F468205

General Info

Members Datasets Scaffolds Average Seq Length
602 311 1204 234

Family's Representative Sequence

Representative Sequence 3300046513|Ga0495616_0053522|Ga0495616_0053522_276_1127
Length 283
Sequence LAASYCARFIGQALQNLIEFFDHRPQNYSFFLPSPSRYTGLHRENNKERIMLEVRKSEERGQAHHGWLQSQHSFSFADYYDPRHVGYGPLRVINEDRVAPGGGFGTHGHRDMEIISYVLDGALEHKDSMGTGSVLHYGDVQRMSAGSGVRHSEFNGSKTDPVHFLQIWIQPNQQGIAPSYEEKHFPLEDKQGKLRLIASGDGREGSVLIHQDASLYAAILDGDDGAEHTLGAGRLGYVHVIRGQVEVNGVALKGGDAVKIEEEDHVRFTGAKAVELLLFDLPQ

Samples

Sample ID Description Type Environment
1 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
2 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
83 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
84 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300029277 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctcc.R1 Metatranscriptome Rhizosphere
140 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
141 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
142 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
143 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
144 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
145 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
146 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
147 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
148 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
149 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
150 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
151 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
152 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
153 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
154 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
155 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
156 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
157 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
158 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
159 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
160 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
161 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
162 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
163 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
164 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
165 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
166 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
167 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
168 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
169 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
171 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
172 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
173 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
174 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
175 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
176 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
177 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
178 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
179 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
180 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
181 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
182 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
183 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
184 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
185 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
186 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
187 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
188 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
189 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
190 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
191 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
192 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
193 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
194 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
195 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
196 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
197 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
198 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
199 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
200 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
201 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
202 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
203 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
204 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
205 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
206 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
207 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
208 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
209 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
210 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
211 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
212 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
213 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
214 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
215 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
216 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
217 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
218 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
219 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
220 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
221 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
222 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
223 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
224 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
225 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
226 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
227 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
228 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
229 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
230 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
231 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
232 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
233 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
234 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
235 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
236 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
237 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
238 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
239 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
240 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
241 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
242 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
243 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
244 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
245 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
246 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
247 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
248 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
249 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
250 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
251 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
252 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
253 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
254 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
255 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
256 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
257 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
258 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
259 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
260 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
261 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
262 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
263 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
264 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
265 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
266 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
267 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
268 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
269 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
270 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
271 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
272 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
273 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
274 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
275 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
276 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
277 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
278 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
283 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
284 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
285 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
286 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
287 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
288 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
289 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
290 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
291 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
292 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
293 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
294 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
295 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
296 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
297 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
298 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
299 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
300 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
301 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
302 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
303 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
304 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
305 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
306 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
307 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
308 2643221556 Massilia sp. Root1485 Isolate Unclassified
309 2643221645 Massilia sp. Root351 Isolate Unclassified
310 2643221684 Massilia sp. Root133 Isolate Unclassified
311 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.17
Metatranscriptomes 1.16
Isolates 0.66

