F468098

General Info

Members Datasets Scaffolds Average Seq Length
601 415 1202 214

Family's Representative Sequence

Representative Sequence 3300047323|Ga0495683_0032650|Ga0495683_0032650_313_1056
Length 247
Sequence MAVASAALIRFTSCDRPEHFMNNLMQASFGVVDFWTFFLGTLFIVLLPGPNSLYVLSVAAQRGVRQGYLGACGVFVGDWILMILSACGAASLLKTSPVLFMAVKFIGAAYLGWIGLQMLIGCWRRLRAGSDVDAXXXAARMLAPVVRGVHPFKKALAISLLNPKAILFFISFFVQFVDPHFHSSLVSFGMLGLICQLLSFTYLTALIFLGTRLAAVFQRRRRLSAGLSAGVGALFMGFGLKLATATL

Samples

Sample ID Description Type Environment
1 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
11 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
12 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
13 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
14 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
15 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
16 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
17 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
18 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
19 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
20 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
21 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
22 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
23 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
24 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
25 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
26 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
41 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
42 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
43 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
44 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
48 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
49 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
59 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
63 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
64 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
65 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
70 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
78 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
79 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
82 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
83 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
86 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
89 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
91 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
94 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
116 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
117 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
118 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
119 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
120 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
121 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
122 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
123 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
124 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
125 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
126 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
127 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
128 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
129 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
130 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
131 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
132 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
133 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
134 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
135 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
136 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
137 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
138 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
139 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
140 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
141 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
142 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
143 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
144 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
145 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
146 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
147 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
148 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
149 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
150 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
151 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
152 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
153 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
154 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
155 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
156 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
157 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
158 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
159 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
160 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
161 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
162 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
163 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
164 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
165 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
166 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
167 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
168 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
169 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
170 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
171 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
172 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
173 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
174 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
175 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
176 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
177 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
178 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
179 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
180 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
181 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
182 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
183 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
184 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
185 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
186 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
187 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
188 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
189 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
190 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
191 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
192 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
193 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
194 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
195 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
196 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
197 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
198 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
199 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
200 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
201 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
202 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
203 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
204 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
205 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
