ga0495685_010802 | 3300047447 | Bacteria | 3068 |
| 399 | Ga0495685_101466 | 3300047447 | Bacteria | 950 |
| 400 | Ga0495681_0000442 | 3300047470 | Bacteria | 31718 |
| 401 | Ga0495681_0025275 | 3300047470 | Bacteria | 3109 |
| 402 | Ga0495684_0058636 | 3300047471 | Bacteria | 2932 |
| 403 | Ga0495684_0071566 | 3300047471 | Bacteria | 2634 |
| 404 | Ga0495686_0057500 | 3300047472 | Bacteria | 2427 |
| 405 | Ga0495686_0073026 | 3300047472 | Bacteria | 2108 |
| 406 | Ga0495593_0035696 | 3300047673 | Bacteria | 2697 |
| 407 | Ga0495602_0086611 | 3300048088 | Bacteria | 2614 |
| 408 | Ga0495602_0089577 | 3300048088 | Bacteria | 2558 |
| 409 | Ga0495614_0003037 | 3300048089 | Bacteria | 7478 |
| 410 | Ga0495614_0020431 | 3300048089 | Bacteria | 2863 |
| 411 | Ga0495614_0080362 | 3300048089 | Bacteria | 1412 |
| 412 | Ga0495626_0000197 | 3300048091 | Bacteria | 73484 |
| 413 | Ga0496102_0167677 | 3300048905 | Bacteria | 2067 |
| 414 | Ga0496104_0393896 | 3300048907 | Bacteria | 1297 |
| 415 | Ga0496104_0581793 | 3300048907 | Bacteria | 1030 |
| 416 | Ga0496109_0025467 | 3300048912 | Bacteria | 5273 |
| 417 | Ga0496111_0371751 | 3300048914 | Bacteria | 1058 |
| 418 | Ga0496116_0002105 | 3300048919 | Bacteria | 21249 |
| 419 | Ga0496116_0075488 | 3300048919 | Bacteria | 2115 |
| 420 | Ga0496116_0080291 | 3300048919 | Bacteria | 2026 |
| 421 | Ga0496117_0000001 | 3300048920 | Bacteria | 2526244 |
| 422 | Ga0496118_0000002 | 3300048921 | Bacteria | 1690764 |
| 423 | Ga0496119_0003104 | 3300048922 | Bacteria | 17531 |
| 424 | Ga0496120_0000028 | 3300048923 | Bacteria | 230249 |
| 425 | Ga0496121_0006753 | 3300048924 | Bacteria | 14081 |
| 426 | Ga0496121_0013269 | 3300048924 | Bacteria | 8872 |
| 427 | Ga0496121_0193629 | 3300048924 | Bacteria | 1455 |
| 428 | Ga0496122_0001676 | 3300048925 | Bacteria | 34352 |
| 429 | Ga0496122_0085638 | 3300048925 | Bacteria | 2173 |
| 430 | Ga0496123_0002807 | 3300048926 | Bacteria | 20674 |
| 431 | Ga0496123_0067793 | 3300048926 | Bacteria | 2251 |
| 432 | Ga0496124_0001246 | 3300048927 | Bacteria | 39090 |
| 433 | Ga0496124_0058684 | 3300048927 | Bacteria | 3235 |
| 434 | Ga0496125_0214382 | 3300048928 | Bacteria | 1247 |
| 435 | Ga0496125_0305834 | 3300048928 | Bacteria | 971 |
| 436 | Ga0496126_0045207 | 3300048929 | Bacteria | 4049 |
| 437 | Ga0501309_007469 | 3300049129 | Bacteria | 1356 |
| 438 | Ga0501310_003134 | 3300049130 | Bacteria | 1607 |
| 439 | Ga0495678_005338 | 3300049459 | Bacteria | 7126 |
| 440 | Ga0495678_018990 | 3300049459 | Bacteria | 3077 |
| 441 | Ga0495682_0003131 | 3300049460 | Bacteria | 7477 |
| 442 | Ga0501294_002385 | 3300049517 | Bacteria | 1788 |
| 443 | Ga0501300_003939 | 3300049523 | Bacteria | 2209 |
| 444 | Ga0501031_0007119 | 3300049568 | Bacteria | 7300 |
| 445 | Ga0501032_0012805 | 3300049569 | Bacteria | 5981 |
| 446 | Ga0501032_0208143 | 3300049569 | Bacteria | 1276 |
| 447 | Ga0501033_0002135 | 3300049570 | Bacteria | 17104 |
| 448 | Ga0501033_0141413 | 3300049570 | Bacteria | 1739 |
| 449 | Ga0501033_0208126 | 3300049570 | Bacteria | 1395 |
| 450 | Ga0501033_0403142 | 3300049570 | Bacteria | 954 |
| 451 | Ga0501034_0001049 | 3300049571 | Bacteria | 39330 |
| 452 | Ga0501034_0147089 | 3300049571 | Bacteria | 2333 |
| 453 | Ga0501034_0147508 | 3300049571 | Bacteria | 2329 |
| 454 | Ga0501034_0983704 | 3300049571 | Bacteria | 728 |
| 455 | Ga0501036_0000576 | 3300049572 | Bacteria | 26456 |
| 456 | Ga0501036_0021103 | 3300049572 | Bacteria | 5471 |
| 457 | Ga0501036_0393124 | 3300049572 | Bacteria | 1157 |
| 458 | Ga0501037_0009522 | 3300049573 | Bacteria | 7129 |
| 459 | Ga0501037_0139961 | 3300049573 | Bacteria | 1732 |
| 460 | Ga0501037_0268865 | 3300049573 | Bacteria | 1190 |
| 461 | Ga0501038_0006067 | 3300049574 | Bacteria | 11179 |
| 462 | Ga0501038_0195117 | 3300049574 | Bacteria | 1628 |
| 463 | Ga0501039_0093817 | 3300049575 | Bacteria | 2339 |
| 464 | Ga0501040_0829734 | 3300049576 | Bacteria | 669 |
| 465 | Ga0501043_0003457 | 3300049579 | Bacteria | 12972 |
| 466 | Ga0501043_0570764 | 3300049579 | Bacteria | 838 |