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.66
Nodule 0
Rhizoplane 3.49
Rhizosphere 93.02
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495616_0053522 3300046513 Bacteria 2005
2 Ga0006777J48905_1134701 3300003308 Bacteria 800
3 rootL2_10005622 3300003322 Bacteria 27902
4 Ga0007417J51691_1028844 3300003544 Bacteria 839
5 Ga0007410J51695_1043264 3300003574 Bacteria 828
6 Ga0055543_1008850 3300004625 Bacteria 2201
7 Ga0065165_1000156 3300005262 Bacteria 119261
8 Ga0065165_1001173 3300005262 Bacteria 30458
9 Ga0065715_10118230 3300005293 Bacteria 2322
10 Ga0070658_10283787 3300005327 Bacteria 1410
11 Ga0070658_10755037 3300005327 Bacteria 845
12 Ga0070676_10013004 3300005328 Bacteria 4560
13 Ga0070676_10013531 3300005328 Bacteria 4472
14 Ga0070683_100061288 3300005329 Bacteria 3498
15 Ga0070677_10008560 3300005333 Bacteria 3447
16 Ga0070666_10277634 3300005335 Bacteria 1190
17 Ga0070660_100007080 3300005339 Bacteria 7793
18 Ga0070660_100200778 3300005339 Bacteria 1617
19 Ga0070660_100227357 3300005339 Bacteria 1517
20 Ga0070689_100001052 3300005340 Bacteria 17337
21 Ga0070687_100045158 3300005343 Bacteria 2248
22 Ga0070661_100003142 3300005344 Bacteria 11359
23 Ga0070661_100005513 3300005344 Bacteria 8723
24 Ga0070661_100375385 3300005344 Bacteria 1120
25 Ga0070692_10189394 3300005345 Bacteria 1197
26 Ga0070668_100084928 3300005347 Bacteria 2487
27 Ga0070669_100004842 3300005353 Bacteria 9715
28 Ga0070669_100132044 3300005353 Bacteria 1917
29 Ga0070675_100275506 3300005354 Bacteria 1477
30 Ga0070671_100127427 3300005355 Bacteria 2143
31 Ga0070671_100191106 3300005355 Bacteria 1735
32 Ga0070674_100033150 3300005356 Bacteria 3436
33 Ga0070674_100045586 3300005356 Bacteria 2996
34 Ga0070673_100064782 3300005364 Bacteria 2912
35 Ga0070688_100059715 3300005365 Bacteria 2406
36 Ga0070659_100014092 3300005366 Bacteria 5967
37 Ga0070659_100038200 3300005366 Bacteria 3744
38 Ga0070659_100140829 3300005366 Bacteria 1964
39 Ga0070694_100176390 3300005444 Bacteria 1578
40 Ga0070663_100054860 3300005455 Bacteria 2850
41 Ga0070663_100091278 3300005455 Bacteria 2257
42 Ga0070662_100001925 3300005457 Bacteria 12756
43 Ga0070662_100515639 3300005457 Bacteria 998
44 Ga0070681_10154428 3300005458 Bacteria 2221
45 Ga0068867_100001711 3300005459 Bacteria 15285
46 Ga0068867_100567231 3300005459 Bacteria 985
47 Ga0070685_10003882 3300005466 Bacteria 7559
48 Ga0070707_100235396 3300005468 Bacteria 1782
49 Ga0070707_100294762 3300005468 Bacteria 1576
50 Ga0068853_100014010 3300005539 Bacteria 6561
51 Ga0068853_100015987 3300005539 Bacteria 6170
52 Ga0068853_100090053 3300005539 Bacteria 2696
53 Ga0068853_100468826 3300005539 Bacteria 1186
54 Ga0070672_100044821 3300005543 Bacteria 3418
55 Ga0070672_100132850 3300005543 Bacteria 2047
56 Ga0070672_100209194 3300005543 Bacteria 1633
57 Ga0070672_100209195 3300005543 Bacteria 1633
58 Ga0070672_100613505 3300005543 Bacteria 948
59 Ga0070686_100042258 3300005544 Bacteria 2854
60 Ga0070695_100018431 3300005545 Bacteria 4240
61 Ga0070696_100252591 3300005546 Bacteria 1334
62 Ga0070665_100016480 3300005548 Bacteria 7410
63 Ga0070704_100081732 3300005549 Bacteria 2381
64 Ga0068855_100000068 3300005563 Bacteria 124575
65 Ga0068855_100008552 3300005563 Bacteria 12372
66 Ga0068855_100023030 3300005563 Bacteria 7465
67 Ga0068855_100346632 3300005563 Bacteria 1637
68 Ga0070664_100028732 3300005564 Bacteria 4629
69 Ga0070664_100131783 3300005564 Bacteria 2196
70 Ga0070664_100407802 3300005564 Bacteria 1243
71 Ga0068854_100045905 3300005578 Bacteria 3108
72 Ga0068856_100000181 3300005614 Bacteria 65631
73 Ga0068852_100102756 3300005616 Bacteria 2583
74 Ga0068859_100020248 3300005617 Bacteria 6678
75 Ga0068859_100432758 3300005617 Bacteria 1412
76 Ga0068864_100010007 3300005618 Bacteria 7826
77 Ga0068866_10057609 3300005718 Bacteria 2003
78 Ga0068861_100004408 3300005719 Bacteria 9432
79 Ga0068861_100222406 3300005719 Bacteria 1596
80 Ga0068851_10033082 3300005834 Bacteria 2575
81 Ga0068870_10014284 3300005840 Bacteria 3750
82 Ga0068870_10031964 3300005840 Bacteria 2670
83 Ga0068863_100123501 3300005841 Bacteria 2470
84 Ga0068858_100019450 3300005842 Bacteria 6351
85 Ga0068860_100134569 3300005843 Bacteria 2373
86 Ga0068860_100501551 3300005843 Bacteria 1212
87 Ga0068862_100008611 3300005844 Bacteria 8440
88 Ga0070716_100233933 3300006173 Bacteria 1242
89 Ga0075367_10130353 3300006178 Bacteria 1554
90 Ga0097621_100177020 3300006237 Bacteria 1841
91 Ga0068871_100454979 3300006358 Bacteria 1148
92 Ga0075428_100008854 3300006844 Bacteria 11165
93 Ga0075430_100033965 3300006846 Bacteria 4328
94 Ga0075430_100064131 3300006846 Bacteria 3086
95 Ga0075430_100089951 3300006846 Bacteria 2568
96 Ga0075429_100080541 3300006880 Bacteria 2839
97 Ga0068865_100015443 3300006881 Bacteria 4870
98 Ga0068865_100148732 3300006881 Bacteria 1774
99 Ga0097620_100020248 3300006931 Bacteria 6678
100 Ga0097620_100432740 3300006931 Bacteria 1412
101 Ga0111539_10063522 3300009094 Bacteria 4369
102 Ga0111539_10165559 3300009094 Bacteria 2585
103 Ga0111539_10247938 3300009094 Bacteria 2074
104 Ga0105241_10432856 3300009174 Bacteria 1160
105 Ga0105237_10162351 3300009545 Bacteria 2233
106 Ga0157373_10050969 3300013100 Bacteria 2947
107 Ga0157373_10157378 3300013100 Bacteria 1598
108 Ga0157371_10036801 3300013102 Bacteria 3505
109 Ga0157370_10035249 3300013104 Bacteria 4866
110 Ga0157370_10406970 3300013104 Bacteria 1252
111 Ga0157369_10011852 3300013105 Bacteria 9902
112 Ga0157369_10315825 3300013105 Bacteria 1624
113 Ga0157369_10497438 3300013105 Bacteria 1261
114 Ga0157374_10052046 3300013296 Bacteria 3812
115 Ga0157374_10854038 3300013296 Bacteria 927
116 Ga0157378_10223429 3300013297 Bacteria 1791
117 Ga0157372_10000481 3300013307 Bacteria 44095
118 Ga0157372_10080705 3300013307 Bacteria 3681
119 Ga0157372_10157395 3300013307 Bacteria 2625
120 Ga0157372_10225302 3300013307 Bacteria 2173
121 Ga0157375_10124906 3300013308 Bacteria 2687
122 Ga0163163_10002938 3300014325 Bacteria 14431
123 Ga0163163_10069714 3300014325 Bacteria 3501
124 Ga0157380_10025234 3300014326 Bacteria 4506
125 Ga0157380_10048236 3300014326 Bacteria 3353
126 Ga0157377_10002681 3300014745 Bacteria 7901
127 Ga0157379_10056462 3300014968 Bacteria 3508
128 Ga0157379_10062051 3300014968 Bacteria 3343
129 Ga0157376_10431472 3300014969 Bacteria 1281
130 Ga0209148_1000280 3300025254 Bacteria 78989
131 Ga0209130_1000268 3300025284 Bacteria 65115
132 Ga0207426_1007139 3300025302 Bacteria 4717
133 Ga0207697_10002035 3300025315 Bacteria 10675
134 Ga0207682_10008838 3300025893 Bacteria 3985
135 Ga0207692_10147638 3300025898 Bacteria 1344
136 Ga0207642_10006785 3300025899 Bacteria 3829
137 Ga0207688_10003028 3300025901 Bacteria 9157
138 Ga0207680_10010024 3300025903 Bacteria 4723
139 Ga0207645_10004453 3300025907 Bacteria 10373
140 Ga0207645_10122646 3300025907 Bacteria 1688
141 Ga0207643_10011553 3300025908 Bacteria 4770
142 Ga0207707_10208067 3300025912 Bacteria 1705
143 Ga0207671_10128332 3300025914 Bacteria 1944
144 Ga0207662_10013247 3300025918 Bacteria 4610
145 Ga0207657_10006281 3300025919 Bacteria 12350