206 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
207 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
208 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
209 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
210 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
211 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
212 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
213 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
214 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
215 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
216 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
217 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
218 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
219 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
220 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
221 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
222 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
223 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
224 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
225 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
226 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
227 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
228 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
229 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
230 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
231 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
232 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
233 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
234 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
235 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
236 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
237 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
238 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
239 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
240 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
241 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
242 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
243 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
244 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
245 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
246 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
247 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
248 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
249 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
250 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
251 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
252 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
253 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
254 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
255 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
256 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
257 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
258 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
259 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
260 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
261 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
262 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
263 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
264 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
265 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
266 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
267 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
268 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
269 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
270 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
271 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
272 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
273 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
274 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
275 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
276 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
277 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
285 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
290 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
291 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
292 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
293 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
294 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
295 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
296 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
297 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
298 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
299 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
300 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
301 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
304 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
305 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
306 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
307 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
308 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
309 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
310 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
311 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
312 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
313 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
314 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
315 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
316 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
317 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
318 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
319 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
320 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
321 2547132103 Chromobacterium sp. C-61 Isolate Rhizosphere
322 2547132512 Azospira oryzae 6a3 Isolate Unclassified
323 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
324 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
325 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
326 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
327 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
328 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
329 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
330 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
331 2643221585 Pelomonas sp. Root662 Isolate Unclassified
332 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
333 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
334 2643221604 Nocardioides sp. Root190 Isolate Unclassified
335 2643221617 Nocardioides sp. Root79 Isolate Unclassified
336 2643221620 Nocardioides sp. Root240 Isolate Unclassified
337 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
338 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
339 2643221641 Nocardioides sp. Root122 Isolate Unclassified
340 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
341 2643221656 Pelomonas sp. Root405 Isolate Unclassified
342 2643221665 Acinetobacter sp. Root1280 Isolate Unclassified
343 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
344 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
345 2738541305 Nocardioides sp. CF167 Isolate Unclassified
346 2738541337 Pelomonas sp. BT06 Isolate Unclassified
347 2739367898 Nocardioides sp. CF479 Isolate Unclassified
348 2744054655 Acinetobacter sp. BMW17 Isolate Unclassified
349 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
350 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
351 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
352 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