| 467 | Ga0501046_0015957 | 3300049580 | Bacteria | 6300 |
| 468 | Ga0501047_0011643 | 3300049581 | Bacteria | 8318 |
| 469 | Ga0501071_0236477 | 3300049587 | Bacteria | 1377 |
| 470 | Ga0501075_0633400 | 3300049591 | Bacteria | 815 |
| 471 | Ga0501202_051415 | 3300049652 | Bacteria | 914 |
| 472 | Ga0501217_083728 | 3300049661 | Bacteria | 886 |
| 473 | Ga0501235_009196 | 3300049669 | Bacteria | 2159 |
| 474 | Ga0501258_011087 | 3300049687 | Bacteria | 962 |
| 475 | Ga0501221_000105 | 3300049704 | Bacteria | 10203 |
| 476 | Ga0501262_007915 | 3300049759 | Bacteria | 1294 |
| 477 | Ga0501265_040925 | 3300049762 | Bacteria | 700 |
| 478 | Ga0501267_003397 | 3300049764 | Bacteria | 1449 |
| 479 | Ga0501272_000243 | 3300049769 | Bacteria | 4546 |
| 480 | Ga0501283_026424 | 3300049779 | Bacteria | 955 |
| 481 | Ga0501035_0007650 | 3300049822 | Bacteria | 10093 |
| 482 | Ga0501035_0050113 | 3300049822 | Bacteria | 3743 |
| 483 | Ga0501035_0415271 | 3300049822 | Bacteria | 1118 |
| 484 | Ga0501044_0002016 | 3300049823 | Bacteria | 23415 |
| 485 | Ga0501044_0008136 | 3300049823 | Bacteria | 11508 |
| 486 | Ga0501045_0097017 | 3300049824 | Bacteria | 2181 |
| 487 | nmdc:mga00v17_294249_c1 | 3300050491 | Bacteria | 1054 |
| 488 | nmdc:mga0k408_1230_c1 | 3300050493 | Bacteria | 14028 |
| 489 | nmdc:mga0k408_4433_c1 | 3300050493 | Bacteria | 7449 |
| 490 | nmdc:mga07m45_82083_c1 | 3300050496 | Bacteria | 1841 |
| 491 | nmdc:mga0qj67_126676_c1 | 3300050509 | Bacteria | 2066 |
| 492 | nmdc:mga06r32_131566_c1 | 3300050510 | Bacteria | 2474 |
| 493 | Ga0495619_0098691 | 3300053085 | Bacteria | 1986 |
| 494 | Ga0500640_061984 | 3300053095 | Bacteria | 1619 |
| 495 | Ga0500560_059194 | 3300053107 | Bacteria | 1245 |
| 496 | Ga0500614_010439 | 3300053123 | Bacteria | 1995 |
| 497 | Ga0500559_0190818 | 3300053136 | Bacteria | 966 |
| 498 | Ga0500573_0146753 | 3300053140 | Bacteria | 1295 |
| 499 | Ga0500586_119098 | 3300053145 | Bacteria | 920 |
| 500 | Ga0500600_0086445 | 3300053149 | Bacteria | 1683 |
| 501 | Ga0501082_0428053 | 3300060353 | Bacteria | 1156 |
| 502 | Ga0466962_0025883 | 3300061719 | Bacteria | 2816 |
| 503 | 2513956419 | 2513237150 | Bacteria | 6553639 |
| 504 | 2514041519 | 2513237165 | Bacteria | 6771773 |
| 505 | 2547374326 | 2547132103 | Bacteria | 5115736 |
| 506 | 2548849143 | 2547132512 | Bacteria | 3416496 |
| 507 | 2585296090 | 2582581312 | Bacteria | 7308206 |
| 508 | 2585306160 | 2582581313 | Bacteria | 10042643 |
| 509 | 2585316078 | 2582581314 | Bacteria | 11452267 |
| 510 | 2597031968 | 2596583598 | Bacteria | 5251611 |
| 511 | 2599444087 | 2599185178 | Bacteria | 5365746 |
| 512 | 2601668145 | 2600255292 | Bacteria | 6300551 |
| 513 | 2616903068 | 2616644941 | Bacteria | 8510691 |
| 514 | 2643745898 | 2643221544 | Bacteria | 5886209 |
| 515 | 2643935239 | 2643221585 | Bacteria | 5812563 |
| 516 | 2643941826 | 2643221587 | Bacteria | 7586415 |
| 517 | 2644014864 | 2643221601 | Bacteria | 7493239 |
| 518 | 2644035148 | 2643221604 | Bacteria | 5014917 |
| 519 | 2644101297 | 2643221617 | Bacteria | 5139111 |
| 520 | 2644119297 | 2643221620 | Bacteria | 5134593 |
| 521 | 2644176299 | 2643221631 | Bacteria | 8168043 |
| 522 | 2644221903 | 2643221639 | Bacteria | 6649903 |
| 523 | 2644231776 | 2643221641 | Bacteria | 4490190 |
| 524 | 2644257301 | 2643221646 | Bacteria | 6433402 |
| 525 | 2644314863 | 2643221656 | Bacteria | 5809961 |
| 526 | 2644361719 | 2643221665 | Bacteria | 4699229 |
| 527 | 2644428909 | 2643221677 | Bacteria | 7584031 |
| 528 | 2644438682 | 2643221678 | Bacteria | 9540101 |
| 529 | 2738868926 | 2738541305 | Bacteria | 4910150 |
| 530 | 2739055118 | 2738541337 | Bacteria | 6183410 |
| 531 | 2740165394 | 2739367898 | Bacteria | 4367674 |
| 532 | 2745160028 | 2744054655 | Bacteria | 3552603 |
| 533 | 2745161652 | 2744054655 | Bacteria | 3552603 |
| 534 | 2785341676 | 2784746763 | Bacteria | 9783172 |
| 535 | 2785370991 | 2784746768 | Bacteria | 10036182 |
| 536 | 2786672188 | 2786546132 | Bacteria | 10419719 |
| 537 | 2808848785 | 2808606359 | Bacteria | 9866990 |