146 Ga0207657_10020569 3300025919 Bacteria 6232
147 Ga0207657_10052623 3300025919 Bacteria 3532
148 Ga0207657_10177349 3300025919 Bacteria 1724
149 Ga0207649_10007766 3300025920 Bacteria 5834
150 Ga0207652_10339136 3300025921 Bacteria 1357
151 Ga0207646_10113148 3300025922 Bacteria 2436
152 Ga0207646_10412921 3300025922 Bacteria 1219
153 Ga0207681_10002320 3300025923 Bacteria 12099
154 Ga0207681_10067033 3300025923 Bacteria 2487
155 Ga0207650_10002733 3300025925 Bacteria 12179
156 Ga0207659_10038350 3300025926 Bacteria 3332
157 Ga0207659_10124352 3300025926 Bacteria 1981
158 Ga0207644_10095849 3300025931 Bacteria 2219
159 Ga0207644_10171599 3300025931 Bacteria 1693
160 Ga0207690_10002028 3300025932 Bacteria 12417
161 Ga0207706_10000074 3300025933 Bacteria 103144
162 Ga0207706_10013695 3300025933 Bacteria 7360
163 Ga0207670_10010089 3300025936 Bacteria 5423
164 Ga0207669_10018487 3300025937 Bacteria 3605
165 Ga0207704_10010144 3300025938 Bacteria 4578
166 Ga0207665_10416579 3300025939 Bacteria 1025
167 Ga0207691_10033608 3300025940 Bacteria 4775
168 Ga0207691_10076932 3300025940 Bacteria 3007
169 Ga0207691_10234037 3300025940 Bacteria 1590
170 Ga0207711_10068327 3300025941 Bacteria 3077
171 Ga0207689_10001435 3300025942 Bacteria 22775
172 Ga0207661_10040127 3300025944 Bacteria 3678
173 Ga0207679_10023599 3300025945 Bacteria 4208
174 Ga0207679_10362461 3300025945 Bacteria 1266
175 Ga0207667_10000057 3300025949 Bacteria 202301
176 Ga0207667_10013194 3300025949 Bacteria 9472
177 Ga0207667_10069904 3300025949 Bacteria 3655
178 Ga0207651_10032167 3300025960 Bacteria 3366
179 Ga0207651_10407190 3300025960 Bacteria 1158
180 Ga0207712_10014645 3300025961 Bacteria 5049
181 Ga0207712_10052763 3300025961 Bacteria 2849
182 Ga0207668_10005071 3300025972 Bacteria 7754
183 Ga0207640_10087955 3300025981 Bacteria 2143
184 Ga0207640_10204010 3300025981 Bacteria 1501
185 Ga0207658_10038153 3300025986 Bacteria 3458
186 Ga0207703_10027963 3300026035 Bacteria 4440
187 Ga0207639_10001107 3300026041 Bacteria 18300
188 Ga0207678_10006227 3300026067 Bacteria 10598
189 Ga0207678_10031774 3300026067 Bacteria 4603
190 Ga0207708_10008607 3300026075 Bacteria 7550
191 Ga0207708_10049053 3300026075 Bacteria 3215
192 Ga0207702_10001390 3300026078 Bacteria 24132
193 Ga0207641_10036623 3300026088 Bacteria 4095
194 Ga0207641_10090036 3300026088 Bacteria 2682
195 Ga0207648_10002472 3300026089 Bacteria 19861
196 Ga0207676_10001646 3300026095 Bacteria 16449
197 Ga0207674_10000461 3300026116 Bacteria 53251
198 Ga0207674_10336079 3300026116 Bacteria 1460
199 Ga0207675_100011252 3300026118 Bacteria 8379
200 Ga0207698_10412173 3300026142 Bacteria 1294
201 Ga0207698_10869110 3300026142 Bacteria 908
202 Ga0209996_1009199 3300027395 Bacteria 1301
203 Ga0209983_1005879 3300027665 Bacteria 2533
204 Ga0209588_1004244 3300027671 Bacteria 4030
205 Ga0209971_1008028 3300027682 Bacteria 2507
206 Ga0209998_10008078 3300027717 Bacteria 2184
207 Ga0209974_10000467 3300027876 Bacteria 13434
208 Ga0268265_10001364 3300028380 Bacteria 20788
209 Ga0268265_10165657 3300028380 Bacteria 1883
210 Ga0268264_10153153 3300028381 Bacteria 2069
211 Ga0311001_1059652 3300029277 Bacteria 726
212 Ga0307509_10000044 3300031507 Bacteria 176718
213 Ga0307408_100079604 3300031548 Bacteria 2445
214 Ga0307508_10056909 3300031616 Bacteria 3461
215 Ga0307405_10022142 3300031731 Bacteria 3588
216 Ga0307413_10004939 3300031824 Bacteria 5876
217 Ga0307413_10238149 3300031824 Bacteria 1342
218 Ga0307410_10025025 3300031852 Bacteria 3738
219 Ga0307406_10005075 3300031901 Bacteria 7182
220 Ga0307412_10011189 3300031911 Bacteria 5192
221 Ga0307409_100008454 3300031995 Bacteria 6250
222 Ga0307416_100059194 3300032002 Bacteria 3111
223 Ga0307416_100156662 3300032002 Bacteria 2098
224 Ga0307411_10014724 3300032005 Bacteria 4364
225 Ga0307411_10238200 3300032005 Bacteria 1423
226 Ga0307415_100008439 3300032126 Bacteria 5710
227 Ga0307507_10234248 3300033179 Bacteria 1212
228 Ga0373934_0000731 3300035086 Bacteria 11743
229 Ga0373923_0000489 3300035111 Bacteria 9511
230 Ga0373936_0002939 3300035113 Bacteria 6370
231 Ga0373941_0015192 3300035115 Bacteria 2070
232 Ga0373953_0138669 3300035117 Bacteria 1039
233 Ga0373954_0000665 3300035118 Bacteria 13169
234 Ga0373954_0012185 3300035118 Bacteria 3823
235 Ga0373956_0006545 3300035119 Bacteria 4667
236 Ga0373957_0012049 3300035120 Bacteria 2901
237 Ga0373957_0108248 3300035120 Bacteria 1118
238 Ga0373943_0242081 3300035170 Bacteria 1011
239 Ga0373946_0010964 3300035171 Bacteria 3370
240 Ga0316574_0494583 3300035398 Bacteria 763
241 Ga0373924_0023342 3300035410 Bacteria 2425
242 Ga0373935_0226082 3300035692 Bacteria 1301
243 Ga0373927_0020223 3300035695 Bacteria 4365
244 Ga0373927_0100850 3300035695 Bacteria 1877
245 Ga0373933_0013442 3300035724 Bacteria 4537
246 Ga0373937_0128403 3300036401 Bacteria 2366
247 Ga0373925_0016379 3300037068 Bacteria 5369
248 Ga0373925_0035075 3300037068 Bacteria 3700
249 Ga0395899_0075913 3300037312 Bacteria 2454
250 Ga0395899_0150009 3300037312 Bacteria 1653
251 Ga0395900_0000297 3300037418 Bacteria 74817
252 Ga0395900_0080416 3300037418 Bacteria 3349
253 Ga0395900_0244365 3300037418 Bacteria 1799
254 Ga0395898_0074976 3300037466 Bacteria 3268
255 Ga0395905_0127754 3300037471 Bacteria 2390
256 Ga0395905_0563293 3300037471 Bacteria 1041
257 Ga0395901_0086487 3300038443 Bacteria 3278
258 Ga0400483_057805 3300039062 Bacteria 1611
259 Ga0400483_268566 3300039062 Bacteria 1999
260 Ga0495617_000039 3300046452 Bacteria 128069
261 Ga0495627_000303 3300046453 Bacteria 48679
262 Ga0495627_004164 3300046453 Bacteria 6132
263 Ga0495627_101361 3300046453 Bacteria 821
264 Ga0495592_0021952 3300046454 Bacteria 4857
265 Ga0495592_0213636 3300046454 Bacteria 1294
266 Ga0495590_0000018 3300046457 Bacteria 216375
267 Ga0495590_0014881 3300046457 Bacteria 2834
268 Ga0495591_000134 3300046458 Bacteria 80820
269 Ga0495638_0014015 3300046460 Bacteria 5434
270 Ga0495638_0078208 3300046460 Bacteria 2013
271 Ga0495641_0045813 3300046461 Bacteria 2012
272 Ga0495651_0034753 3300046462 Bacteria 3928
273 Ga0495653_0079220 3300046463 Bacteria 2433
274 Ga0495650_0000048 3300046471 Bacteria 334427
275 Ga0495650_0111221 3300046471 Bacteria 1017
276 Ga0495580_0027507 3300046472 Bacteria 4137
277 Ga0495580_0103538 3300046472 Bacteria 1978
278 Ga0495582_0000534 3300046473 Bacteria 21025
279 Ga0495582_0033767 3300046473 Bacteria 2813
280 Ga0495582_0194237 3300046473 Bacteria 1158
281 Ga0495605_0001258 3300046474 Bacteria 16801
282 Ga0495605_0001847 3300046474 Bacteria 13542
283 Ga0495605_0014011 3300046474 Bacteria 4399
284 Ga0495605_0032164 3300046474 Bacteria 2673
285 Ga0495639_0006735 3300046475 Bacteria 4941
286 Ga0495664_0009228 3300046477 Bacteria 5514
287 Ga0495584_0000243 3300046491 Bacteria 39445
288 Ga0495584_0004813 3300046491 Bacteria 7212
289 Ga0495584_0012074 3300046491 Bacteria 4416
290 Ga0495584_0025191 3300046491 Bacteria 3015
291 Ga0495584_0084103 3300046491 Bacteria 1602
292 Ga0495584_0204916 3300046491 Bacteria 1002
293 Ga0495585_0004757 3300046492 Bacteria 8739