353 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
354 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
355 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
356 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
357 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
358 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
359 2846033681 Chromobacterium sinusclupearum MWU13-2610 Isolate Rhizosphere
360 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
361 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
362 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
363 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
364 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
365 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
366 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
367 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
368 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
369 2862574272 Streptomyces sp. AcE210 Isolate Nodule
370 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
371 2867428634 Streptomyces sp. RP5T Isolate Unclassified
372 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
373 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
374 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
375 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
376 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
377 2885266251 Ralstonia sp. SET104 Isolate Nodule
378 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
379 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
380 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
381 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
382 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
383 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
384 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
385 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
386 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
387 2919688452 Pararheinheimera soli 4138 Isolate Unclassified
388 2928058823 Ralstonia sp. 1138 Isolate Unclassified
389 2928515477 Acinetobacter bereziniae 1375 Isolate Rhizosphere
390 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
391 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
392 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
393 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
394 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
395 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
396 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
397 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
398 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
399 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
400 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
401 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
402 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
403 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
404 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
405 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere
406 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
407 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
408 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
409 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
410 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
411 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
412 8033232454 Acinetobacter radioresistens SA188 Isolate Unclassified
413 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
414 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
415 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.53
Metatranscriptomes 1
Isolates 16.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.81
Nodule 1.5
Rhizoplane 1.16
Rhizosphere 66.39
Stem 0
Stem Tuber 0
Unclassified 0.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495683_0032650 3300047323 Bacteria 2651
2 JGI24741J21665_1000679 3300001915 Bacteria 10254
3 JGI24740J21852_10029859 3300001979 Bacteria 1784
4 JGI24740J21852_10030041 3300001979 Bacteria 1775
5 JGI25156J39149_1018101 3300002705 Bacteria 1313
6 JGI25156J39149_1024588 3300002705 Bacteria 983
7 JGI25154J39366_1000136 3300002738 Bacteria 57760
8 JGI25151J46595_10004611 3300003187 Bacteria 7254
9 JGI25151J46595_10026146 3300003187 Bacteria 2360
10 JGI25151J46595_10035285 3300003187 Bacteria 1901
11 JGI25153J46596_10054376 3300003215 Bacteria 1127
12 rootH1_10007098 3300003316 Bacteria 1112
13 rootH1_10037411 3300003316 Bacteria 5055
14 rootH1_10054269 3300003323 Bacteria 1325
15 JGI25160J50197_1020461 3300003354 Bacteria 1995
16 Ga0006562J51391_1026270 3300003578 Bacteria 873
17 Ga0006562J51391_1041146 3300003578 Bacteria 1090
18 Ga0055539_1000061 3300003752 Bacteria 144457
19 Ga0055532_1000042 3300003758 Bacteria 195195
20 Ga0055525_1000480 3300003759 Bacteria 21423
21 Ga0055525_1000616 3300003759 Bacteria 14804
22 Ga0055527_1000169 3300003760 Bacteria 45013
23 Ga0055535_1000031 3300003761 Bacteria 195195
24 Ga0055542_1001292 3300003762 Bacteria 13371
25 Ga0055529_1000075 3300003763 Bacteria 156291
26 Ga0055526_1026693 3300003771 Bacteria 1811
27 Ga0055524_1002307 3300003775 Bacteria 9936
28 Ga0055524_1008846 3300003775 Bacteria 4147
29 Ga0055536_1000108 3300003781 Bacteria 73142
30 Ga0055534_1010636 3300003784 Bacteria 1913
31 Ga0055531_10000011 3300003794 Bacteria 195010
32 Ga0055541_1002919 3300003841 Bacteria 3299
33 Ga0055541_1015165 3300003841 Bacteria 1033
34 Ga0058692_1000025 3300003856 Bacteria 217356
35 Ga0058692_1001325 3300003856 Bacteria 9285
36 Ga0070683_100003993 3300005329 Bacteria 12083
37 Ga0070680_100082043 3300005336 Bacteria 2661
38 Ga0070682_100213578 3300005337 Bacteria 1369
39 Ga0070661_100002111 3300005344 Bacteria 13690
40 Ga0070661_100407762 3300005344 Bacteria 1076
41 Ga0070659_100028665 3300005366 Bacteria 4302
42 Ga0070709_10025818 3300005434 Bacteria 3473
43 Ga0070663_100000086 3300005455 Bacteria 41783
44 Ga0070684_100004378 3300005535 Bacteria 10735
45 Ga0070684_100256708 3300005535 Bacteria 1598
46 Ga0070664_100000210 3300005564 Bacteria 41664
47 Ga0068857_100323692 3300005577 Bacteria 1424
48 Ga0068854_100000176 3300005578 Bacteria 43579
49 Ga0068856_100000539 3300005614 Bacteria 41776
50 Ga0068856_100813534 3300005614 Bacteria 954
51 Ga0068852_100293395 3300005616 Bacteria 1572
52 Ga0081539_10000709 3300005985 Bacteria 66741
53 Ga0075363_100152709 3300006048 Bacteria 1304
54 Ga0075364_10043348 3300006051 Bacteria 2925
55 Ga0075367_10390260 3300006178 Bacteria 880
56 Ga0075366_10002780 3300006195 Bacteria 9062
57 Ga0075366_10060088 3300006195 Bacteria 2258
58 Ga0075370_10077364 3300006353 Bacteria 1909
59 Ga0075370_10344754 3300006353 Bacteria 889
60 Ga0075430_100136085 3300006846 Bacteria 2047
61 Ga0075431_100077526 3300006847 Bacteria 3430
62 Ga0099826_10000029 3300006948 Bacteria 128855
63 Ga0105251_10018652 3300009011 Bacteria 3683
64 Ga0105251_10035794 3300009011 Bacteria 2447
65 Ga0105251_10145367 3300009011 Bacteria 1072
66 Ga0105244_10000076 3300009036 Bacteria 110824
67 Ga0105240_10454623 3300009093 Bacteria 1432
68 Ga0111539_11030966 3300009094 Bacteria 956
69 Ga0105245_10100173 3300009098 Bacteria 2680
70 Ga0114129_10377697 3300009147 Bacteria 1872
71 Ga0105243_10288804 3300009148 Bacteria 1481
72 Ga0105243_11016140 3300009148 Bacteria 833
73 Ga0105249_10004632 3300009553 Bacteria 11881
74 Ga0105239_10195606 3300010375 Bacteria 2264
75 Ga0105246_10245508 3300011119 Bacteria 1418
76 Ga0157373_10129255 3300013100 Bacteria 1776
77 Ga0157371_10006566 3300013102 Bacteria 9565
78 Ga0157369_10007469 3300013105 Bacteria 12585
79 Ga0157369_10596192 3300013105 Bacteria 1141
80 Ga0157372_10006060 3300013307 Bacteria 12846
