F468210

General Info

Members Datasets Scaffolds Average Seq Length
602 339 541 228

Family's Representative Sequence

Representative Sequence 3300046557|Ga0495622_0000995|Ga0495622_0000995_6413_7159
Length 248
Sequence MDRATGNMKASDNLPNPADADAGAAAQRHSVPHRTRIKLCGLSKPEDVARAIDLGADAIGLVFYPPSPRSVSVAQAVELVREVPPFVSVVGLFVNATPDWIREVVSNVGLTLLQFHGDETAEQCETLAGVAGLPWLRALRVAADTQPADLVKSALNYSAASGLLFDTHVEGYGGGGKVFDWSLIPAELARRAVLSGGLNAQNVSDAIHRVRPYAVDVSSGIEVVGAKGVKDPARMAAFVRAVRAADAE

Samples

Sample ID Description Type Environment
1 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
2 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
3 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
4 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
5 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
6 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
7 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
8 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
9 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
10 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
11 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
12 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
13 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
14 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
15 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
16 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
17 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
18 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
19 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
20 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
21 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
22 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
23 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
24 2643221660 Methylibium sp. Root1272 Isolate Unclassified
25 2643221665 Acinetobacter sp. Root1280 Isolate Unclassified
26 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
27 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
28 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
29 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
30 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
31 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
32 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
33 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
34 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
35 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
36 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
37 2818991450 Burkholderia sp. 604 Isolate Unclassified
38 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
39 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
40 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
41 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
42 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
43 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
44 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
45 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
46 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
47 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
48 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
49 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
50 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
51 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
52 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
53 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
54 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
55 2928515477 Acinetobacter bereziniae 1375 Isolate Rhizosphere
56 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
57 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
58 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
59 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
60 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
61 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
62 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
63 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
64 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
65 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
66 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
67 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
68 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
69 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
70 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
71 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
72 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
73 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
74 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
75 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
76 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
77 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
78 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
79 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
80 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
81 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
82 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
83 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
84 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
85 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
86 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
87 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
88 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
89 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
90 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
91 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
92 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
93 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
94 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
95 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
96 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
97 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
98 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
99 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
100 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
101 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
102 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
103 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
104 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
105 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
106 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
107 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
108 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
109 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
110 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
111 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
112 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
113 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
114 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
115 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
116 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
117 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
118 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
119 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
120 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
121 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
122 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
123 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
124 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
125 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
126 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
127 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
128 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
129 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
130 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
131 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
132 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
136 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
137 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
139 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
140 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
142 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
143 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
145 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
176 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
177 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
178 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
179 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
180 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
181 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
182 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
183 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
184 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
185 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
186 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
187 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
188 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
189 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
190 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
191 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
192 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
193 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
194 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
195 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
196 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
197 3300044668 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3E2 Metagenome Unclassified
198 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
199 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
200 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
201 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
202 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
203 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
204 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
205 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
206 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
207 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
208 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
209 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
210 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
211 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
212 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
213 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