294 Ga0495585_0034364 3300046492 Bacteria 2865
295 Ga0495585_0038865 3300046492 Bacteria 2677
296 Ga0495585_0049092 3300046492 Bacteria 2344
297 Ga0495585_0055116 3300046492 Bacteria 2197
298 Ga0495594_0004358 3300046499 Bacteria 7283
299 Ga0495594_0013300 3300046499 Bacteria 4293
300 Ga0495594_0028902 3300046499 Bacteria 2993
301 Ga0495594_0078827 3300046499 Bacteria 1838
302 Ga0495594_0085781 3300046499 Bacteria 1761
303 Ga0495596_0015492 3300046500 Bacteria 3190
304 Ga0495596_0021676 3300046500 Bacteria 2620
305 Ga0495596_0022501 3300046500 Bacteria 2565
306 Ga0495596_0024640 3300046500 Bacteria 2435
307 Ga0495596_0028461 3300046500 Bacteria 2243
308 Ga0495596_0033331 3300046500 Bacteria 2049
309 Ga0495596_0099100 3300046500 Bacteria 1131
310 Ga0495607_0001206 3300046501 Bacteria 23354
311 Ga0495607_0001465 3300046501 Bacteria 21024
312 Ga0495607_0047107 3300046501 Bacteria 2527
313 Ga0495607_0050603 3300046501 Bacteria 2417
314 Ga0495607_0052716 3300046501 Bacteria 2354
315 Ga0495607_0171275 3300046501 Bacteria 1096
316 Ga0495583_0000377 3300046506 Bacteria 69237
317 Ga0495583_0001102 3300046506 Bacteria 29889
318 Ga0495583_0013112 3300046506 Bacteria 4644
319 Ga0495583_0029758 3300046506 Bacteria 2668
320 Ga0495583_0041668 3300046506 Bacteria 2149
321 Ga0495583_0044111 3300046506 Bacteria 2072
322 Ga0495606_0020046 3300046507 Bacteria 4945
323 Ga0495606_0101758 3300046507 Bacteria 1748
324 Ga0495606_0108041 3300046507 Bacteria 1682
325 Ga0495610_0000147 3300046512 Bacteria 77304
326 Ga0495616_0000175 3300046513 Bacteria 54795
327 Ga0495616_0004688 3300046513 Bacteria 8575
328 Ga0495616_0005403 3300046513 Bacteria 7870
329 Ga0495616_0016092 3300046513 Bacteria 4144
330 Ga0495616_0045377 3300046513 Bacteria 2224
331 Ga0495616_0048260 3300046513 Bacteria 2140
332 Ga0495628_0020369 3300046516 Bacteria 5472
333 Ga0495630_0122796 3300046517 Bacteria 1970
334 Ga0495631_0000028 3300046518 Bacteria 87180
335 Ga0495631_0001122 3300046518 Bacteria 16601
336 Ga0495631_0008662 3300046518 Bacteria 5118
337 Ga0495631_0009878 3300046518 Bacteria 4747
338 Ga0495631_0014639 3300046518 Bacteria 3779
339 Ga0495631_0017486 3300046518 Bacteria 3391
340 Ga0495631_0022437 3300046518 Bacteria 2935
341 Ga0495631_0074151 3300046518 Bacteria 1469
342 Ga0495632_0000267 3300046519 Bacteria 52020
343 Ga0495632_0000684 3300046519 Bacteria 30931
344 Ga0495632_0003767 3300046519 Bacteria 10600
345 Ga0495632_0006115 3300046519 Bacteria 7804
346 Ga0495632_0015831 3300046519 Bacteria 4214
347 Ga0495632_0018018 3300046519 Bacteria 3882
348 Ga0495632_0018226 3300046519 Bacteria 3856
349 Ga0495632_0041634 3300046519 Bacteria 2307
350 Ga0495637_0000004 3300046520 Bacteria 589740
351 Ga0495643_0001557 3300046522 Bacteria 20441
352 Ga0495643_0014626 3300046522 Bacteria 4663
353 Ga0495643_0069576 3300046522 Bacteria 1849
354 Ga0495644_0001291 3300046523 Bacteria 10283
355 Ga0495644_0002623 3300046523 Bacteria 7154
356 Ga0495644_0008124 3300046523 Bacteria 4038
357 Ga0495644_0015220 3300046523 Bacteria 2945
358 Ga0495644_0023219 3300046523 Bacteria 2361
359 Ga0495648_0011379 3300046524 Bacteria 6706
360 Ga0495648_0014105 3300046524 Bacteria 5870
361 Ga0495648_0026581 3300046524 Bacteria 3893
362 Ga0495648_0070625 3300046524 Bacteria 2028
363 Ga0495666_0007773 3300046526 Bacteria 5367
364 Ga0495666_0012947 3300046526 Bacteria 4156
365 Ga0495666_0041319 3300046526 Bacteria 2233
366 Ga0495642_0000081 3300046528 Bacteria 55669
367 Ga0495642_0001200 3300046528 Bacteria 11930
368 Ga0495642_0014072 3300046528 Bacteria 3101
369 Ga0495642_0040548 3300046528 Bacteria 1891
370 Ga0495642_0042669 3300046528 Bacteria 1848
371 Ga0495652_0041160 3300046529 Bacteria 3990
372 Ga0495652_0057079 3300046529 Bacteria 3313
373 Ga0495654_0007829 3300046530 Bacteria 5940
374 Ga0495654_0053124 3300046530 Bacteria 1970
375 Ga0495665_0004851 3300046531 Bacteria 7254
376 Ga0495640_0110622 3300046533 Bacteria 1796
377 Ga0495640_0379882 3300046533 Bacteria 869
378 Ga0495586_0015570 3300046535 Bacteria 4046
379 Ga0495587_0006076 3300046536 Bacteria 7879
380 Ga0495609_0006889 3300046538 Bacteria 5739
381 Ga0495609_0008883 3300046538 Bacteria 4890
382 Ga0495609_0015800 3300046538 Bacteria 3528
383 Ga0495609_0016598 3300046538 Bacteria 3429
384 Ga0495609_0031754 3300046538 Bacteria 2399
385 Ga0495609_0093622 3300046538 Bacteria 1305
386 Ga0495609_0128119 3300046538 Bacteria 1088
387 Ga0495621_0013697 3300046539 Bacteria 2553
388 Ga0495597_0000187 3300046542 Bacteria 55956
389 Ga0495597_0000404 3300046542 Bacteria 37304
390 Ga0495597_0002432 3300046542 Bacteria 11812
391 Ga0495597_0028870 3300046542 Bacteria 2535
392 Ga0495597_0031584 3300046542 Bacteria 2408
393 Ga0495597_0044231 3300046542 Bacteria 1981
394 Ga0495597_0092019 3300046542 Bacteria 1286
395 Ga0495622_0049992 3300046557 Bacteria 1940
396 Ga0495622_0257012 3300046557 Bacteria 767
397 Ga0495633_0001359 3300046558 Bacteria 19163
398 Ga0495633_0009075 3300046558 Bacteria 5529
399 Ga0495633_0019652 3300046558 Bacteria 3413
400 Ga0495633_0051380 3300046558 Bacteria 1942
401 Ga0495667_0006636 3300046559 Bacteria 7855
402 Ga0495667_0119177 3300046559 Bacteria 1704
403 Ga0495656_0040782 3300046615 Bacteria 1936
404 Ga0495656_0117989 3300046615 Bacteria 1249
405 Ga0495656_0138753 3300046615 Bacteria 1164
406 Ga0495668_0000603 3300046616 Bacteria 43532
407 Ga0495668_0001327 3300046616 Bacteria 24338
408 Ga0495668_0003472 3300046616 Bacteria 11763
409 Ga0495668_0008015 3300046616 Bacteria 6654
410 Ga0495668_0023093 3300046616 Bacteria 3550
411 Ga0495668_0025211 3300046616 Bacteria 3380
412 Ga0495668_0025226 3300046616 Bacteria 3379
413 Ga0495668_0049134 3300046616 Bacteria 2339
414 Ga0495668_0107029 3300046616 Bacteria 1529
415 Ga0495668_0110488 3300046616 Bacteria 1503
416 Ga0495668_0165995 3300046616 Bacteria 1209
417 Ga0495668_0254734 3300046616 Bacteria 961
418 Ga0495634_0004975 3300046642 Bacteria 10266
419 Ga0495634_0043743 3300046642 Bacteria 3034
420 Ga0495611_0001261 3300046648 Bacteria 13033
421 Ga0495611_0002381 3300046648 Bacteria 8656
422 Ga0495611_0032033 3300046648 Bacteria 2316
423 Ga0495625_0019644 3300046660 Bacteria 5233
424 Ga0495625_0063631 3300046660 Bacteria 2604
425 Ga0495625_0096352 3300046660 Bacteria 2038
426 Ga0495625_0141008 3300046660 Bacteria 1626
427 Ga0495635_0054081 3300046663 Bacteria 2765
428 Ga0495635_0081969 3300046663 Bacteria 2207
429 Ga0495661_0003069 3300046665 Bacteria 12562
430 Ga0495661_0003405 3300046665 Bacteria 11761
431 Ga0495661_0007004 3300046665 Bacteria 7885
432 Ga0495661_0019568 3300046665 Bacteria 4434
433 Ga0495661_0034655 3300046665 Bacteria 3174
434 Ga0495661_0066800 3300046665 Bacteria 2115
435 Ga0495588_0004759 3300046674 Bacteria 6000
436 Ga0495588_0005321 3300046674 Bacteria 5725
437 Ga0495588_0022699 3300046674 Bacteria 3102
438 Ga0495588_0143479 3300046674 Bacteria 1261
439 Ga0495657_0003112 3300046675 Bacteria 13695
440 Ga0495599_0023512 3300046678 Bacteria 3853
441 Ga0495623_0002113 3300046679 Bacteria 13287
442 Ga0495647_0010219 3300046681 Bacteria 3193
443 Ga0495647_0051592 3300046681 Bacteria 1599