| 538 | 2808913109 | 2808606375 | Bacteria | 9466072 |
| 539 | 2811844909 | 2808606982 | Bacteria | 7791042 |
| 540 | 2812330378 | 2811994874 | Bacteria | 5367947 |
| 541 | 2812356504 | 2811994879 | Bacteria | 9313447 |
| 542 | 2834645023 | 2834641062 | Bacteria | 5559922 |
| 543 | 2843694812 | 2843690924 | Bacteria | 5169057 |
| 544 | 2846033718 | 2846033681 | Bacteria | 4377894 |
| 545 | 2846040261 | 2846037992 | Bacteria | 4526407 |
| 546 | 2852640180 | 2852635781 | Bacteria | 8251373 |
| 547 | 2857550379 | 2857547612 | Bacteria | 6179999 |
| 548 | 2858695242 | 2858688981 | Bacteria | 8184122 |
| 549 | 2861521800 | 2861520306 | Bacteria | 8348283 |
| 550 | 2862287207 | 2862281513 | Bacteria | 9621493 |
| 551 | 2862293396 | 2862290372 | Bacteria | 7471434 |
| 552 | 2862384082 | 2862382967 | Bacteria | 10317375 |
| 553 | 2862512057 | 2862507626 | Bacteria | 9425308 |
| 554 | 2862577981 | 2862574272 | Bacteria | 10567477 |
| 555 | 2863411356 | 2863404153 | Bacteria | 9672205 |
| 556 | 2867435204 | 2867428634 | Bacteria | 9590268 |
| 557 | 2873154539 | 2873151551 | Bacteria | 8625867 |
| 558 | 2875396200 | 2875391855 | Bacteria | 7600475 |
| 559 | 2877679586 | 2877676314 | Bacteria | 9512378 |
| 560 | 2884695862 | 2884693830 | Bacteria | 11273186 |
| 561 | 2885081797 | 2885080285 | Bacteria | 6355622 |
| 562 | 2885269881 | 2885266251 | Bacteria | 4796748 |
| 563 | 2887481910 | 2887478801 | Bacteria | 8972725 |
| 564 | 2891400959 | 2891395885 | Bacteria | 9251614 |
| 565 | 2891558662 | 2891554331 | Bacteria | 8812224 |
| 566 | 2891634418 | 2891633521 | Bacteria | 4602265 |
| 567 | 2895438934 | 2895427314 | Bacteria | 13147766 |
| 568 | 2895445424 | 2895442618 | Bacteria | 11027144 |
| 569 | 2900579348 | 2900577576 | Bacteria | 5438534 |
| 570 | 2918505989 | 2918501144 | Bacteria | 8668083 |
| 571 | 2919469159 | 2919468124 | Bacteria | 9133025 |
| 572 | 2919692129 | 2919688452 | Bacteria | 4595932 |
| 573 | 2928062310 | 2928058823 | Bacteria | 5520022 |
| 574 | 2928517107 | 2928515477 | Bacteria | 4448421 |
| 575 | 2932411851 | 2932410948 | Bacteria | 6312192 |
| 576 | 2932418582 | 2932416698 | Bacteria | 6315112 |
| 577 | 2935391863 | 2935390628 | Bacteria | 7043367 |
| 578 | 2939605330 | 2939602548 | Bacteria | 4950493 |
| 579 | 2946069359 | 2946064051 | Bacteria | 8957905 |
| 580 | 2954384499 | 2954380949 | Bacteria | 10050426 |
| 581 | 2954678465 | 2954673503 | Bacteria | 9685905 |
| 582 | 2954685690 | 2954682443 | Bacteria | 9862841 |
| 583 | 2954695356 | 2954691527 | Bacteria | 10720516 |
| 584 | 2954710547 | 2954701450 | Bacteria | 10834262 |
| 585 | 2954714792 | 2954711539 | Bacteria | 10867210 |
| 586 | 2954724737 | 2954721474 | Bacteria | 10456478 |
| 587 | 2954743661 | 2954740390 | Bacteria | 10229294 |
| 588 | 2954762614 | 2954759201 | Bacteria | 9358192 |
| 589 | 2995471378 | 2995463766 | Bacteria | 8577691 |
| 590 | 2998345725 | 2998344455 | Bacteria | 4222996 |
| 591 | 3006399110 | 3006393351 | Bacteria | 6615579 |
| 592 | 644748299 | 644736347 | Bacteria | 6476522 |
| 593 | 8001781803 | 8001781756 | Bacteria | 9586736 |
| 594 | 8001788840 | 8001781756 | Bacteria | 9586736 |
| 595 | 8003401409 | 8003400568 | Bacteria | 5535898 |
| 596 | 8008566756 | 8008558824 | Bacteria | 10610750 |
| 597 | 8008577617 | 8008574985 | Bacteria | 7815457 |
| 598 | 8033234578 | 8033232454 | Bacteria | 3202805 |
| 599 | 8048412228 | 8048406513 | Bacteria | 8936924 |
| 600 | 8055173736 | 8055172936 | Bacteria | 9305943 |
| 601 | 8057572345 | 8057568493 | Bacteria | 7221719 |
| 602 | Ga0495683_0032650 | |||
| 603 | JGI24741J21665_1000679 | |||
| 604 | JGI24740J21852_10029859 | |||
| 605 | JGI24740J21852_10030041 | |||
| 606 | JGI25156J39149_1018101 | |||
| 607 | JGI25156J39149_1024588 | |||
| 608 | JGI25154J39366_1000136 | |||
| 609 | JGI25151J46595_10004611 | |||
| 610 | JGI25151J46595_10026146 | |||
| 611 | JGI25151J46595_10035285 | |||
| 612 | JGI25153J46596_10054376 | |||
| 613 | rootH1_10007098 | |||
| 614 | rootH1_10037411 | |||
| 615 | rootH1_10054269 | |||