81 Ga0157372_10017379 3300013307 Bacteria 7720
82 Ga0157372_10034019 3300013307 Bacteria 5599
83 Ga0157372_11297528 3300013307 Bacteria 840
84 Ga0182008_10000119 3300014497 Bacteria 59427
85 Ga0182006_1000067 3300015261 Bacteria 147932
86 Ga0182007_10000123 3300015262 Bacteria 53953
87 Ga0182005_1000002 3300015265 Bacteria 908499
88 Ga0163161_10020619 3300017792 Bacteria 4628
89 Ga0163161_10550756 3300017792 Bacteria 945
90 Ga0206352_10334922 3300020078 Bacteria 1820
91 Ga0206353_10552251 3300020082 Bacteria 2105
92 Ga0213872_10001107 3300021361 Bacteria 18438
93 Ga0213872_10006231 3300021361 Bacteria 6024
94 Ga0213872_10088999 3300021361 Bacteria 1383
95 Ga0209784_100003 3300025224 Bacteria 1379451
96 Ga0209784_100686 3300025224 Bacteria 9430
97 Ga0209566_100002 3300025225 Bacteria 2614868
98 Ga0209566_100330 3300025225 Bacteria 42404
99 Ga0209566_102470 3300025225 Bacteria 3401
100 Ga0209674_100094 3300025226 Bacteria 169506
101 Ga0209674_104116 3300025226 Bacteria 2451
102 Ga0209672_100096 3300025228 Bacteria 112947
103 Ga0209147_100002 3300025229 Bacteria 2158988
104 Ga0209563_100004 3300025230 Bacteria 1814108
105 Ga0209258_100002 3300025242 Bacteria 2158988
106 Ga0209646_1000019 3300025246 Bacteria 475248
107 Ga0209026_1011832 3300025250 Bacteria 1547
108 Ga0209677_100071 3300025253 Bacteria 139425
109 Ga0209148_1000118 3300025254 Bacteria 188330
110 Ga0209759_1004997 3300025256 Bacteria 4776
111 Ga0209759_1012625 3300025256 Bacteria 2328
112 Ga0209565_1000084 3300025263 Bacteria 153894
113 Ga0209565_1010070 3300025263 Bacteria 2360
114 Ga0209455_1000009 3300025272 Bacteria 1042273
115 Ga0209673_1034247 3300025273 Bacteria 1537
116 Ga0209130_1006165 3300025284 Bacteria 3954
117 Ga0209675_1000464 3300025291 Bacteria 31142
118 Ga0209676_1000012 3300025292 Bacteria 841431
119 Ga0209025_1000214 3300025294 Bacteria 138780
120 Ga0209025_1001025 3300025294 Bacteria 41120
121 Ga0209025_1007952 3300025294 Bacteria 7760
122 Ga0209025_1032342 3300025294 Bacteria 2448
123 Ga0209564_1022535 3300025295 Bacteria 2222
124 Ga0209564_1025321 3300025295 Bacteria 2000
125 Ga0209564_1026027 3300025295 Bacteria 1947
126 Ga0209758_1006507 3300025297 Bacteria 8345
127 Ga0209758_1023388 3300025297 Bacteria 2796
128 Ga0209050_1009066 3300025298 Bacteria 5170
129 Ga0209256_1000468 3300025299 Bacteria 60770
130 Ga0209256_1001006 3300025299 Bacteria 33408
131 Ga0207426_1004524 3300025302 Bacteria 6728
132 Ga0207426_1008470 3300025302 Bacteria 4148
133 Ga0207426_1016632 3300025302 Bacteria 2634
134 Ga0209051_1002325 3300025303 Bacteria 13807
135 Ga0209051_1012366 3300025303 Bacteria 4135
136 Ga0209257_1000017 3300025304 Bacteria 866287
137 Ga0207655_1000030 3300025728 Bacteria 413221
138 Ga0207655_1001093 3300025728 Bacteria 26680
139 Ga0207655_1001907 3300025728 Bacteria 17900
140 Ga0207713_1032021 3300025735 Bacteria 2315
141 Ga0207699_10021514 3300025906 Bacteria 3478
142 Ga0207695_10003065 3300025913 Bacteria 23956
143 Ga0207695_10483383 3300025913 Bacteria 1120
144 Ga0207660_10402059 3300025917 Bacteria 1103
145 Ga0207690_10001107 3300025932 Bacteria 17169
146 Ga0207709_10744361 3300025935 Bacteria 787
147 Ga0207704_10345353 3300025938 Bacteria 1157
148 Ga0207661_10000747 3300025944 Bacteria 21096
149 Ga0207679_10000240 3300025945 Bacteria 41798
150 Ga0207679_10014167 3300025945 Bacteria 5236
151 Ga0207712_10004502 3300025961 Bacteria 8805
152 Ga0207640_10000049 3300025981 Bacteria 97025
153 Ga0207678_10000353 3300026067 Bacteria 41741
154 Ga0207702_10000550 3300026078 Bacteria 41779
155 Ga0207702_10715809 3300026078 Bacteria 987
156 Ga0207641_10098511 3300026088 Bacteria 2571
157 Ga0207674_10283821 3300026116 Bacteria 1604
158 Ga0209371_1000036 3300027312 Bacteria 367250
159 Ga0209371_1002657 3300027312 Bacteria 9739
160 Ga0209371_1011550 3300027312 Bacteria 2616
161 Ga0209282_1001593 3300027666 Bacteria 12556
162 Ga0268266_11082022 3300028379 Bacteria 776
163 Ga0307517_10002842 3300028786 Bacteria 27511
164 Ga0307515_10000497 3300028794 Bacteria 94190
165 Ga0307515_10054430 3300028794 Bacteria 5875
166 Ga0307515_10088171 3300028794 Bacteria 3926
167 Ga0307515_10234736 3300028794 Bacteria 1618
168 Ga0265338_10285782 3300028800 Bacteria 1204
169 Ga0268256_1000040 3300030500 Bacteria 348002
170 Ga0268256_1002353 3300030500 Bacteria 9739
171 Ga0307511_10000238 3300030521 Bacteria 56455
172 Ga0307512_10015539 3300030522 Bacteria 7051
173 Ga0265332_10000013 3300031238 Bacteria 250095
174 Ga0265325_10057382 3300031241 Bacteria 1985
175 Ga0265327_10122603 3300031251 Unclassified 1230
176 Ga0265316_10290426 3300031344 Bacteria 1193
177 Ga0307513_10069290 3300031456 Bacteria 3691
178 Ga0307509_10013379 3300031507 Bacteria 9719
179 Ga0307509_10020287 3300031507 Bacteria 7544
180 Ga0307509_10033994 3300031507 Bacteria 5605
181 Ga0307408_100000114 3300031548 Bacteria 89451
182 Ga0307508_10016710 3300031616 Bacteria 6676
183 Ga0307514_10006271 3300031649 Bacteria 10408
184 Ga0307514_10079711 3300031649 Bacteria 2426
185 Ga0307514_10114363 3300031649 Bacteria 1902
186 Ga0307514_10154087 3300031649 Bacteria 1536
187 Ga0307516_10003058 3300031730 Bacteria 21831
188 Ga0307516_10018858 3300031730 Bacteria 7161
189 Ga0307518_10114000 3300031838 Bacteria 1922
190 Ga0307410_10322209 3300031852 Bacteria 1227
191 Ga0307410_10364955 3300031852 Bacteria 1158
192 Ga0307406_10173533 3300031901 Bacteria 1563
193 Ga0307414_10004465 3300032004 Bacteria 7598
194 Ga0307414_10209347 3300032004 Bacteria 1592
195 Ga0307411_10000823 3300032005 Bacteria 11600
196 Ga0307507_10117085 3300033179 Bacteria 2149
197 Ga0307510_10004320 3300033180 Bacteria 16724
198 Ga0307510_10007211 3300033180 Bacteria 13244
199 Ga0307510_10015697 3300033180 Bacteria 8958
200 Ga0373948_0010565 3300034817 Bacteria 1615
201 Ga0373940_0008308 3300035088 Bacteria 2376
202 Ga0373939_0000029 3300035114 Bacteria 52306
203 Ga0373960_0002621 3300035121 Bacteria 4068
204 Ga0373931_0008333 3300035691 Bacteria 4910
205 Ga0395900_0066377 3300037418 Bacteria 3707
206 Ga0395900_0079576 3300037418 Bacteria 3368
207 Ga0395900_0097583 3300037418 Bacteria 3019
208 Ga0395900_0388450 3300037418 Bacteria 1362
209 Ga0395898_0028535 3300037466 Bacteria 5591
210 Ga0395905_0001795 3300037471 Bacteria 24890
211 Ga0395905_0087003 3300037471 Bacteria 2930
212 Ga0395901_0225283 3300038443 Bacteria 1959
213 Ga0395901_0305528 3300038443 Bacteria 1649
214 Ga0436361_0007228 3300039447 Bacteria 1845
215 Ga0436361_0028828 3300039447 Bacteria 968
216 Ga0436361_0505573 3300039447 Bacteria 1738
217 Ga0436361_0662050 3300039447 Unclassified 3482
218 Ga0436361_0802016 3300039447 Bacteria 24229
219 Ga0436361_0921973 3300039447 Bacteria 1083
220 Ga0436361_0922237 3300039447 Bacteria 22454
221 Ga0439436_0003137 3300041404 Bacteria 5010
222 Ga0439439_0001872 3300041406 Bacteria 4342
223 Ga0439439_0004865 3300041406 Bacteria 3044
224 Ga0451837_1229693 3300041494 Bacteria 1228
225 Ga0451843_1180629 3300041509 Bacteria 910
226 Ga0451853_0516285 3300041512 Bacteria 1075
227 Ga0451853_0887708 3300041512 Bacteria 1145
228 Ga0439433_0001405 3300041999 Bacteria 4954
229 Ga0439449_0014625 3300042007 Bacteria 2949
230 Ga0439449_0037525 3300042007 Bacteria 1802
231 Ga0439455_0000348 3300042012 Bacteria 5982
232 Ga0439457_001796 3300042014 Bacteria 6338
233 Ga0439457_018010 3300042014 Bacteria 1567
234 Ga0450917_000376 3300042120 Bacteria 3350
235 Ga0450888_000028 3300042126 Bacteria 10038
236 Ga0450890_003595 3300042127 Bacteria 2056
237 Ga0450891_000149 3300042129 Bacteria 6505
238 Ga0450892_000225 3300042130 Bacteria 6792
239 Ga0450894_000045 3300042131 Bacteria 18255
240 Ga0450896_009320 3300042133 Bacteria 1366
241 Ga0450899_000042 3300042135 Bacteria 9738
242 Ga0450900_012816 3300042136 Bacteria 1103
243 Ga0450903_000542 3300042138 Bacteria 7873
244 Ga0450903_010568 3300042138 Bacteria 1492