444 Ga0495669_0000174 3300046684 Bacteria 40779
445 Ga0495669_0002474 3300046684 Bacteria 7536
446 Ga0495669_0004825 3300046684 Bacteria 5594
447 Ga0495669_0007519 3300046684 Bacteria 4572
448 Ga0495669_0017305 3300046684 Bacteria 3092
449 Ga0495669_0025169 3300046684 Bacteria 2594
450 Ga0495669_0056497 3300046684 Bacteria 1769
451 Ga0495669_0078458 3300046684 Bacteria 1513
452 Ga0495613_0129512 3300046689 Bacteria 1807
453 Ga0495624_0147194 3300046690 Bacteria 1441
454 Ga0495670_0001204 3300046691 Bacteria 12575
455 Ga0495670_0017542 3300046691 Bacteria 3523
456 Ga0495670_0058698 3300046691 Bacteria 1931
457 Ga0495671_0000338 3300046692 Bacteria 39056
458 Ga0495671_0000846 3300046692 Bacteria 21877
459 Ga0495671_0016291 3300046692 Bacteria 3972
460 Ga0495671_0240164 3300046692 Bacteria 875
461 Ga0495649_0000355 3300046694 Bacteria 39453
462 Ga0495649_0003389 3300046694 Bacteria 10775
463 Ga0495649_0022143 3300046694 Bacteria 3556
464 Ga0495649_0068786 3300046694 Bacteria 1899
465 Ga0495649_0143406 3300046694 Bacteria 1256
466 Ga0495589_0000441 3300046794 Bacteria 30525
467 Ga0495589_0000813 3300046794 Bacteria 19744
468 Ga0495589_0002969 3300046794 Bacteria 9344
469 Ga0495589_0009670 3300046794 Bacteria 5011
470 Ga0495589_0015895 3300046794 Bacteria 3869
471 Ga0495589_0017623 3300046794 Bacteria 3664
472 Ga0495600_0036797 3300046809 Bacteria 3181
473 Ga0495660_0001242 3300046810 Bacteria 17743
474 Ga0495660_0054162 3300046810 Bacteria 2174
475 Ga0495660_0056767 3300046810 Bacteria 2114
476 Ga0495660_0089629 3300046810 Bacteria 1601
477 Ga0495581_0392117 3300047315 Bacteria 810
478 Ga0495581_0484655 3300047315 Bacteria 719
479 Ga0495604_0012212 3300047317 Bacteria 6826
480 Ga0495604_0108536 3300047317 Bacteria 2027
481 Ga0495636_0010339 3300047318 Bacteria 3684
482 Ga0495636_0049678 3300047318 Bacteria 1754
483 Ga0495674_0002348 3300047319 Bacteria 18570
484 Ga0495672_0000126 3300047320 Bacteria 117782
485 Ga0495672_0056639 3300047320 Bacteria 2279
486 Ga0495676_0000047 3300047321 Bacteria 100683
487 Ga0495680_0007593 3300047322 Bacteria 9911
488 Ga0495680_0030498 3300047322 Bacteria 4403
489 Ga0495680_0066852 3300047322 Bacteria 2749
490 Ga0495683_0000214 3300047323 Bacteria 54728
491 Ga0495683_0044543 3300047323 Bacteria 2231
492 Ga0495683_0162185 3300047323 Bacteria 1033
493 Ga0495687_000002 3300047443 Bacteria 1085770
494 Ga0495687_000017 3300047443 Bacteria 350429
495 Ga0495687_007764 3300047443 Bacteria 6247
496 Ga0495675_0010331 3300047444 Bacteria 5837
497 Ga0495675_0045135 3300047444 Bacteria 2806
498 Ga0495675_0047688 3300047444 Bacteria 2725
499 Ga0495675_0049677 3300047444 Bacteria 2665
500 Ga0495677_0000292 3300047445 Bacteria 21858
501 Ga0495677_0000887 3300047445 Bacteria 12070
502 Ga0495677_0001264 3300047445 Bacteria 10128
503 Ga0495677_0004012 3300047445 Bacteria 5683
504 Ga0495677_0004242 3300047445 Bacteria 5521
505 Ga0495679_008925 3300047446 Bacteria 4043
506 Ga0495679_011252 3300047446 Bacteria 3465
507 Ga0495679_024830 3300047446 Bacteria 2013
508 Ga0495685_035140 3300047447 Bacteria 1722
509 Ga0495685_073093 3300047447 Bacteria 1147
510 Ga0495681_0000213 3300047470 Bacteria 48410
511 Ga0495681_0000629 3300047470 Bacteria 26892
512 Ga0495681_0004133 3300047470 Bacteria 9969
513 Ga0495681_0017002 3300047470 Bacteria 4054
514 Ga0495681_0028671 3300047470 Bacteria 2860
515 Ga0495681_0037654 3300047470 Bacteria 2380
516 Ga0495684_0012196 3300047471 Bacteria 6630
517 Ga0495686_0000248 3300047472 Bacteria 97017
518 Ga0495686_0000350 3300047472 Bacteria 75596
519 Ga0495686_0035961 3300047472 Bacteria 3180
520 Ga0495614_0114515 3300048089 Bacteria 1185
521 Ga0495626_0010864 3300048091 Bacteria 4835
522 Ga0495626_0012884 3300048091 Bacteria 4363
523 Ga0495626_0014087 3300048091 Bacteria 4135
524 Ga0495626_0020798 3300048091 Bacteria 3265
525 Ga0495626_0024969 3300048091 Bacteria 2925
526 Ga0495626_0031890 3300048091 Bacteria 2533
527 Ga0495626_0068054 3300048091 Bacteria 1607
528 Ga0495626_0080376 3300048091 Bacteria 1449
529 Ga0496100_0016595 3300048903 Bacteria 4328
530 Ga0496101_0362652 3300048904 Bacteria 1139
531 Ga0496102_0000306 3300048905 Bacteria 62296
532 Ga0496102_0009564 3300048905 Bacteria 8337
533 Ga0496102_0112183 3300048905 Bacteria 2543
534 Ga0496102_0300928 3300048905 Bacteria 1512
535 Ga0496104_0003929 3300048907 Bacteria 12868
536 Ga0496105_0008045 3300048908 Bacteria 8195
537 Ga0496106_0007041 3300048909 Bacteria 8306
538 Ga0496106_0217353 3300048909 Bacteria 1523
539 Ga0496107_0104454 3300048910 Bacteria 2079
540 Ga0496107_0466811 3300048910 Bacteria 937
541 Ga0496108_0001996 3300048911 Bacteria 16344
542 Ga0496109_0003539 3300048912 Bacteria 13034
543 Ga0496110_0000031 3300048913 Bacteria 67672
544 Ga0496110_0144508 3300048913 Bacteria 2151
545 Ga0496110_0256538 3300048913 Bacteria 1592
546 Ga0496110_0842252 3300048913 Bacteria 822
547 Ga0496111_0034738 3300048914 Bacteria 3601
548 Ga0496114_0276929 3300048917 Bacteria 1479
549 Ga0496115_0280358 3300048918 Bacteria 1368
550 Ga0496124_0023019 3300048927 Bacteria 5699
551 Ga0496124_0227281 3300048927 Bacteria 1398
552 Ga0501308_008319 3300049128 Bacteria 1108
553 Ga0495678_000121 3300049459 Bacteria 91388
554 Ga0495678_000371 3300049459 Bacteria 45956
555 Ga0495678_000722 3300049459 Bacteria 30006
556 Ga0495678_001149 3300049459 Bacteria 21969
557 Ga0495678_015016 3300049459 Bacteria 3580
558 Ga0495682_0000155 3300049460 Bacteria 58368
559 Ga0495682_0008564 3300049460 Bacteria 4024
560 Ga0495682_0026482 3300049460 Bacteria 2152
561 Ga0495682_0043757 3300049460 Bacteria 1639
562 Ga0501315_011342 3300049531 Bacteria 1086
563 Ga0501315_012996 3300049531 Bacteria 1037
564 Ga0501033_0274418 3300049570 Bacteria 1191
565 Ga0501036_0256229 3300049572 Bacteria 1466
566 Ga0501038_0372146 3300049574 Bacteria 1109
567 Ga0501039_0317920 3300049575 Bacteria 1224
568 Ga0501039_0419070 3300049575 Bacteria 1052
569 Ga0501068_0026702 3300049584 Bacteria 3404
570 Ga0501069_0025868 3300049585 Bacteria 3211
571 Ga0501071_0021131 3300049587 Bacteria 4533
572 Ga0501071_0085617 3300049587 Bacteria 2311
573 Ga0501072_0131932 3300049588 Bacteria 1991
574 Ga0501073_0004140 3300049589 Bacteria 10881
575 Ga0501074_0147996 3300049590 Bacteria 1679
576 Ga0501076_0078551 3300049592 Bacteria 2648
577 Ga0501077_0000288 3300049593 Bacteria 29818
578 Ga0501229_008742 3300049706 Bacteria 1268
579 Ga0501079_0121060 3300049741 Bacteria 2035
580 Ga0501080_0001913 3300049742 Bacteria 17955
581 Ga0501083_0025178 3300049744 Bacteria 4120
582 Ga0501269_013608 3300049766 Bacteria 997
583 Ga0501283_019817 3300049779 Bacteria 1067
584 nmdc:mga00v17_208130_c1 3300050491 Bacteria 1265
585 nmdc:mga05p37_812439_c1 3300050507 Bacteria 1021
586 nmdc:mga09592_255090_c1 3300050508 Bacteria 1520
587 nmdc:mga0qj67_74741_c1 3300050509 Bacteria 2708
588 nmdc:mga06r32_26525_c1 3300050510 Bacteria 5403
589 nmdc:mga08y16_192886_c1 3300050511 Bacteria 2113
590 nmdc:mga08y16_195630_c1 3300050511 Bacteria 2096
591 nmdc:mga08y16_38519_c1 3300050511 Bacteria 5020
592 Ga0495595_0005439 3300053084 Bacteria 5155
593 Ga0495619_0007281 3300053085 Bacteria 7007