| 616 | JGI25160J50197_1020461 | |||
| 617 | Ga0006562J51391_1026270 | |||
| 618 | Ga0006562J51391_1041146 | |||
| 619 | Ga0055539_1000061 | |||
| 620 | Ga0055532_1000042 | |||
| 621 | Ga0055525_1000480 | |||
| 622 | Ga0055525_1000616 | |||
| 623 | Ga0055527_1000169 | |||
| 624 | Ga0055535_1000031 | |||
| 625 | Ga0055542_1001292 | |||
| 626 | Ga0055529_1000075 | |||
| 627 | Ga0055526_1026693 | |||
| 628 | Ga0055524_1002307 | |||
| 629 | Ga0055524_1008846 | |||
| 630 | Ga0055536_1000108 | |||
| 631 | Ga0055534_1010636 | |||
| 632 | Ga0055531_10000011 | |||
| 633 | Ga0055541_1002919 | |||
| 634 | Ga0055541_1015165 | |||
| 635 | Ga0058692_1000025 | |||
| 636 | Ga0058692_1001325 | |||
| 637 | Ga0070683_100003993 | |||
| 638 | Ga0070680_100082043 | |||
| 639 | Ga0070682_100213578 | |||
| 640 | Ga0070661_100002111 | |||
| 641 | Ga0070661_100407762 | |||
| 642 | Ga0070659_100028665 | |||
| 643 | Ga0070709_10025818 | |||
| 644 | Ga0070663_100000086 | |||
| 645 | Ga0070684_100004378 | |||
| 646 | Ga0070684_100256708 | |||
| 647 | Ga0070664_100000210 | |||
| 648 | Ga0068857_100323692 | |||
| 649 | Ga0068854_100000176 | |||
| 650 | Ga0068856_100000539 | |||
| 651 | Ga0068856_100813534 | |||
| 652 | Ga0068852_100293395 | |||
| 653 | Ga0081539_10000709 | |||
| 654 | Ga0075363_100152709 | |||
| 655 | Ga0075364_10043348 | |||
| 656 | Ga0075367_10390260 | |||
| 657 | Ga0075366_10002780 | |||
| 658 | Ga0075366_10060088 | |||
| 659 | Ga0075370_10077364 | |||
| 660 | Ga0075370_10344754 | |||
| 661 | Ga0075430_100136085 | |||
| 662 | Ga0075431_100077526 | |||
| 663 | Ga0099826_10000029 | |||
| 664 | Ga0105251_10018652 | |||
| 665 | Ga0105251_10035794 | |||
| 666 | Ga0105251_10145367 | |||
| 667 | Ga0105244_10000076 | |||
| 668 | Ga0105240_10454623 | |||
| 669 | Ga0111539_11030966 | |||
| 670 | Ga0105245_10100173 | |||
| 671 | Ga0114129_10377697 | |||
| 672 | Ga0105243_10288804 | |||
| 673 | Ga0105243_11016140 | |||
| 674 | Ga0105249_10004632 | |||
| 675 | Ga0105239_10195606 | |||
| 676 | Ga0105246_10245508 | |||
| 677 | Ga0157373_10129255 | |||
| 678 | Ga0157371_10006566 | |||
| 679 | Ga0157369_10007469 | |||
| 680 | Ga0157369_10596192 | |||
| 681 | Ga0157372_10006060 | |||
| 682 | Ga0157372_10017379 | |||
| 683 | Ga0157372_10034019 | |||
| 684 | Ga0157372_11297528 | |||
| 685 | Ga0182008_10000119 | |||
| 686 | Ga0182006_1000067 | |||
| 687 | Ga0182007_10000123 | |||
| 688 | Ga0182005_1000002 | |||
| 689 | Ga0163161_10020619 | |||
| 690 | Ga0163161_10550756 | |||
| 691 | Ga0206352_10334922 | |||
| 692 | Ga0206353_10552251 | |||
| 693 | Ga0213872_10001107 | |||
| 694 | Ga0213872_10006231 | |||
| 695 | Ga0213872_10088999 | |||
| 696 | Ga0209784_100003 | |||
| 697 | Ga0209784_100686 | |||
| 698 | Ga0209566_100002 | |||
| 699 | Ga0209566_100330 | |||
| 700 | Ga0209566_102470 | |||
| 701 | Ga0209674_100094 | |||
| 702 | Ga0209674_104116 | |||
| 703 | Ga0209672_100096 | |||
| 704 | Ga0209147_100002 | |||
| 705 | Ga0209563_100004 | |||
| 706 | Ga0209258_100002 | |||
| 707 | Ga0209646_1000019 | |||
| 708 | Ga0209026_1011832 | |||
| 709 | Ga0209677_100071 | |||
| 710 | Ga0209148_1000118 | |||
| 711 | Ga0209759_1004997 | |||
| 712 | Ga0209759_1012625 | |||
| 713 | Ga0209565_1000084 | |||
| 714 | Ga0209565_1010070 | |||
| 715 | Ga0209455_1000009 | |||
| 716 | Ga0209673_1034247 | |||
| 717 | Ga0209130_1006165 | |||
| 718 | Ga0209675_1000464 | |||
| 719 | Ga0209676_1000012 | |||
| 720 | Ga0209025_1000214 | |||
| 721 | Ga0209025_1001025 | |||
| 722 | Ga0209025_1007952 | |||
| 723 | Ga0209025_1032342 | |||
| 724 | Ga0209564_1022535 | |||
| 725 | Ga0209564_1025321 | |||
| 726 | Ga0209564_1026027 | |||
| 727 | Ga0209758_1006507 | |||
| 728 | Ga0209758_1023388 | |||
| 729 | Ga0209050_1009066 | |||
| 730 | Ga0209256_1000468 | |||
| 731 | Ga0209256_1001006 | |||
| 732 | Ga0207426_1004524 | |||
| 733 | Ga0207426_1008470 | |||
| 734 | Ga0207426_1016632 | |||
| 735 | Ga0209051_1002325 | |||
| 736 | Ga0209051_1012366 | |||
| 737 | Ga0209257_1000017 | |||
| 738 | Ga0207655_1000030 | |||
| 739 | Ga0207655_1001093 | |||