245 Ga0450906_003844 3300042145 Bacteria 3194
246 Ga0439458_0001470 3300042157 Bacteria 5937
247 Ga0439459_0054317 3300042438 Bacteria 889
248 Ga0450893_0001575 3300042532 Bacteria 3500
249 Ga0451577_0149432 3300042876 Bacteria 2101
250 Ga0451577_0288609 3300042876 Bacteria 1487
251 Ga0451577_0679423 3300042876 Bacteria 933
252 Ga0466969_0026071 3300044656 Bacteria 3000
253 Ga0466969_0074981 3300044656 Bacteria 1622
254 Ga0466972_0080702 3300044658 Bacteria 1549
255 Ga0466977_0008418 3300044666 Bacteria 5721
256 Ga0453683_0064929 3300044673 Bacteria 2282
257 Ga0466965_0137220 3300044683 Bacteria 1271
258 Ga0466966_0039685 3300044684 Bacteria 3032
259 Ga0466966_0173147 3300044684 Bacteria 1311
260 Ga0466961_0000765 3300044693 Bacteria 20117
261 Ga0466961_0014177 3300044693 Bacteria 5115
262 Ga0466961_0145682 3300044693 Bacteria 1481
263 Ga0466961_0206610 3300044693 Bacteria 1213
264 Ga0466961_0320073 3300044693 Bacteria 946
265 Ga0466963_0068156 3300044694 Bacteria 2389
266 Ga0466963_0363597 3300044694 Bacteria 1019
267 Ga0466964_0100956 3300044706 Bacteria 1272
268 Ga0453684_0000657 3300044712 Bacteria 124222
269 Ga0453684_0000826 3300044712 Bacteria 104663
270 Ga0453684_0027032 3300044712 Bacteria 8252
271 Ga0453684_0916520 3300044712 Bacteria 937
272 Ga0466971_0019939 3300044719 Bacteria 2980
273 Ga0466971_0226851 3300044719 Bacteria 886
274 Ga0466970_0006415 3300044765 Bacteria 5883
275 Ga0466970_0008543 3300044765 Bacteria 5157
276 Ga0466970_0034858 3300044765 Bacteria 2665
277 Ga0466970_0165540 3300044765 Bacteria 1224
278 Ga0466957_0382457 3300044842 Bacteria 960
279 Ga0466959_0004532 3300045049 Bacteria 9319
280 Ga0466959_0122595 3300045049 Bacteria 1846
281 Ga0451576_0003274 3300045051 Bacteria 22482
282 Ga0451576_0015862 3300045051 Bacteria 8334
283 Ga0451576_0280189 3300045051 Bacteria 1743
284 Ga0451576_0560495 3300045051 Bacteria 1200
285 Ga0466958_0067631 3300045836 Bacteria 2183
286 Ga0466958_0491299 3300045836 Bacteria 796
287 Ga0466967_0016519 3300045976 Bacteria 5825
288 Ga0466967_0057144 3300045976 Bacteria 3443
289 Ga0466967_0903863 3300045976 Bacteria 878
290 Ga0495592_0037407 3300046454 Bacteria 3654
291 Ga0495592_0185898 3300046454 Bacteria 1411
292 Ga0495603_0007330 3300046455 Bacteria 6632
293 Ga0495603_0007840 3300046455 Bacteria 6438
294 Ga0495603_0033176 3300046455 Bacteria 3106
295 Ga0495603_0069558 3300046455 Bacteria 2070
296 Ga0495590_0123847 3300046457 Bacteria 927
297 Ga0495629_0007540 3300046459 Bacteria 8020
298 Ga0495629_0008794 3300046459 Bacteria 7425
299 Ga0495629_0030418 3300046459 Bacteria 3827
300 Ga0495629_0134359 3300046459 Bacteria 1722
301 Ga0495629_0270034 3300046459 Bacteria 1168
302 Ga0495638_0051398 3300046460 Bacteria 2570
303 Ga0495651_0033152 3300046462 Bacteria 4028
304 Ga0495651_0177013 3300046462 Bacteria 1513
305 Ga0495653_0070603 3300046463 Bacteria 2613
306 Ga0495650_0000056 3300046471 Bacteria 307565
307 Ga0495650_0002634 3300046471 Bacteria 14043
308 Ga0495580_0055666 3300046472 Bacteria 2786
309 Ga0495605_0033687 3300046474 Bacteria 2598
310 Ga0495605_0095038 3300046474 Bacteria 1376
311 Ga0495662_0001795 3300046476 Bacteria 10744
312 Ga0495662_0004825 3300046476 Bacteria 6758
313 Ga0495662_0009839 3300046476 Bacteria 4697
314 Ga0495662_0010977 3300046476 Bacteria 4430
315 Ga0495662_0028001 3300046476 Bacteria 2721
316 Ga0495584_0122503 3300046491 Bacteria 1317
317 Ga0495585_0164829 3300046492 Bacteria 1148
318 Ga0495594_0009975 3300046499 Bacteria 4918
319 Ga0495594_0011844 3300046499 Bacteria 4537
320 Ga0495594_0030329 3300046499 Bacteria 2925
321 Ga0495596_0023925 3300046500 Bacteria 2476
322 Ga0495607_0089016 3300046501 Bacteria 1676
323 Ga0495606_0001978 3300046507 Bacteria 25275
324 Ga0495608_0075832 3300046511 Bacteria 2191
325 Ga0495610_0039594 3300046512 Bacteria 2382
326 Ga0495616_0042417 3300046513 Bacteria 2316
327 Ga0495618_0212259 3300046514 Bacteria 1223
328 Ga0495628_0065534 3300046516 Bacteria 2840
329 Ga0495630_0118545 3300046517 Bacteria 2007
330 Ga0495630_0240170 3300046517 Bacteria 1384
331 Ga0495643_0078160 3300046522 Bacteria 1728
332 Ga0495648_0231871 3300046524 Bacteria 903
333 Ga0495666_0001499 3300046526 Bacteria 11413
334 Ga0495652_0058218 3300046529 Bacteria 3273
335 Ga0495665_0012858 3300046531 Bacteria 4530
336 Ga0495586_0217432 3300046535 Bacteria 1085
337 Ga0495587_0001425 3300046536 Bacteria 15904
338 Ga0495609_0038915 3300046538 Bacteria 2142
339 Ga0495645_0009259 3300046543 Bacteria 6886
340 Ga0495645_0044479 3300046543 Bacteria 3238
341 Ga0495645_0147370 3300046543 Bacteria 1638
342 Ga0495633_0001151 3300046558 Bacteria 21225
343 Ga0495667_0023067 3300046559 Bacteria 4192
344 Ga0495656_0142997 3300046615 Bacteria 1149
345 Ga0495668_0000103 3300046616 Bacteria 135853
346 Ga0495634_0002605 3300046642 Bacteria 14837
347 Ga0495634_0137943 3300046642 Bacteria 1550
348 Ga0495625_0000643 3300046660 Bacteria 50299
349 Ga0495625_0013459 3300046660 Bacteria 6574
350 Ga0495625_0383906 3300046660 Bacteria 881
351 Ga0495635_0005300 3300046663 Bacteria 8973
352 Ga0495661_0051196 3300046665 Bacteria 2495
353 Ga0495661_0094528 3300046665 Bacteria 1694
354 Ga0495588_0027301 3300046674 Bacteria 2853
355 Ga0495588_0030163 3300046674 Bacteria 2724
356 Ga0495588_0205182 3300046674 Bacteria 1041
357 Ga0495657_0004044 3300046675 Bacteria 11759
358 Ga0495657_0061541 3300046675 Bacteria 2482
359 Ga0495623_0099321 3300046679 Bacteria 1775
360 Ga0495623_0195779 3300046679 Bacteria 1165
361 Ga0495646_0011392 3300046680 Bacteria 5646
362 Ga0495646_0014474 3300046680 Bacteria 5016
363 Ga0495658_0020216 3300046683 Bacteria 3491
364 Ga0495669_0265186 3300046684 Bacteria 825
365 Ga0495613_0024695 3300046689 Bacteria 4477
366 Ga0495613_0085682 3300046689 Bacteria 2285
367 Ga0495670_0017680 3300046691 Bacteria 3511
368 Ga0495671_0040339 3300046692 Bacteria 2354
369 Ga0495671_0130589 3300046692 Bacteria 1225
370 Ga0495671_0351320 3300046692 Bacteria 707
371 Ga0495649_0079256 3300046694 Bacteria 1757
372 Ga0495589_0011121 3300046794 Bacteria 4670
373 Ga0495589_0120458 3300046794 Bacteria 1263
374 Ga0495589_0168587 3300046794 Bacteria 1041
375 Ga0495600_0021500 3300046809 Bacteria 4132
376 Ga0495600_0307741 3300046809 Bacteria 998
377 Ga0495581_0005898 3300047315 Bacteria 7105
378 Ga0495581_0036491 3300047315 Bacteria 2844
379 Ga0495604_0000264 3300047317 Bacteria 46714
380 Ga0495604_0000590 3300047317 Bacteria 31463
381 Ga0495604_0020111 3300047317 Bacteria 5335
382 Ga0495636_0004733 3300047318 Bacteria 5340
383 Ga0495636_0011296 3300047318 Bacteria 3533
384 Ga0495636_0021870 3300047318 Bacteria 2583
385 Ga0495674_0602085 3300047319 Bacteria 870
386 Ga0495676_0013764 3300047321 Bacteria 7254
387 Ga0495676_0036088 3300047321 Bacteria 4131
388 Ga0495683_0034182 3300047323 Bacteria 2586
389 Ga0495683_0101669 3300047323 Bacteria 1381
390 Ga0495687_002653 3300047443 Bacteria 13957
391 Ga0495687_036832 3300047443 Bacteria 2184
392 Ga0495687_173310 3300047443 Bacteria 712
393 Ga0495675_0009963 3300047444 Bacteria 5926
394 Ga0495675_0278198 3300047444 Bacteria 998
395 Ga0495685_002027 3300047447 Bacteria 6294
396 Ga0495685_003406 3300047447 Bacteria 5076
397 Ga0495685_005251 3300047447 Bacteria 4218
398 Ga0495685_010802 3300047447 Bacteria 3068
399 Ga0495685_101466 3300047447 Bacteria 950
400 Ga0495681_0000442 3300047470 Bacteria 31718
401 Ga0495681_0025275 3300047470 Bacteria 3109
402 Ga0495684_0058636 3300047471 Bacteria 2932
403 Ga0495684_0071566 3300047471 Bacteria 2634
404 Ga0495686_0057500 3300047472 Bacteria 2427
405 Ga0495686_0073026 3300047472 Bacteria 2108
406 Ga0495593_0035696 3300047673 Bacteria 2697
407 Ga0495602_0086611 3300048088 Bacteria 2614
408 Ga0495602_0089577 3300048088 Bacteria 2558
409 Ga0495614_0003037 3300048089 Bacteria 7478