594 Ga0500652_270818 3300053131 Bacteria 666
595 Ga0500589_050561 3300053147 Bacteria 1929
596 Ga0501084_0005439 3300054114 Bacteria 10446
597 Ga0501084_0906055 3300054114 Bacteria 742
598 Ga0501082_0077873 3300060353 Bacteria 2859
599 2643802216 2643221556 Bacteria 7251154
600 2644254254 2643221645 Bacteria 7207331
601 2644475724 2643221684 Bacteria 7145183
602 8047673926 8047673197 Bacteria 7395230
603 Ga0495616_0053522
604 Ga0006777J48905_1134701
605 rootL2_10005622
606 Ga0007417J51691_1028844
607 Ga0007410J51695_1043264
608 Ga0055543_1008850
609 Ga0065165_1000156
610 Ga0065165_1001173
611 Ga0065715_10118230
612 Ga0070658_10283787
613 Ga0070658_10755037
614 Ga0070676_10013004
615 Ga0070676_10013531
616 Ga0070683_100061288
617 Ga0070677_10008560
618 Ga0070666_10277634
619 Ga0070660_100007080
620 Ga0070660_100200778
621 Ga0070660_100227357
622 Ga0070689_100001052
623 Ga0070687_100045158
624 Ga0070661_100003142
625 Ga0070661_100005513
626 Ga0070661_100375385
627 Ga0070692_10189394
628 Ga0070668_100084928
629 Ga0070669_100004842
630 Ga0070669_100132044
631 Ga0070675_100275506
632 Ga0070671_100127427
633 Ga0070671_100191106
634 Ga0070674_100033150
635 Ga0070674_100045586
636 Ga0070673_100064782
637 Ga0070688_100059715
638 Ga0070659_100014092
639 Ga0070659_100038200
640 Ga0070659_100140829
641 Ga0070694_100176390
642 Ga0070663_100054860
643 Ga0070663_100091278
644 Ga0070662_100001925
645 Ga0070662_100515639
646 Ga0070681_10154428
647 Ga0068867_100001711
648 Ga0068867_100567231
649 Ga0070685_10003882
650 Ga0070707_100235396
651 Ga0070707_100294762
652 Ga0068853_100014010
653 Ga0068853_100015987
654 Ga0068853_100090053
655 Ga0068853_100468826
656 Ga0070672_100044821
657 Ga0070672_100132850
658 Ga0070672_100209194
659 Ga0070672_100209195
660 Ga0070672_100613505
661 Ga0070686_100042258
662 Ga0070695_100018431
663 Ga0070696_100252591
664 Ga0070665_100016480
665 Ga0070704_100081732
666 Ga0068855_100000068
667 Ga0068855_100008552
668 Ga0068855_100023030
669 Ga0068855_100346632
670 Ga0070664_100028732
671 Ga0070664_100131783
672 Ga0070664_100407802
673 Ga0068854_100045905
674 Ga0068856_100000181
675 Ga0068852_100102756
676 Ga0068859_100020248
677 Ga0068859_100432758
678 Ga0068864_100010007
679 Ga0068866_10057609
680 Ga0068861_100004408
681 Ga0068861_100222406
682 Ga0068851_10033082
683 Ga0068870_10014284
684 Ga0068870_10031964
685 Ga0068863_100123501
686 Ga0068858_100019450
687 Ga0068860_100134569
688 Ga0068860_100501551
689 Ga0068862_100008611
690 Ga0070716_100233933
691 Ga0075367_10130353
692 Ga0097621_100177020
693 Ga0068871_100454979
694 Ga0075428_100008854
695 Ga0075430_100033965
696 Ga0075430_100064131
697 Ga0075430_100089951
698 Ga0075429_100080541
699 Ga0068865_100015443
700 Ga0068865_100148732
701 Ga0097620_100020248
702 Ga0097620_100432740
703 Ga0111539_10063522
704 Ga0111539_10165559
705 Ga0111539_10247938
706 Ga0105241_10432856
707 Ga0105237_10162351
708 Ga0157373_10050969
709 Ga0157373_10157378
710 Ga0157371_10036801
711 Ga0157370_10035249
712 Ga0157370_10406970
713 Ga0157369_10011852
714 Ga0157369_10315825
715 Ga0157369_10497438
716 Ga0157374_10052046
717 Ga0157374_10854038
718 Ga0157378_10223429
719 Ga0157372_10000481
720 Ga0157372_10080705
721 Ga0157372_10157395
722 Ga0157372_10225302
723 Ga0157375_10124906
724 Ga0163163_10002938
725 Ga0163163_10069714
726 Ga0157380_10025234
727 Ga0157380_10048236
728 Ga0157377_10002681
729 Ga0157379_10056462
730 Ga0157379_10062051
731 Ga0157376_10431472
732 Ga0209148_1000280
733 Ga0209130_1000268
734 Ga0207426_1007139
735 Ga0207697_10002035
736 Ga0207682_10008838
737 Ga0207692_10147638
738 Ga0207642_10006785
739 Ga0207688_10003028
740 Ga0207680_10010024
741 Ga0207645_10004453
742 Ga0207645_10122646
743 Ga0207643_10011553
744 Ga0207707_10208067
745 Ga0207671_10128332
746 Ga0207662_10013247
747 Ga0207657_10006281
748 Ga0207657_10020569
749 Ga0207657_10052623
750 Ga0207657_10177349
751 Ga0207649_10007766
752 Ga0207652_10339136
753 Ga0207646_10113148
754 Ga0207646_10412921
755 Ga0207681_10002320
756 Ga0207681_10067033
757 Ga0207650_10002733
758 Ga0207659_10038350
759 Ga0207659_10124352
760 Ga0207644_10095849
761 Ga0207644_10171599
762 Ga0207690_10002028
763 Ga0207706_10000074
764 Ga0207706_10013695
765 Ga0207670_10010089
766 Ga0207669_10018487
767 Ga0207704_10010144
768 Ga0207665_10416579
769 Ga0207691_10033608
770 Ga0207691_10076932
771 Ga0207691_10234037
772 Ga0207711_10068327
773 Ga0207689_10001435
774 Ga0207661_10040127
775 Ga0207679_10023599
776 Ga0207679_10362461
777 Ga0207667_10000057
778 Ga0207667_10013194
779 Ga0207667_10069904
780 Ga0207651_10032167
781 Ga0207651_10407190
782 Ga0207712_10014645
783 Ga0207712_10052763
784 Ga0207668_10005071
785 Ga0207640_10087955
786 Ga0207640_10204010
787 Ga0207658_10038153
788 Ga0207703_10027963
789 Ga0207639_10001107
790 Ga0207678_10006227
791 Ga0207678_10031774
792 Ga0207708_10008607
793 Ga0207708_10049053
794 Ga0207702_10001390
795 Ga0207641_10036623
796 Ga0207641_10090036
797 Ga0207648_10002472
798 Ga0207676_10001646
799 Ga0207674_10000461
800 Ga0207674_10336079
801 Ga0207675_100011252
802 Ga0207698_10412173
803 Ga0207698_10869110
804 Ga0209996_1009199
805 Ga0209983_1005879
806 Ga0209588_1004244
807 Ga0209971_1008028
808 Ga0209998_10008078
809 Ga0209974_10000467
810 Ga0268265_10001364
811 Ga0268265_10165657
812 Ga0268264_10153153
813 Ga0311001_1059652
814 Ga0307509_10000044
815 Ga0307408_100079604
816 Ga0307508_10056909
817 Ga0307405_10022142
818 Ga0307413_10004939
819 Ga0307413_10238149
820 Ga0307410_10025025
821 Ga0307406_10005075
822 Ga0307412_10011189
823 Ga0307409_100008454
824 Ga0307416_100059194
825 Ga0307416_100156662
826 Ga0307411_10014724
827 Ga0307411_10238200
828 Ga0307415_100008439
829 Ga0307507_10234248
830 Ga0373934_0000731
831 Ga0373923_0000489
832 Ga0373936_0002939
833 Ga0373941_0015192
834 Ga0373953_0138669
835 Ga0373954_0000665
836 Ga0373954_0012185
837 Ga0373956_0006545
838 Ga0373957_0012049
839 Ga0373957_0108248
840 Ga0373943_0242081
841 Ga0373946_0010964
842 Ga0316574_0494583
843 Ga0373924_0023342
844 Ga0373935_0226082
845 Ga0373927_0020223
846 Ga0373927_0100850
847 Ga0373933_0013442
848 Ga0373937_0128403
849 Ga0373925_0016379
850 Ga0373925_0035075
851 Ga0395899_0075913
852 Ga0395899_0150009
853 Ga0395900_0000297
854 Ga0395900_0080416
855 Ga0395900_0244365
856 Ga0395898_0074976
857 Ga0395905_0127754
858 Ga0395905_0563293
859 Ga0395901_0086487
860 Ga0400483_057805
861 Ga0400483_268566
862 Ga0495617_000039
863 Ga0495627_000303
864 Ga0495627_004164
865 Ga0495627_101361
866 Ga0495592_0021952
867 Ga0495592_0213636
868 Ga0495590_0000018
869 Ga0495590_0014881
870 Ga0495591_000134
871 Ga0495638_0014015
872 Ga0495638_0078208
873 Ga0495641_0045813
874 Ga0495651_0034753
875 Ga0495653_0079220
876 Ga0495650_0000048
877 Ga0495650_0111221
878 Ga0495580_0027507
879 Ga0495580_0103538
880 Ga0495582_0000534
881 Ga0495582_0033767
882 Ga0495582_0194237
883 Ga0495605_0001258
884 Ga0495605_0001847
885 Ga0495605_0014011
886 Ga0495605_0032164
887 Ga0495639_0006735
888 Ga0495664_0009228
889 Ga0495584_0000243
890 Ga0495584_0004813
891 Ga0495584_0012074