| 740 | Ga0207655_1001907 | |||
| 741 | Ga0207713_1032021 | |||
| 742 | Ga0207699_10021514 | |||
| 743 | Ga0207695_10003065 | |||
| 744 | Ga0207695_10483383 | |||
| 745 | Ga0207660_10402059 | |||
| 746 | Ga0207690_10001107 | |||
| 747 | Ga0207709_10744361 | |||
| 748 | Ga0207704_10345353 | |||
| 749 | Ga0207661_10000747 | |||
| 750 | Ga0207679_10000240 | |||
| 751 | Ga0207679_10014167 | |||
| 752 | Ga0207712_10004502 | |||
| 753 | Ga0207640_10000049 | |||
| 754 | Ga0207678_10000353 | |||
| 755 | Ga0207702_10000550 | |||
| 756 | Ga0207702_10715809 | |||
| 757 | Ga0207641_10098511 | |||
| 758 | Ga0207674_10283821 | |||
| 759 | Ga0209371_1000036 | |||
| 760 | Ga0209371_1002657 | |||
| 761 | Ga0209371_1011550 | |||
| 762 | Ga0209282_1001593 | |||
| 763 | Ga0268266_11082022 | |||
| 764 | Ga0307517_10002842 | |||
| 765 | Ga0307515_10000497 | |||
| 766 | Ga0307515_10054430 | |||
| 767 | Ga0307515_10088171 | |||
| 768 | Ga0307515_10234736 | |||
| 769 | Ga0265338_10285782 | |||
| 770 | Ga0268256_1000040 | |||
| 771 | Ga0268256_1002353 | |||
| 772 | Ga0307511_10000238 | |||
| 773 | Ga0307512_10015539 | |||
| 774 | Ga0265332_10000013 | |||
| 775 | Ga0265325_10057382 | |||
| 776 | Ga0265327_10122603 | |||
| 777 | Ga0265316_10290426 | |||
| 778 | Ga0307513_10069290 | |||
| 779 | Ga0307509_10013379 | |||
| 780 | Ga0307509_10020287 | |||
| 781 | Ga0307509_10033994 | |||
| 782 | Ga0307408_100000114 | |||
| 783 | Ga0307508_10016710 | |||
| 784 | Ga0307514_10006271 | |||
| 785 | Ga0307514_10079711 | |||
| 786 | Ga0307514_10114363 | |||
| 787 | Ga0307514_10154087 | |||
| 788 | Ga0307516_10003058 | |||
| 789 | Ga0307516_10018858 | |||
| 790 | Ga0307518_10114000 | |||
| 791 | Ga0307410_10322209 | |||
| 792 | Ga0307410_10364955 | |||
| 793 | Ga0307406_10173533 | |||
| 794 | Ga0307414_10004465 | |||
| 795 | Ga0307414_10209347 | |||
| 796 | Ga0307411_10000823 | |||
| 797 | Ga0307507_10117085 | |||
| 798 | Ga0307510_10004320 | |||
| 799 | Ga0307510_10007211 | |||
| 800 | Ga0307510_10015697 | |||
| 801 | Ga0373948_0010565 | |||
| 802 | Ga0373940_0008308 | |||
| 803 | Ga0373939_0000029 | |||
| 804 | Ga0373960_0002621 | |||
| 805 | Ga0373931_0008333 | |||
| 806 | Ga0395900_0066377 | |||
| 807 | Ga0395900_0079576 | |||
| 808 | Ga0395900_0097583 | |||
| 809 | Ga0395900_0388450 | |||
| 810 | Ga0395898_0028535 | |||
| 811 | Ga0395905_0001795 | |||
| 812 | Ga0395905_0087003 | |||
| 813 | Ga0395901_0225283 | |||
| 814 | Ga0395901_0305528 | |||
| 815 | Ga0436361_0007228 | |||
| 816 | Ga0436361_0028828 | |||
| 817 | Ga0436361_0505573 | |||
| 818 | Ga0436361_0662050 | |||
| 819 | Ga0436361_0802016 | |||
| 820 | Ga0436361_0921973 | |||
| 821 | Ga0436361_0922237 | |||
| 822 | Ga0439436_0003137 | |||
| 823 | Ga0439439_0001872 | |||
| 824 | Ga0439439_0004865 | |||
| 825 | Ga0451837_1229693 | |||
| 826 | Ga0451843_1180629 | |||
| 827 | Ga0451853_0516285 | |||
| 828 | Ga0451853_0887708 | |||
| 829 | Ga0439433_0001405 | |||
| 830 | Ga0439449_0014625 | |||
| 831 | Ga0439449_0037525 | |||
| 832 | Ga0439455_0000348 | |||
| 833 | Ga0439457_001796 | |||
| 834 | Ga0439457_018010 | |||
| 835 | Ga0450917_000376 | |||
| 836 | Ga0450888_000028 | |||
| 837 | Ga0450890_003595 | |||
| 838 | Ga0450891_000149 | |||
| 839 | Ga0450892_000225 | |||
| 840 | Ga0450894_000045 | |||
| 841 | Ga0450896_009320 | |||
| 842 | Ga0450899_000042 | |||
| 843 | Ga0450900_012816 | |||
| 844 | Ga0450903_000542 | |||
| 845 | Ga0450903_010568 | |||
| 846 | Ga0450906_003844 | |||
| 847 | Ga0439458_0001470 | |||
| 848 | Ga0439459_0054317 | |||
| 849 | Ga0450893_0001575 | |||
| 850 | Ga0451577_0149432 | |||
| 851 | Ga0451577_0288609 | |||
| 852 | Ga0451577_0679423 | |||
| 853 | Ga0466969_0026071 | |||
| 854 | Ga0466969_0074981 | |||
| 855 | Ga0466972_0080702 | |||
| 856 | Ga0466977_0008418 | |||
| 857 | Ga0453683_0064929 | |||
| 858 | Ga0466965_0137220 | |||
| 859 | Ga0466966_0039685 | |||
| 860 | Ga0466966_0173147 | |||
| 861 | Ga0466961_0000765 | |||
| 862 | Ga0466961_0014177 | |||
| 863 | Ga0466961_0145682 | |||
| 864 | Ga0466961_0206610 | |||
| 865 | Ga0466961_0320073 | |||