410 Ga0495614_0020431 3300048089 Bacteria 2863
411 Ga0495614_0080362 3300048089 Bacteria 1412
412 Ga0495626_0000197 3300048091 Bacteria 73484
413 Ga0496102_0167677 3300048905 Bacteria 2067
414 Ga0496104_0393896 3300048907 Bacteria 1297
415 Ga0496104_0581793 3300048907 Bacteria 1030
416 Ga0496109_0025467 3300048912 Bacteria 5273
417 Ga0496111_0371751 3300048914 Bacteria 1058
418 Ga0496116_0002105 3300048919 Bacteria 21249
419 Ga0496116_0075488 3300048919 Bacteria 2115
420 Ga0496116_0080291 3300048919 Bacteria 2026
421 Ga0496117_0000001 3300048920 Bacteria 2526244
422 Ga0496118_0000002 3300048921 Bacteria 1690764
423 Ga0496119_0003104 3300048922 Bacteria 17531
424 Ga0496120_0000028 3300048923 Bacteria 230249
425 Ga0496121_0006753 3300048924 Bacteria 14081
426 Ga0496121_0013269 3300048924 Bacteria 8872
427 Ga0496121_0193629 3300048924 Bacteria 1455
428 Ga0496122_0001676 3300048925 Bacteria 34352
429 Ga0496122_0085638 3300048925 Bacteria 2173
430 Ga0496123_0002807 3300048926 Bacteria 20674
431 Ga0496123_0067793 3300048926 Bacteria 2251
432 Ga0496124_0001246 3300048927 Bacteria 39090
433 Ga0496124_0058684 3300048927 Bacteria 3235
434 Ga0496125_0214382 3300048928 Bacteria 1247
435 Ga0496125_0305834 3300048928 Bacteria 971
436 Ga0496126_0045207 3300048929 Bacteria 4049
437 Ga0501309_007469 3300049129 Bacteria 1356
438 Ga0501310_003134 3300049130 Bacteria 1607
439 Ga0495678_005338 3300049459 Bacteria 7126
440 Ga0495678_018990 3300049459 Bacteria 3077
441 Ga0495682_0003131 3300049460 Bacteria 7477
442 Ga0501294_002385 3300049517 Bacteria 1788
443 Ga0501300_003939 3300049523 Bacteria 2209
444 Ga0501031_0007119 3300049568 Bacteria 7300
445 Ga0501032_0012805 3300049569 Bacteria 5981
446 Ga0501032_0208143 3300049569 Bacteria 1276
447 Ga0501033_0002135 3300049570 Bacteria 17104
448 Ga0501033_0141413 3300049570 Bacteria 1739
449 Ga0501033_0208126 3300049570 Bacteria 1395
450 Ga0501033_0403142 3300049570 Bacteria 954
451 Ga0501034_0001049 3300049571 Bacteria 39330
452 Ga0501034_0147089 3300049571 Bacteria 2333
453 Ga0501034_0147508 3300049571 Bacteria 2329
454 Ga0501034_0983704 3300049571 Bacteria 728
455 Ga0501036_0000576 3300049572 Bacteria 26456
456 Ga0501036_0021103 3300049572 Bacteria 5471
457 Ga0501036_0393124 3300049572 Bacteria 1157
458 Ga0501037_0009522 3300049573 Bacteria 7129
459 Ga0501037_0139961 3300049573 Bacteria 1732
460 Ga0501037_0268865 3300049573 Bacteria 1190
461 Ga0501038_0006067 3300049574 Bacteria 11179
462 Ga0501038_0195117 3300049574 Bacteria 1628
463 Ga0501039_0093817 3300049575 Bacteria 2339
464 Ga0501040_0829734 3300049576 Bacteria 669
465 Ga0501043_0003457 3300049579 Bacteria 12972
466 Ga0501043_0570764 3300049579 Bacteria 838
467 Ga0501046_0015957 3300049580 Bacteria 6300
468 Ga0501047_0011643 3300049581 Bacteria 8318
469 Ga0501071_0236477 3300049587 Bacteria 1377
470 Ga0501075_0633400 3300049591 Bacteria 815
471 Ga0501202_051415 3300049652 Bacteria 914
472 Ga0501217_083728 3300049661 Bacteria 886
473 Ga0501235_009196 3300049669 Bacteria 2159
474 Ga0501258_011087 3300049687 Bacteria 962
475 Ga0501221_000105 3300049704 Bacteria 10203
476 Ga0501262_007915 3300049759 Bacteria 1294
477 Ga0501265_040925 3300049762 Bacteria 700
478 Ga0501267_003397 3300049764 Bacteria 1449
479 Ga0501272_000243 3300049769 Bacteria 4546
480 Ga0501283_026424 3300049779 Bacteria 955
481 Ga0501035_0007650 3300049822 Bacteria 10093
482 Ga0501035_0050113 3300049822 Bacteria 3743
483 Ga0501035_0415271 3300049822 Bacteria 1118
484 Ga0501044_0002016 3300049823 Bacteria 23415
485 Ga0501044_0008136 3300049823 Bacteria 11508
486 Ga0501045_0097017 3300049824 Bacteria 2181
487 nmdc:mga00v17_294249_c1 3300050491 Bacteria 1054
488 nmdc:mga0k408_1230_c1 3300050493 Bacteria 14028
489 nmdc:mga0k408_4433_c1 3300050493 Bacteria 7449
490 nmdc:mga07m45_82083_c1 3300050496 Bacteria 1841
491 nmdc:mga0qj67_126676_c1 3300050509 Bacteria 2066
492 nmdc:mga06r32_131566_c1 3300050510 Bacteria 2474
493 Ga0495619_0098691 3300053085 Bacteria 1986
494 Ga0500640_061984 3300053095 Bacteria 1619
495 Ga0500560_059194 3300053107 Bacteria 1245
496 Ga0500614_010439 3300053123 Bacteria 1995
497 Ga0500559_0190818 3300053136 Bacteria 966
498 Ga0500573_0146753 3300053140 Bacteria 1295
499 Ga0500586_119098 3300053145 Bacteria 920
500 Ga0500600_0086445 3300053149 Bacteria 1683
501 Ga0501082_0428053 3300060353 Bacteria 1156
502 Ga0466962_0025883 3300061719 Bacteria 2816
503 2513956419 2513237150 Bacteria 6553639
504 2514041519 2513237165 Bacteria 6771773
505 2547374326 2547132103 Bacteria 5115736
506 2548849143 2547132512 Bacteria 3416496
507 2585296090 2582581312 Bacteria 7308206
508 2585306160 2582581313 Bacteria 10042643
509 2585316078 2582581314 Bacteria 11452267
510 2597031968 2596583598 Bacteria 5251611
511 2599444087 2599185178 Bacteria 5365746
512 2601668145 2600255292 Bacteria 6300551
513 2616903068 2616644941 Bacteria 8510691
514 2643745898 2643221544 Bacteria 5886209
515 2643935239 2643221585 Bacteria 5812563
516 2643941826 2643221587 Bacteria 7586415
517 2644014864 2643221601 Bacteria 7493239
518 2644035148 2643221604 Bacteria 5014917
519 2644101297 2643221617 Bacteria 5139111
520 2644119297 2643221620 Bacteria 5134593
521 2644176299 2643221631 Bacteria 8168043
522 2644221903 2643221639 Bacteria 6649903
523 2644231776 2643221641 Bacteria 4490190
524 2644257301 2643221646 Bacteria 6433402
525 2644314863 2643221656 Bacteria 5809961
526 2644361719 2643221665 Bacteria 4699229
527 2644428909 2643221677 Bacteria 7584031
528 2644438682 2643221678 Bacteria 9540101
529 2738868926 2738541305 Bacteria 4910150
530 2739055118 2738541337 Bacteria 6183410
531 2740165394 2739367898 Bacteria 4367674
532 2745160028 2744054655 Bacteria 3552603
533 2745161652 2744054655 Bacteria 3552603
534 2785341676 2784746763 Bacteria 9783172
535 2785370991 2784746768 Bacteria 10036182
536 2786672188 2786546132 Bacteria 10419719
537 2808848785 2808606359 Bacteria 9866990
538 2808913109 2808606375 Bacteria 9466072
539 2811844909 2808606982 Bacteria 7791042
540 2812330378 2811994874 Bacteria 5367947
541 2812356504 2811994879 Bacteria 9313447
542 2834645023 2834641062 Bacteria 5559922
543 2843694812 2843690924 Bacteria 5169057
544 2846033718 2846033681 Bacteria 4377894
545 2846040261 2846037992 Bacteria 4526407
546 2852640180 2852635781 Bacteria 8251373
547 2857550379 2857547612 Bacteria 6179999
548 2858695242 2858688981 Bacteria 8184122
549 2861521800 2861520306 Bacteria 8348283
550 2862287207 2862281513 Bacteria 9621493
551 2862293396 2862290372 Bacteria 7471434
552 2862384082 2862382967 Bacteria 10317375
553 2862512057 2862507626 Bacteria 9425308
554 2862577981 2862574272 Bacteria 10567477
555 2863411356 2863404153 Bacteria 9672205
556 2867435204 2867428634 Bacteria 9590268
557 2873154539 2873151551 Bacteria 8625867
558 2875396200 2875391855 Bacteria 7600475
559 2877679586 2877676314 Bacteria 9512378
560 2884695862 2884693830 Bacteria 11273186
561 2885081797 2885080285 Bacteria 6355622
562 2885269881 2885266251 Bacteria 4796748
563 2887481910 2887478801 Bacteria 8972725
564 2891400959 2891395885 Bacteria 9251614
565 2891558662 2891554331 Bacteria 8812224
566 2891634418 2891633521 Bacteria 4602265
567 2895438934 2895427314 Bacteria 13147766
568 2895445424 2895442618 Bacteria 11027144
569 2900579348 2900577576 Bacteria 5438534
570 2918505989 2918501144 Bacteria 8668083
571 2919469159 2919468124 Bacteria 9133025
572 2919692129 2919688452 Bacteria 4595932
573 2928062310 2928058823 Bacteria 5520022
574 2928517107 2928515477 Bacteria 4448421
575 2932411851 2932410948 Bacteria 6312192
576 2932418582 2932416698 Bacteria 6315112
577 2935391863 2935390628 Bacteria 7043367
578 2939605330 2939602548 Bacteria 4950493
579 2946069359 2946064051 Bacteria 8957905
580 2954384499 2954380949 Bacteria 10050426
581 2954678465 2954673503 Bacteria 9685905