892 Ga0495584_0025191
893 Ga0495584_0084103
894 Ga0495584_0204916
895 Ga0495585_0004757
896 Ga0495585_0034364
897 Ga0495585_0038865
898 Ga0495585_0049092
899 Ga0495585_0055116
900 Ga0495594_0004358
901 Ga0495594_0013300
902 Ga0495594_0028902
903 Ga0495594_0078827
904 Ga0495594_0085781
905 Ga0495596_0015492
906 Ga0495596_0021676
907 Ga0495596_0022501
908 Ga0495596_0024640
909 Ga0495596_0028461
910 Ga0495596_0033331
911 Ga0495596_0099100
912 Ga0495607_0001206
913 Ga0495607_0001465
914 Ga0495607_0047107
915 Ga0495607_0050603
916 Ga0495607_0052716
917 Ga0495607_0171275
918 Ga0495583_0000377
919 Ga0495583_0001102
920 Ga0495583_0013112
921 Ga0495583_0029758
922 Ga0495583_0041668
923 Ga0495583_0044111
924 Ga0495606_0020046
925 Ga0495606_0101758
926 Ga0495606_0108041
927 Ga0495610_0000147
928 Ga0495616_0000175
929 Ga0495616_0004688
930 Ga0495616_0005403
931 Ga0495616_0016092
932 Ga0495616_0045377
933 Ga0495616_0048260
934 Ga0495628_0020369
935 Ga0495630_0122796
936 Ga0495631_0000028
937 Ga0495631_0001122
938 Ga0495631_0008662
939 Ga0495631_0009878
940 Ga0495631_0014639
941 Ga0495631_0017486
942 Ga0495631_0022437
943 Ga0495631_0074151
944 Ga0495632_0000267
945 Ga0495632_0000684
946 Ga0495632_0003767
947 Ga0495632_0006115
948 Ga0495632_0015831
949 Ga0495632_0018018
950 Ga0495632_0018226
951 Ga0495632_0041634
952 Ga0495637_0000004
953 Ga0495643_0001557
954 Ga0495643_0014626
955 Ga0495643_0069576
956 Ga0495644_0001291
957 Ga0495644_0002623
958 Ga0495644_0008124
959 Ga0495644_0015220
960 Ga0495644_0023219
961 Ga0495648_0011379
962 Ga0495648_0014105
963 Ga0495648_0026581
964 Ga0495648_0070625
965 Ga0495666_0007773
966 Ga0495666_0012947
967 Ga0495666_0041319
968 Ga0495642_0000081
969 Ga0495642_0001200
970 Ga0495642_0014072
971 Ga0495642_0040548
972 Ga0495642_0042669
973 Ga0495652_0041160
974 Ga0495652_0057079
975 Ga0495654_0007829
976 Ga0495654_0053124
977 Ga0495665_0004851
978 Ga0495640_0110622
979 Ga0495640_0379882
980 Ga0495586_0015570
981 Ga0495587_0006076
982 Ga0495609_0006889
983 Ga0495609_0008883
984 Ga0495609_0015800
985 Ga0495609_0016598
986 Ga0495609_0031754
987 Ga0495609_0093622
988 Ga0495609_0128119
989 Ga0495621_0013697
990 Ga0495597_0000187
991 Ga0495597_0000404
992 Ga0495597_0002432
993 Ga0495597_0028870
994 Ga0495597_0031584
995 Ga0495597_0044231
996 Ga0495597_0092019
997 Ga0495622_0049992
998 Ga0495622_0257012
999 Ga0495633_0001359
1000 Ga0495633_0009075
1001 Ga0495633_0019652
1002 Ga0495633_0051380
1003 Ga0495667_0006636
1004 Ga0495667_0119177
1005 Ga0495656_0040782
1006 Ga0495656_0117989
1007 Ga0495656_0138753
1008 Ga0495668_0000603
1009 Ga0495668_0001327
1010 Ga0495668_0003472
1011 Ga0495668_0008015
1012 Ga0495668_0023093
1013 Ga0495668_0025211
1014 Ga0495668_0025226
1015 Ga0495668_0049134
1016 Ga0495668_0107029
1017 Ga0495668_0110488
1018 Ga0495668_0165995
1019 Ga0495668_0254734
1020 Ga0495634_0004975
1021 Ga0495634_0043743
1022 Ga0495611_0001261
1023 Ga0495611_0002381
1024 Ga0495611_0032033
1025 Ga0495625_0019644
1026 Ga0495625_0063631
1027 Ga0495625_0096352
1028 Ga0495625_0141008
1029 Ga0495635_0054081
1030 Ga0495635_0081969
1031 Ga0495661_0003069
1032 Ga0495661_0003405
1033 Ga0495661_0007004
1034 Ga0495661_0019568
1035 Ga0495661_0034655
1036 Ga0495661_0066800
1037 Ga0495588_0004759
1038 Ga0495588_0005321
1039 Ga0495588_0022699
1040 Ga0495588_0143479
1041 Ga0495657_0003112
1042 Ga0495599_0023512
1043 Ga0495623_0002113
1044 Ga0495647_0010219
1045 Ga0495647_0051592
1046 Ga0495669_0000174
1047 Ga0495669_0002474
1048 Ga0495669_0004825
1049 Ga0495669_0007519
1050 Ga0495669_0017305
1051 Ga0495669_0025169
1052 Ga0495669_0056497
1053 Ga0495669_0078458
1054 Ga0495613_0129512
1055 Ga0495624_0147194
1056 Ga0495670_0001204
1057 Ga0495670_0017542
1058 Ga0495670_0058698
1059 Ga0495671_0000338
1060 Ga0495671_0000846
1061 Ga0495671_0016291
1062 Ga0495671_0240164
1063 Ga0495649_0000355
1064 Ga0495649_0003389
1065 Ga0495649_0022143
1066 Ga0495649_0068786
1067 Ga0495649_0143406
1068 Ga0495589_0000441
1069 Ga0495589_0000813
1070 Ga0495589_0002969
1071 Ga0495589_0009670
1072 Ga0495589_0015895
1073 Ga0495589_0017623
1074 Ga0495600_0036797
1075 Ga0495660_0001242
1076 Ga0495660_0054162
1077 Ga0495660_0056767
1078 Ga0495660_0089629
1079 Ga0495581_0392117
1080 Ga0495581_0484655
1081 Ga0495604_0012212
1082 Ga0495604_0108536
1083 Ga0495636_0010339
1084 Ga0495636_0049678
1085 Ga0495674_0002348
1086 Ga0495672_0000126
1087 Ga0495672_0056639
1088 Ga0495676_0000047
1089 Ga0495680_0007593
1090 Ga0495680_0030498
1091 Ga0495680_0066852
1092 Ga0495683_0000214
1093 Ga0495683_0044543
1094 Ga0495683_0162185
1095 Ga0495687_000002
1096 Ga0495687_000017
1097 Ga0495687_007764
1098 Ga0495675_0010331
1099 Ga0495675_0045135
1100 Ga0495675_0047688
1101 Ga0495675_0049677
1102 Ga0495677_0000292
1103 Ga0495677_0000887
1104 Ga0495677_0001264
1105 Ga0495677_0004012
1106 Ga0495677_0004242
1107 Ga0495679_008925
1108 Ga0495679_011252
1109 Ga0495679_024830
1110 Ga0495685_035140
1111 Ga0495685_073093
1112 Ga0495681_0000213
1113 Ga0495681_0000629
1114 Ga0495681_0004133
1115 Ga0495681_0017002
1116 Ga0495681_0028671
1117 Ga0495681_0037654
1118 Ga0495684_0012196
1119 Ga0495686_0000248
1120 Ga0495686_0000350
1121 Ga0495686_0035961
1122 Ga0495614_0114515
1123 Ga0495626_0010864
1124 Ga0495626_0012884
1125 Ga0495626_0014087
1126 Ga0495626_0020798
1127 Ga0495626_0024969
1128 Ga0495626_0031890
1129 Ga0495626_0068054
1130 Ga0495626_0080376
1131 Ga0496100_0016595
1132 Ga0496101_0362652
1133 Ga0496102_0000306
1134 Ga0496102_0009564
1135 Ga0496102_0112183
1136 Ga0496102_0300928
1137 Ga0496104_0003929
1138 Ga0496105_0008045
1139 Ga0496106_0007041
1140 Ga0496106_0217353
1141 Ga0496107_0104454
1142 Ga0496107_0466811
1143 Ga0496108_0001996
1144 Ga0496109_0003539
1145 Ga0496110_0000031
1146 Ga0496110_0144508
1147 Ga0496110_0256538
1148 Ga0496110_0842252
1149 Ga0496111_0034738
1150 Ga0496114_0276929
1151 Ga0496115_0280358
1152 Ga0496124_0023019
1153 Ga0496124_0227281
1154 Ga0501308_008319
1155 Ga0495678_000121
1156 Ga0495678_000371
1157 Ga0495678_000722
1158 Ga0495678_001149
1159 Ga0495678_015016
1160 Ga0495682_0000155
1161 Ga0495682_0008564
1162 Ga0495682_0026482
1163 Ga0495682_0043757
1164 Ga0501315_011342
1165 Ga0501315_012996
1166 Ga0501033_0274418
1167 Ga0501036_0256229
1168 Ga0501038_0372146
1169 Ga0501039_0317920
1170 Ga0501039_0419070
1171 Ga0501068_0026702
1172 Ga0501069_0025868
1173 Ga0501071_0021131
1174 Ga0501071_0085617
1175 Ga0501072_0131932
1176 Ga0501073_0004140
1177 Ga0501074_0147996
1178 Ga0501076_0078551
1179 Ga0501077_0000288
1180 Ga0501229_008742
1181 Ga0501079_0121060
1182 Ga0501080_0001913
1183 Ga0501083_0025178
1184 Ga0501269_013608
1185 Ga0501283_019817
1186 nmdc:mga00v17_208130_c1
1187 nmdc:mga05p37_812439_c1
1188 nmdc:mga09592_255090_c1
1189 nmdc:mga0qj67_74741_c1
1190 nmdc:mga06r32_26525_c1
1191 nmdc:mga08y16_192886_c1
1192 nmdc:mga08y16_195630_c1
1193 nmdc:mga08y16_38519_c1
1194 Ga0495595_0005439
1195 Ga0495619_0007281
1196 Ga0500652_270818
1197 Ga0500589_050561
1198 Ga0501084_0005439
1199 Ga0501084_0906055
1200 Ga0501082_0077873
1201 2643802216
1202 2644254254
1203 2644475724
1204 8047673926