| 866 | Ga0466963_0068156 | |||
| 867 | Ga0466963_0363597 | |||
| 868 | Ga0466964_0100956 | |||
| 869 | Ga0453684_0000657 | |||
| 870 | Ga0453684_0000826 | |||
| 871 | Ga0453684_0027032 | |||
| 872 | Ga0453684_0916520 | |||
| 873 | Ga0466971_0019939 | |||
| 874 | Ga0466971_0226851 | |||
| 875 | Ga0466970_0006415 | |||
| 876 | Ga0466970_0008543 | |||
| 877 | Ga0466970_0034858 | |||
| 878 | Ga0466970_0165540 | |||
| 879 | Ga0466957_0382457 | |||
| 880 | Ga0466959_0004532 | |||
| 881 | Ga0466959_0122595 | |||
| 882 | Ga0451576_0003274 | |||
| 883 | Ga0451576_0015862 | |||
| 884 | Ga0451576_0280189 | |||
| 885 | Ga0451576_0560495 | |||
| 886 | Ga0466958_0067631 | |||
| 887 | Ga0466958_0491299 | |||
| 888 | Ga0466967_0016519 | |||
| 889 | Ga0466967_0057144 | |||
| 890 | Ga0466967_0903863 | |||
| 891 | Ga0495592_0037407 | |||
| 892 | Ga0495592_0185898 | |||
| 893 | Ga0495603_0007330 | |||
| 894 | Ga0495603_0007840 | |||
| 895 | Ga0495603_0033176 | |||
| 896 | Ga0495603_0069558 | |||
| 897 | Ga0495590_0123847 | |||
| 898 | Ga0495629_0007540 | |||
| 899 | Ga0495629_0008794 | |||
| 900 | Ga0495629_0030418 | |||
| 901 | Ga0495629_0134359 | |||
| 902 | Ga0495629_0270034 | |||
| 903 | Ga0495638_0051398 | |||
| 904 | Ga0495651_0033152 | |||
| 905 | Ga0495651_0177013 | |||
| 906 | Ga0495653_0070603 | |||
| 907 | Ga0495650_0000056 | |||
| 908 | Ga0495650_0002634 | |||
| 909 | Ga0495580_0055666 | |||
| 910 | Ga0495605_0033687 | |||
| 911 | Ga0495605_0095038 | |||
| 912 | Ga0495662_0001795 | |||
| 913 | Ga0495662_0004825 | |||
| 914 | Ga0495662_0009839 | |||
| 915 | Ga0495662_0010977 | |||
| 916 | Ga0495662_0028001 | |||
| 917 | Ga0495584_0122503 | |||
| 918 | Ga0495585_0164829 | |||
| 919 | Ga0495594_0009975 | |||
| 920 | Ga0495594_0011844 | |||
| 921 | Ga0495594_0030329 | |||
| 922 | Ga0495596_0023925 | |||
| 923 | Ga0495607_0089016 | |||
| 924 | Ga0495606_0001978 | |||
| 925 | Ga0495608_0075832 | |||
| 926 | Ga0495610_0039594 | |||
| 927 | Ga0495616_0042417 | |||
| 928 | Ga0495618_0212259 | |||
| 929 | Ga0495628_0065534 | |||
| 930 | Ga0495630_0118545 | |||
| 931 | Ga0495630_0240170 | |||
| 932 | Ga0495643_0078160 | |||
| 933 | Ga0495648_0231871 | |||
| 934 | Ga0495666_0001499 | |||
| 935 | Ga0495652_0058218 | |||
| 936 | Ga0495665_0012858 | |||
| 937 | Ga0495586_0217432 | |||
| 938 | Ga0495587_0001425 | |||
| 939 | Ga0495609_0038915 | |||
| 940 | Ga0495645_0009259 | |||
| 941 | Ga0495645_0044479 | |||
| 942 | Ga0495645_0147370 | |||
| 943 | Ga0495633_0001151 | |||
| 944 | Ga0495667_0023067 | |||
| 945 | Ga0495656_0142997 | |||
| 946 | Ga0495668_0000103 | |||
| 947 | Ga0495634_0002605 | |||
| 948 | Ga0495634_0137943 | |||
| 949 | Ga0495625_0000643 | |||
| 950 | Ga0495625_0013459 | |||
| 951 | Ga0495625_0383906 | |||
| 952 | Ga0495635_0005300 | |||
| 953 | Ga0495661_0051196 | |||
| 954 | Ga0495661_0094528 | |||
| 955 | Ga0495588_0027301 | |||
| 956 | Ga0495588_0030163 | |||
| 957 | Ga0495588_0205182 | |||
| 958 | Ga0495657_0004044 | |||
| 959 | Ga0495657_0061541 | |||
| 960 | Ga0495623_0099321 | |||
| 961 | Ga0495623_0195779 | |||
| 962 | Ga0495646_0011392 | |||
| 963 | Ga0495646_0014474 | |||
| 964 | Ga0495658_0020216 | |||
| 965 | Ga0495669_0265186 | |||
| 966 | Ga0495613_0024695 | |||
| 967 | Ga0495613_0085682 | |||
| 968 | Ga0495670_0017680 | |||
| 969 | Ga0495671_0040339 | |||
| 970 | Ga0495671_0130589 | |||
| 971 | Ga0495671_0351320 | |||
| 972 | Ga0495649_0079256 | |||
| 973 | Ga0495589_0011121 | |||
| 974 | Ga0495589_0120458 | |||
| 975 | Ga0495589_0168587 | |||
| 976 | Ga0495600_0021500 | |||
| 977 | Ga0495600_0307741 | |||
| 978 | Ga0495581_0005898 | |||
| 979 | Ga0495581_0036491 | |||
| 980 | Ga0495604_0000264 | |||
| 981 | Ga0495604_0000590 | |||
| 982 | Ga0495604_0020111 | |||
| 983 | Ga0495636_0004733 | |||
| 984 | Ga0495636_0011296 | |||
| 985 | Ga0495636_0021870 | |||
| 986 | Ga0495674_0602085 | |||
| 987 | Ga0495676_0013764 | |||
| 988 | Ga0495676_0036088 | |||
| 989 | Ga0495683_0034182 | |||
| 990 | Ga0495683_0101669 | |||
| 991 | Ga0495687_002653 | |||