582 2954685690 2954682443 Bacteria 9862841
583 2954695356 2954691527 Bacteria 10720516
584 2954710547 2954701450 Bacteria 10834262
585 2954714792 2954711539 Bacteria 10867210
586 2954724737 2954721474 Bacteria 10456478
587 2954743661 2954740390 Bacteria 10229294
588 2954762614 2954759201 Bacteria 9358192
589 2995471378 2995463766 Bacteria 8577691
590 2998345725 2998344455 Bacteria 4222996
591 3006399110 3006393351 Bacteria 6615579
592 644748299 644736347 Bacteria 6476522
593 8001781803 8001781756 Bacteria 9586736
594 8001788840 8001781756 Bacteria 9586736
595 8003401409 8003400568 Bacteria 5535898
596 8008566756 8008558824 Bacteria 10610750
597 8008577617 8008574985 Bacteria 7815457
598 8033234578 8033232454 Bacteria 3202805
599 8048412228 8048406513 Bacteria 8936924
600 8055173736 8055172936 Bacteria 9305943
601 8057572345 8057568493 Bacteria 7221719
602 Ga0495683_0032650
603 JGI24741J21665_1000679
604 JGI24740J21852_10029859
605 JGI24740J21852_10030041
606 JGI25156J39149_1018101
607 JGI25156J39149_1024588
608 JGI25154J39366_1000136
609 JGI25151J46595_10004611
610 JGI25151J46595_10026146
611 JGI25151J46595_10035285
612 JGI25153J46596_10054376
613 rootH1_10007098
614 rootH1_10037411
615 rootH1_10054269
616 JGI25160J50197_1020461
617 Ga0006562J51391_1026270
618 Ga0006562J51391_1041146
619 Ga0055539_1000061
620 Ga0055532_1000042
621 Ga0055525_1000480
622 Ga0055525_1000616
623 Ga0055527_1000169
624 Ga0055535_1000031
625 Ga0055542_1001292
626 Ga0055529_1000075
627 Ga0055526_1026693
628 Ga0055524_1002307
629 Ga0055524_1008846
630 Ga0055536_1000108
631 Ga0055534_1010636
632 Ga0055531_10000011
633 Ga0055541_1002919
634 Ga0055541_1015165
635 Ga0058692_1000025
636 Ga0058692_1001325
637 Ga0070683_100003993
638 Ga0070680_100082043
639 Ga0070682_100213578
640 Ga0070661_100002111
641 Ga0070661_100407762
642 Ga0070659_100028665
643 Ga0070709_10025818
644 Ga0070663_100000086
645 Ga0070684_100004378
646 Ga0070684_100256708
647 Ga0070664_100000210
648 Ga0068857_100323692
649 Ga0068854_100000176
650 Ga0068856_100000539
651 Ga0068856_100813534
652 Ga0068852_100293395
653 Ga0081539_10000709
654 Ga0075363_100152709
655 Ga0075364_10043348
656 Ga0075367_10390260
657 Ga0075366_10002780
658 Ga0075366_10060088
659 Ga0075370_10077364
660 Ga0075370_10344754
661 Ga0075430_100136085
662 Ga0075431_100077526
663 Ga0099826_10000029
664 Ga0105251_10018652
665 Ga0105251_10035794
666 Ga0105251_10145367
667 Ga0105244_10000076
668 Ga0105240_10454623
669 Ga0111539_11030966
670 Ga0105245_10100173
671 Ga0114129_10377697
672 Ga0105243_10288804
673 Ga0105243_11016140
674 Ga0105249_10004632
675 Ga0105239_10195606
676 Ga0105246_10245508
677 Ga0157373_10129255
678 Ga0157371_10006566
679 Ga0157369_10007469
680 Ga0157369_10596192
681 Ga0157372_10006060
682 Ga0157372_10017379
683 Ga0157372_10034019
684 Ga0157372_11297528
685 Ga0182008_10000119
686 Ga0182006_1000067
687 Ga0182007_10000123
688 Ga0182005_1000002
689 Ga0163161_10020619
690 Ga0163161_10550756
691 Ga0206352_10334922
692 Ga0206353_10552251
693 Ga0213872_10001107
694 Ga0213872_10006231
695 Ga0213872_10088999
696 Ga0209784_100003
697 Ga0209784_100686
698 Ga0209566_100002
699 Ga0209566_100330
700 Ga0209566_102470
701 Ga0209674_100094
702 Ga0209674_104116
703 Ga0209672_100096
704 Ga0209147_100002
705 Ga0209563_100004
706 Ga0209258_100002
707 Ga0209646_1000019
708 Ga0209026_1011832
709 Ga0209677_100071
710 Ga0209148_1000118
711 Ga0209759_1004997
712 Ga0209759_1012625
713 Ga0209565_1000084
714 Ga0209565_1010070
715 Ga0209455_1000009
716 Ga0209673_1034247
717 Ga0209130_1006165
718 Ga0209675_1000464
719 Ga0209676_1000012
720 Ga0209025_1000214
721 Ga0209025_1001025
722 Ga0209025_1007952
723 Ga0209025_1032342
724 Ga0209564_1022535
725 Ga0209564_1025321
726 Ga0209564_1026027
727 Ga0209758_1006507
728 Ga0209758_1023388
729 Ga0209050_1009066
730 Ga0209256_1000468
731 Ga0209256_1001006
732 Ga0207426_1004524
733 Ga0207426_1008470
734 Ga0207426_1016632
735 Ga0209051_1002325
736 Ga0209051_1012366
737 Ga0209257_1000017
738 Ga0207655_1000030
739 Ga0207655_1001093
740 Ga0207655_1001907
741 Ga0207713_1032021
742 Ga0207699_10021514
743 Ga0207695_10003065
744 Ga0207695_10483383
745 Ga0207660_10402059
746 Ga0207690_10001107
747 Ga0207709_10744361
748 Ga0207704_10345353
749 Ga0207661_10000747
750 Ga0207679_10000240
751 Ga0207679_10014167
752 Ga0207712_10004502
753 Ga0207640_10000049
754 Ga0207678_10000353
755 Ga0207702_10000550
756 Ga0207702_10715809
757 Ga0207641_10098511
758 Ga0207674_10283821
759 Ga0209371_1000036
760 Ga0209371_1002657
761 Ga0209371_1011550
762 Ga0209282_1001593
763 Ga0268266_11082022
764 Ga0307517_10002842
765 Ga0307515_10000497
766 Ga0307515_10054430
767 Ga0307515_10088171
768 Ga0307515_10234736
769 Ga0265338_10285782
770 Ga0268256_1000040
771 Ga0268256_1002353
772 Ga0307511_10000238
773 Ga0307512_10015539
774 Ga0265332_10000013
775 Ga0265325_10057382
776 Ga0265327_10122603
777 Ga0265316_10290426
778 Ga0307513_10069290
779 Ga0307509_10013379
780 Ga0307509_10020287
781 Ga0307509_10033994
782 Ga0307408_100000114
783 Ga0307508_10016710
784 Ga0307514_10006271
785 Ga0307514_10079711
786 Ga0307514_10114363
787 Ga0307514_10154087
788 Ga0307516_10003058
789 Ga0307516_10018858
790 Ga0307518_10114000
791 Ga0307410_10322209
792 Ga0307410_10364955
793 Ga0307406_10173533
794 Ga0307414_10004465
795 Ga0307414_10209347
796 Ga0307411_10000823
797 Ga0307507_10117085
798 Ga0307510_10004320
799 Ga0307510_10007211
800 Ga0307510_10015697
801 Ga0373948_0010565
802 Ga0373940_0008308
803 Ga0373939_0000029
804 Ga0373960_0002621
805 Ga0373931_0008333
806 Ga0395900_0066377
807 Ga0395900_0079576
808 Ga0395900_0097583
809 Ga0395900_0388450
810 Ga0395898_0028535
811 Ga0395905_0001795
812 Ga0395905_0087003
813 Ga0395901_0225283
814 Ga0395901_0305528
815 Ga0436361_0007228
816 Ga0436361_0028828
817 Ga0436361_0505573
818 Ga0436361_0662050
819 Ga0436361_0802016
820 Ga0436361_0921973
821 Ga0436361_0922237
822 Ga0439436_0003137
823 Ga0439439_0001872
824 Ga0439439_0004865
825 Ga0451837_1229693
826 Ga0451843_1180629
827 Ga0451853_0516285
828 Ga0451853_0887708
829 Ga0439433_0001405
830 Ga0439449_0014625
831 Ga0439449_0037525
832 Ga0439455_0000348
833 Ga0439457_001796
834 Ga0439457_018010
835 Ga0450917_000376
836 Ga0450888_000028
837 Ga0450890_003595
838 Ga0450891_000149
839 Ga0450892_000225
840 Ga0450894_000045
841 Ga0450896_009320
842 Ga0450899_000042
843 Ga0450900_012816
844 Ga0450903_000542
845 Ga0450903_010568
846 Ga0450906_003844
847 Ga0439458_0001470
848 Ga0439459_0054317
849 Ga0450893_0001575
850 Ga0451577_0149432
851 Ga0451577_0288609
852 Ga0451577_0679423
853 Ga0466969_0026071
854 Ga0466969_0074981
855 Ga0466972_0080702
856 Ga0466977_0008418
857 Ga0453683_0064929
858 Ga0466965_0137220
859 Ga0466966_0039685
860 Ga0466966_0173147
861 Ga0466961_0000765
862 Ga0466961_0014177
863 Ga0466961_0145682
864 Ga0466961_0206610
865 Ga0466961_0320073
866 Ga0466963_0068156
867 Ga0466963_0363597
868 Ga0466964_0100956
869 Ga0453684_0000657
870 Ga0453684_0000826
871 Ga0453684_0027032
872 Ga0453684_0916520
873 Ga0466971_0019939
874 Ga0466971_0226851
875 Ga0466970_0006415
876 Ga0466970_0008543
877 Ga0466970_0034858
878 Ga0466970_0165540
879 Ga0466957_0382457
880 Ga0466959_0004532
881 Ga0466959_0122595
882 Ga0451576_0003274
883 Ga0451576_0015862
884 Ga0451576_0280189
885 Ga0451576_0560495
886 Ga0466958_0067631
887 Ga0466958_0491299
888 Ga0466967_0016519
889 Ga0466967_0057144
890 Ga0466967_0903863
891 Ga0495592_0037407
892 Ga0495592_0185898
893 Ga0495603_0007330
894 Ga0495603_0007840
895 Ga0495603_0033176
896 Ga0495603_0069558
897 Ga0495590_0123847
898 Ga0495629_0007540
899 Ga0495629_0008794
900 Ga0495629_0030418
901 Ga0495629_0134359
902 Ga0495629_0270034
903 Ga0495638_0051398
904 Ga0495651_0033152
905 Ga0495651_0177013
906 Ga0495653_0070603
907 Ga0495650_0000056