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17954

Pirin_C_2

Quercetinase C-terminal cupin domain

196

281

0.99

PF02678

Pirin

Pirin

53

169

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1tq5-assembly1.cif.gz_A crystal structure of yhhw from escherichia coli 0.9713 1 231
6uts-assembly1.cif.gz_A crystal structure of bacterial pirin yhhw in complex with nickel(ii) from escherichia coli 0.9667 1 231
1tq5-assembly1.cif.gz_A crystal structure of yhhw from escherichia coli 0.9549 1 231
6uts-assembly1.cif.gz_A crystal structure of bacterial pirin yhhw in complex with nickel(ii) from escherichia coli 0.9544 1 231
2b8m-assembly1.cif.gz_A-2 crystal structure of a rmlc-like cupin family protein with a double-stranded beta-helix fold (mj0764) from methanocaldococcus jannaschii at 1.70 a resolution 0.841 34 119
ID Description Score Start End Superfamily
1tq5A02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9707 11 134 2.60.120.10
af_P9WI85_16_135_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9696 13 130 2.60.120.10
af_P46852_133_231_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9668 142 231 2.60.120.10
1tq5A01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9666 141 231 2.60.120.10
1tq5A02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9628 11 134 2.60.120.10
ID Description Score Start End GO Terms
AF-A7HDG4-F1-model_v4 Pirin domain protein 0.9904 1 230
AF-A0A0K3A9X6-F1-model_v4 Quercetin 2,3-dioxygenase 0.9896 63 232
AF-A0A2H1PM95-F1-model_v4 deleted 0.9886 1 182
AF-A0A353HYM2-F1-model_v4 Quercetin 2,3-dioxygenase 0.9882 1 207 GO:0046872
GO:0051213
AF-A0A2N2S029-F1-model_v4 Quercetin 2,3-dioxygenase 0.987 1 231 GO:0046872
GO:0051213

Map