| 992 | Ga0495687_036832 | |||
| 993 | Ga0495687_173310 | |||
| 994 | Ga0495675_0009963 | |||
| 995 | Ga0495675_0278198 | |||
| 996 | Ga0495685_002027 | |||
| 997 | Ga0495685_003406 | |||
| 998 | Ga0495685_005251 | |||
| 999 | Ga0495685_010802 | |||
| 1000 | Ga0495685_101466 | |||
| 1001 | Ga0495681_0000442 | |||
| 1002 | Ga0495681_0025275 | |||
| 1003 | Ga0495684_0058636 | |||
| 1004 | Ga0495684_0071566 | |||
| 1005 | Ga0495686_0057500 | |||
| 1006 | Ga0495686_0073026 | |||
| 1007 | Ga0495593_0035696 | |||
| 1008 | Ga0495602_0086611 | |||
| 1009 | Ga0495602_0089577 | |||
| 1010 | Ga0495614_0003037 | |||
| 1011 | Ga0495614_0020431 | |||
| 1012 | Ga0495614_0080362 | |||
| 1013 | Ga0495626_0000197 | |||
| 1014 | Ga0496102_0167677 | |||
| 1015 | Ga0496104_0393896 | |||
| 1016 | Ga0496104_0581793 | |||
| 1017 | Ga0496109_0025467 | |||
| 1018 | Ga0496111_0371751 | |||
| 1019 | Ga0496116_0002105 | |||
| 1020 | Ga0496116_0075488 | |||
| 1021 | Ga0496116_0080291 | |||
| 1022 | Ga0496117_0000001 | |||
| 1023 | Ga0496118_0000002 | |||
| 1024 | Ga0496119_0003104 | |||
| 1025 | Ga0496120_0000028 | |||
| 1026 | Ga0496121_0006753 | |||
| 1027 | Ga0496121_0013269 | |||
| 1028 | Ga0496121_0193629 | |||
| 1029 | Ga0496122_0001676 | |||
| 1030 | Ga0496122_0085638 | |||
| 1031 | Ga0496123_0002807 | |||
| 1032 | Ga0496123_0067793 | |||
| 1033 | Ga0496124_0001246 | |||
| 1034 | Ga0496124_0058684 | |||
| 1035 | Ga0496125_0214382 | |||
| 1036 | Ga0496125_0305834 | |||
| 1037 | Ga0496126_0045207 | |||
| 1038 | Ga0501309_007469 | |||
| 1039 | Ga0501310_003134 | |||
| 1040 | Ga0495678_005338 | |||
| 1041 | Ga0495678_018990 | |||
| 1042 | Ga0495682_0003131 | |||
| 1043 | Ga0501294_002385 | |||
| 1044 | Ga0501300_003939 | |||
| 1045 | Ga0501031_0007119 | |||
| 1046 | Ga0501032_0012805 | |||
| 1047 | Ga0501032_0208143 | |||
| 1048 | Ga0501033_0002135 | |||
| 1049 | Ga0501033_0141413 | |||
| 1050 | Ga0501033_0208126 | |||
| 1051 | Ga0501033_0403142 | |||
| 1052 | Ga0501034_0001049 | |||
| 1053 | Ga0501034_0147089 | |||
| 1054 | Ga0501034_0147508 | |||
| 1055 | Ga0501034_0983704 | |||
| 1056 | Ga0501036_0000576 | |||
| 1057 | Ga0501036_0021103 | |||
| 1058 | Ga0501036_0393124 | |||
| 1059 | Ga0501037_0009522 | |||
| 1060 | Ga0501037_0139961 | |||
| 1061 | Ga0501037_0268865 | |||
| 1062 | Ga0501038_0006067 | |||
| 1063 | Ga0501038_0195117 | |||
| 1064 | Ga0501039_0093817 | |||
| 1065 | Ga0501040_0829734 | |||
| 1066 | Ga0501043_0003457 | |||
| 1067 | Ga0501043_0570764 | |||
| 1068 | Ga0501046_0015957 | |||
| 1069 | Ga0501047_0011643 | |||
| 1070 | Ga0501071_0236477 | |||
| 1071 | Ga0501075_0633400 | |||
| 1072 | Ga0501202_051415 | |||
| 1073 | Ga0501217_083728 | |||
| 1074 | Ga0501235_009196 | |||
| 1075 | Ga0501258_011087 | |||
| 1076 | Ga0501221_000105 | |||
| 1077 | Ga0501262_007915 | |||
| 1078 | Ga0501265_040925 | |||
| 1079 | Ga0501267_003397 | |||
| 1080 | Ga0501272_000243 | |||
| 1081 | Ga0501283_026424 | |||
| 1082 | Ga0501035_0007650 | |||
| 1083 | Ga0501035_0050113 | |||
| 1084 | Ga0501035_0415271 | |||
| 1085 | Ga0501044_0002016 | |||
| 1086 | Ga0501044_0008136 | |||
| 1087 | Ga0501045_0097017 | |||
| 1088 | nmdc:mga00v17_294249_c1 | |||
| 1089 | nmdc:mga0k408_1230_c1 | |||
| 1090 | nmdc:mga0k408_4433_c1 | |||
| 1091 | nmdc:mga07m45_82083_c1 | |||
| 1092 | nmdc:mga0qj67_126676_c1 | |||
| 1093 | nmdc:mga06r32_131566_c1 | |||
| 1094 | Ga0495619_0098691 | |||
| 1095 | Ga0500640_061984 | |||
| 1096 | Ga0500560_059194 | |||
| 1097 | Ga0500614_010439 | |||
| 1098 | Ga0500559_0190818 | |||
| 1099 | Ga0500573_0146753 | |||
| 1100 | Ga0500586_119098 | |||
| 1101 | Ga0500600_0086445 | |||
| 1102 | Ga0501082_0428053 | |||
| 1103 | Ga0466962_0025883 | |||
| 1104 | 2513956419 | |||
| 1105 | 2514041519 | |||
| 1106 | 2547374326 | |||
| 1107 | 2548849143 | |||
| 1108 | 2585296090 | |||
| 1109 | 2585306160 | |||
| 1110 | 2585316078 | |||
| 1111 | 2597031968 | |||
| 1112 | 2599444087 | |||
| 1113 | 2601668145 | |||
| 1114 | 2616903068 | |||
| 1115 | 2643745898 | |||
| 1116 | 2643935239 | |||
| 1117 | 2643941826 | |||
| 1118 | 2644014864 | |||