908 Ga0495650_0002634
909 Ga0495580_0055666
910 Ga0495605_0033687
911 Ga0495605_0095038
912 Ga0495662_0001795
913 Ga0495662_0004825
914 Ga0495662_0009839
915 Ga0495662_0010977
916 Ga0495662_0028001
917 Ga0495584_0122503
918 Ga0495585_0164829
919 Ga0495594_0009975
920 Ga0495594_0011844
921 Ga0495594_0030329
922 Ga0495596_0023925
923 Ga0495607_0089016
924 Ga0495606_0001978
925 Ga0495608_0075832
926 Ga0495610_0039594
927 Ga0495616_0042417
928 Ga0495618_0212259
929 Ga0495628_0065534
930 Ga0495630_0118545
931 Ga0495630_0240170
932 Ga0495643_0078160
933 Ga0495648_0231871
934 Ga0495666_0001499
935 Ga0495652_0058218
936 Ga0495665_0012858
937 Ga0495586_0217432
938 Ga0495587_0001425
939 Ga0495609_0038915
940 Ga0495645_0009259
941 Ga0495645_0044479
942 Ga0495645_0147370
943 Ga0495633_0001151
944 Ga0495667_0023067
945 Ga0495656_0142997
946 Ga0495668_0000103
947 Ga0495634_0002605
948 Ga0495634_0137943
949 Ga0495625_0000643
950 Ga0495625_0013459
951 Ga0495625_0383906
952 Ga0495635_0005300
953 Ga0495661_0051196
954 Ga0495661_0094528
955 Ga0495588_0027301
956 Ga0495588_0030163
957 Ga0495588_0205182
958 Ga0495657_0004044
959 Ga0495657_0061541
960 Ga0495623_0099321
961 Ga0495623_0195779
962 Ga0495646_0011392
963 Ga0495646_0014474
964 Ga0495658_0020216
965 Ga0495669_0265186
966 Ga0495613_0024695
967 Ga0495613_0085682
968 Ga0495670_0017680
969 Ga0495671_0040339
970 Ga0495671_0130589
971 Ga0495671_0351320
972 Ga0495649_0079256
973 Ga0495589_0011121
974 Ga0495589_0120458
975 Ga0495589_0168587
976 Ga0495600_0021500
977 Ga0495600_0307741
978 Ga0495581_0005898
979 Ga0495581_0036491
980 Ga0495604_0000264
981 Ga0495604_0000590
982 Ga0495604_0020111
983 Ga0495636_0004733
984 Ga0495636_0011296
985 Ga0495636_0021870
986 Ga0495674_0602085
987 Ga0495676_0013764
988 Ga0495676_0036088
989 Ga0495683_0034182
990 Ga0495683_0101669
991 Ga0495687_002653
992 Ga0495687_036832
993 Ga0495687_173310
994 Ga0495675_0009963
995 Ga0495675_0278198
996 Ga0495685_002027
997 Ga0495685_003406
998 Ga0495685_005251
999 Ga0495685_010802
1000 Ga0495685_101466
1001 Ga0495681_0000442
1002 Ga0495681_0025275
1003 Ga0495684_0058636
1004 Ga0495684_0071566
1005 Ga0495686_0057500
1006 Ga0495686_0073026
1007 Ga0495593_0035696
1008 Ga0495602_0086611
1009 Ga0495602_0089577
1010 Ga0495614_0003037
1011 Ga0495614_0020431
1012 Ga0495614_0080362
1013 Ga0495626_0000197
1014 Ga0496102_0167677
1015 Ga0496104_0393896
1016 Ga0496104_0581793
1017 Ga0496109_0025467
1018 Ga0496111_0371751
1019 Ga0496116_0002105
1020 Ga0496116_0075488
1021 Ga0496116_0080291
1022 Ga0496117_0000001
1023 Ga0496118_0000002
1024 Ga0496119_0003104
1025 Ga0496120_0000028
1026 Ga0496121_0006753
1027 Ga0496121_0013269
1028 Ga0496121_0193629
1029 Ga0496122_0001676
1030 Ga0496122_0085638
1031 Ga0496123_0002807
1032 Ga0496123_0067793
1033 Ga0496124_0001246
1034 Ga0496124_0058684
1035 Ga0496125_0214382
1036 Ga0496125_0305834
1037 Ga0496126_0045207
1038 Ga0501309_007469
1039 Ga0501310_003134
1040 Ga0495678_005338
1041 Ga0495678_018990
1042 Ga0495682_0003131
1043 Ga0501294_002385
1044 Ga0501300_003939
1045 Ga0501031_0007119
1046 Ga0501032_0012805
1047 Ga0501032_0208143
1048 Ga0501033_0002135
1049 Ga0501033_0141413
1050 Ga0501033_0208126
1051 Ga0501033_0403142
1052 Ga0501034_0001049
1053 Ga0501034_0147089
1054 Ga0501034_0147508
1055 Ga0501034_0983704
1056 Ga0501036_0000576
1057 Ga0501036_0021103
1058 Ga0501036_0393124
1059 Ga0501037_0009522
1060 Ga0501037_0139961
1061 Ga0501037_0268865
1062 Ga0501038_0006067
1063 Ga0501038_0195117
1064 Ga0501039_0093817
1065 Ga0501040_0829734
1066 Ga0501043_0003457
1067 Ga0501043_0570764
1068 Ga0501046_0015957
1069 Ga0501047_0011643
1070 Ga0501071_0236477
1071 Ga0501075_0633400
1072 Ga0501202_051415
1073 Ga0501217_083728
1074 Ga0501235_009196
1075 Ga0501258_011087
1076 Ga0501221_000105
1077 Ga0501262_007915
1078 Ga0501265_040925
1079 Ga0501267_003397
1080 Ga0501272_000243
1081 Ga0501283_026424
1082 Ga0501035_0007650
1083 Ga0501035_0050113
1084 Ga0501035_0415271
1085 Ga0501044_0002016
1086 Ga0501044_0008136
1087 Ga0501045_0097017
1088 nmdc:mga00v17_294249_c1
1089 nmdc:mga0k408_1230_c1
1090 nmdc:mga0k408_4433_c1
1091 nmdc:mga07m45_82083_c1
1092 nmdc:mga0qj67_126676_c1
1093 nmdc:mga06r32_131566_c1
1094 Ga0495619_0098691
1095 Ga0500640_061984
1096 Ga0500560_059194
1097 Ga0500614_010439
1098 Ga0500559_0190818
1099 Ga0500573_0146753
1100 Ga0500586_119098
1101 Ga0500600_0086445
1102 Ga0501082_0428053
1103 Ga0466962_0025883
1104 2513956419
1105 2514041519
1106 2547374326
1107 2548849143
1108 2585296090
1109 2585306160
1110 2585316078
1111 2597031968
1112 2599444087
1113 2601668145
1114 2616903068
1115 2643745898
1116 2643935239
1117 2643941826
1118 2644014864
1119 2644035148
1120 2644101297
1121 2644119297
1122 2644176299
1123 2644221903
1124 2644231776
1125 2644257301
1126 2644314863
1127 2644361719
1128 2644428909
1129 2644438682
1130 2738868926
1131 2739055118
1132 2740165394
1133 2745160028
1134 2745161652
1135 2785341676
1136 2785370991
1137 2786672188
1138 2808848785
1139 2808913109
1140 2811844909
1141 2812330378
1142 2812356504
1143 2834645023
1144 2843694812
1145 2846033718
1146 2846040261
1147 2852640180
1148 2857550379
1149 2858695242
1150 2861521800
1151 2862287207
1152 2862293396
1153 2862384082
1154 2862512057
1155 2862577981
1156 2863411356
1157 2867435204
1158 2873154539
1159 2875396200
1160 2877679586
1161 2884695862
1162 2885081797
1163 2885269881
1164 2887481910
1165 2891400959
1166 2891558662
1167 2891634418
1168 2895438934
1169 2895445424
1170 2900579348
1171 2918505989
1172 2919469159
1173 2919692129
1174 2928062310
1175 2928517107
1176 2932411851
1177 2932418582
1178 2935391863
1179 2939605330
1180 2946069359
1181 2954384499
1182 2954678465
1183 2954685690
1184 2954695356
1185 2954710547
1186 2954714792
1187 2954724737
1188 2954743661
1189 2954762614
1190 2995471378
1191 2998345725
1192 3006399110
1193 644748299
1194 8001781803
1195 8001788840
1196 8003401409
1197 8008566756
1198 8008577617
1199 8033234578
1200 8048412228
1201 8055173736
1202 8057572345

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01810

LysE

LysE type translocator

42

246

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
7vcf-assembly1.cif.gz_A cryo-em structure of chlamydomonas toc-tic supercomplex 0.4553 14 194
5vkv-assembly1.cif.gz_A solution nmr structure of the membrane electron transporter ccda 0.4135 17 200
7vcf-assembly1.cif.gz_A cryo-em structure of chlamydomonas toc-tic supercomplex 0.3772 14 194
5f4y-assembly1.cif.gz_A structure of the sd2 domain of human shroom2 0.3354 36 189
5f5p-assembly1.cif.gz_A molecular basis for shroom2 recognition by rock1 0.3187 32 192
ID Description Score Start End Superfamily
af_Q10320_1_287_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4592 14 193 1.20.1250.20
af_Q2R4J1_1_279_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4546 16 191 1.20.1250.20
af_Q6P2T9_1_103_1.20.120.350 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Voltage-gated potassium channels. Chain C 0.4519 78 191 1.20.120.350
af_Q9P7Q0_1_262_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4287 3 193 1.20.1250.20
af_Q6P2T9_1_103_1.20.120.350 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Voltage-gated potassium channels. Chain C 0.415 78 191 1.20.120.350
ID Description Score Start End GO Terms
AF-A0A6H0CX50-F1-model_v4 Leucine efflux protein LeuE 0.9373 9 221 GO:0005886
GO:0015190
GO:0015820
AF-A0A1G7VGT7-F1-model_v4 Leucine efflux protein 0.9372 8 220 GO:0005886
GO:0015190
GO:0015820
AF-P38102-F1-model_v4 Uncharacterized membrane protein PA4757 0.9348 9 224 GO:0005886
GO:0015190
GO:0015820
AF-A0A5M3XKK9-F1-model_v4 Leucine efflux protein 0.9234 8 220 GO:0005886
GO:0015190
GO:0015820
AF-A0A3N0D5H8-F1-model_v4 Leucine efflux protein LeuE 0.9218 9 220 GO:0005886
GO:0015190
GO:0015820

Map