| 1119 | 2644035148 | |||
| 1120 | 2644101297 | |||
| 1121 | 2644119297 | |||
| 1122 | 2644176299 | |||
| 1123 | 2644221903 | |||
| 1124 | 2644231776 | |||
| 1125 | 2644257301 | |||
| 1126 | 2644314863 | |||
| 1127 | 2644361719 | |||
| 1128 | 2644428909 | |||
| 1129 | 2644438682 | |||
| 1130 | 2738868926 | |||
| 1131 | 2739055118 | |||
| 1132 | 2740165394 | |||
| 1133 | 2745160028 | |||
| 1134 | 2745161652 | |||
| 1135 | 2785341676 | |||
| 1136 | 2785370991 | |||
| 1137 | 2786672188 | |||
| 1138 | 2808848785 | |||
| 1139 | 2808913109 | |||
| 1140 | 2811844909 | |||
| 1141 | 2812330378 | |||
| 1142 | 2812356504 | |||
| 1143 | 2834645023 | |||
| 1144 | 2843694812 | |||
| 1145 | 2846033718 | |||
| 1146 | 2846040261 | |||
| 1147 | 2852640180 | |||
| 1148 | 2857550379 | |||
| 1149 | 2858695242 | |||
| 1150 | 2861521800 | |||
| 1151 | 2862287207 | |||
| 1152 | 2862293396 | |||
| 1153 | 2862384082 | |||
| 1154 | 2862512057 | |||
| 1155 | 2862577981 | |||
| 1156 | 2863411356 | |||
| 1157 | 2867435204 | |||
| 1158 | 2873154539 | |||
| 1159 | 2875396200 | |||
| 1160 | 2877679586 | |||
| 1161 | 2884695862 | |||
| 1162 | 2885081797 | |||
| 1163 | 2885269881 | |||
| 1164 | 2887481910 | |||
| 1165 | 2891400959 | |||
| 1166 | 2891558662 | |||
| 1167 | 2891634418 | |||
| 1168 | 2895438934 | |||
| 1169 | 2895445424 | |||
| 1170 | 2900579348 | |||
| 1171 | 2918505989 | |||
| 1172 | 2919469159 | |||
| 1173 | 2919692129 | |||
| 1174 | 2928062310 | |||
| 1175 | 2928517107 | |||
| 1176 | 2932411851 | |||
| 1177 | 2932418582 | |||
| 1178 | 2935391863 | |||
| 1179 | 2939605330 | |||
| 1180 | 2946069359 | |||
| 1181 | 2954384499 | |||
| 1182 | 2954678465 | |||
| 1183 | 2954685690 | |||
| 1184 | 2954695356 | |||
| 1185 | 2954710547 | |||
| 1186 | 2954714792 | |||
| 1187 | 2954724737 | |||
| 1188 | 2954743661 | |||
| 1189 | 2954762614 | |||
| 1190 | 2995471378 | |||
| 1191 | 2998345725 | |||
| 1192 | 3006399110 | |||
| 1193 | 644748299 | |||
| 1194 | 8001781803 | |||
| 1195 | 8001788840 | |||
| 1196 | 8003401409 | |||
| 1197 | 8008566756 | |||
| 1198 | 8008577617 | |||
| 1199 | 8033234578 | |||
| 1200 | 8048412228 | |||
| 1201 | 8055173736 | |||
| 1202 | 8057572345 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7vcf-assembly1.cif.gz_A | cryo-em structure of chlamydomonas toc-tic supercomplex | 0.4553 | 14 | 194 |
| 5vkv-assembly1.cif.gz_A | solution nmr structure of the membrane electron transporter ccda | 0.4135 | 17 | 200 |
| 7vcf-assembly1.cif.gz_A | cryo-em structure of chlamydomonas toc-tic supercomplex | 0.3772 | 14 | 194 |
| 5f4y-assembly1.cif.gz_A | structure of the sd2 domain of human shroom2 | 0.3354 | 36 | 189 |
| 5f5p-assembly1.cif.gz_A | molecular basis for shroom2 recognition by rock1 | 0.3187 | 32 | 192 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q10320_1_287_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.4592 | 14 | 193 | 1.20.1250.20 |
| af_Q2R4J1_1_279_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.4546 | 16 | 191 | 1.20.1250.20 |
| af_Q6P2T9_1_103_1.20.120.350 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Voltage-gated potassium channels. Chain C | 0.4519 | 78 | 191 | 1.20.120.350 |
| af_Q9P7Q0_1_262_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.4287 | 3 | 193 | 1.20.1250.20 |
| af_Q6P2T9_1_103_1.20.120.350 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Voltage-gated potassium channels. Chain C | 0.415 | 78 | 191 | 1.20.120.350 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6H0CX50-F1-model_v4 | Leucine efflux protein LeuE | 0.9373 | 9 | 221 |
GO:0005886
GO:0015190 GO:0015820 |
| AF-A0A1G7VGT7-F1-model_v4 | Leucine efflux protein | 0.9372 | 8 | 220 |
GO:0005886
GO:0015190 GO:0015820 |
| AF-P38102-F1-model_v4 | Uncharacterized membrane protein PA4757 | 0.9348 | 9 | 224 |
GO:0005886
GO:0015190 GO:0015820 |
| AF-A0A5M3XKK9-F1-model_v4 | Leucine efflux protein | 0.9234 | 8 | 220 |
GO:0005886
GO:0015190 GO:0015820 |
| AF-A0A3N0D5H8-F1-model_v4 | Leucine efflux protein LeuE | 0.9218 | 9 | 220 |
GO:0005886
GO:0015190 GO:0015820 |