214 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
215 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
216 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
217 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
218 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
219 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
220 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
221 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
222 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
223 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
224 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
225 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
226 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
227 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
228 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
229 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
230 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
231 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
232 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
233 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
234 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
235 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
236 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
237 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
238 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
239 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
240 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
241 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
242 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
243 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
244 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
245 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
246 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
247 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
248 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
249 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
250 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
251 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
252 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
253 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
254 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
255 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
256 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
257 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
258 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
259 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
260 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
261 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
262 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
263 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
264 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
265 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
266 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
267 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
268 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
269 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
270 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
271 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
272 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
273 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
274 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
275 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
276 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
277 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
278 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
279 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
280 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
281 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
282 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
283 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
284 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
285 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
286 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
287 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
288 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
289 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
290 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
291 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
292 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
293 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
294 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
295 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
296 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
297 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
298 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
299 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
300 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
301 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
302 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
303 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
304 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
305 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
306 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
307 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
308 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
309 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
310 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
311 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
312 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
313 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
314 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
315 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
316 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
317 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
318 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
319 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
320 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
321 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
322 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
323 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
324 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
325 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
326 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
327 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
328 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
329 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
330 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
331 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
332 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
333 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
334 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
335 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
336 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
337 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
338 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
339 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89.87
Metatranscriptomes 0
Isolates 10.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.81
Nodule 2.82
Rhizoplane 6.15
Rhizosphere 68.6
Stem 0
Stem Tuber 0
Unclassified 14.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10005813 3300001979 Bacteria 5179
2 JGI24739J22299_10005845 3300001989 Bacteria 4658
3 JGI24735J21928_10001474 3300002067 Bacteria 8322
4 JGI24738J21930_10000246 3300002075 Bacteria 14746
5 JGI25156J39149_1002634 3300002705 Bacteria 6304
6 JGI25157J39369_1000206 3300002741 Bacteria 49227
7 JGI25165J46597_1001354 3300003214 Bacteria 13645
8 rootH1_10002706 3300003316 Bacteria 4951
9 rootL2_10065344 3300003322 Bacteria 1247
10 rootH1_10230904 3300003323 Bacteria 1085
11 JGI26128J50194_1003029 3300003347 Bacteria 1108
12 Ga0055532_1000069 3300003758 Bacteria 138614
13 Ga0055532_1000097 3300003758 Bacteria 98781
14 Ga0055527_1000034 3300003760 Bacteria 138614
15 Ga0055535_1000049 3300003761 Bacteria 138835
16 Ga0055542_1000077 3300003762 Bacteria 138614
17 Ga0055529_1000090 3300003763 Bacteria 138416
18 Ga0055530_10018027 3300003791 Bacteria 2192
19 Ga0065165_1010048 3300005262 Bacteria 4156
20 Ga0070658_10190184 3300005327 Bacteria 1730
21 Ga0068869_100015562 3300005334 Bacteria 5107
22 Ga0070682_100095962 3300005337 Bacteria 1948
23 Ga0070682_100331423 3300005337 Bacteria 1128
24 Ga0068868_100195324 3300005338 Bacteria 1684
25 Ga0068868_100252189 3300005338 Bacteria 1486
26 Ga0070660_100002267 3300005339 Bacteria 13211
27 Ga0070660_100203612 3300005339 Bacteria 1606
28 Ga0070661_100268590 3300005344 Bacteria 1320
29 Ga0070675_100036841 3300005354 Bacteria 3982
30 Ga0070671_100303493 3300005355 Bacteria 1359
31 Ga0070673_100006128 3300005364 Bacteria 7793
32 Ga0070659_100001282 3300005366 Bacteria 18216
33 Ga0070667_100186497 3300005367 Bacteria 1836
34 Ga0070663_100000305 3300005455 Bacteria 25223
35 Ga0070663_100070832 3300005455 Bacteria 2536
36 Ga0070663_100164165 3300005455 Bacteria 1712
37 Ga0070678_100176591 3300005456 Bacteria 1745
38 Ga0070662_100150471 3300005457 Bacteria 1811
39 Ga0068867_100007425 3300005459 Bacteria 7752
40 Ga0068867_100286702 3300005459 Bacteria 1352
41 Ga0070706_100079891 3300005467 Bacteria 3028
42 Ga0070672_100010361 3300005543 Bacteria 6463
43 Ga0068855_100016531 3300005563 Bacteria 8875
44 Ga0068855_100095982 3300005563 Bacteria 3417
45 Ga0070664_100000666 3300005564 Bacteria 26228
46 Ga0068857_100124075 3300005577 Bacteria 2326
47 Ga0068852_100073896 3300005616 Bacteria 3001
48 Ga0068858_100354450 3300005842 Bacteria 1406
49 Ga0075368_10015235 3300006042 Bacteria 2849
50 Ga0075364_10064566 3300006051 Bacteria 2403
51 Ga0075362_10022249 3300006177 Bacteria 2669
52 Ga0075367_10013246 3300006178 Bacteria 4427
53 Ga0075367_10379708 3300006178 Bacteria 893
54 Ga0075369_10031907 3300006186 Bacteria 2226
55 Ga0075366_10001021 3300006195 Bacteria 13727
56 Ga0075366_10030594 3300006195 Bacteria 3166
57 Ga0075366_10219771 3300006195 Bacteria 1157
58 Ga0068865_100033482 3300006881 Bacteria 3440
59 Ga0105251_10000229 3300009011 Bacteria 56300
60 Ga0105251_10005917 3300009011 Bacteria 7905
61 Ga0105251_10022094 3300009011 Bacteria 3311
62 Ga0105244_10277023 3300009036 Bacteria 778
63 Ga0105244_10277224 3300009036 Bacteria 778
64 Ga0105250_10013211 3300009092 Bacteria 3399
65 Ga0105240_10022845 3300009093 Bacteria 8286
66 Ga0105240_10152995 3300009093 Bacteria 2746
67 Ga0105243_10093819 3300009148 Bacteria 2477
68 Ga0105243_10951483 3300009148 Bacteria 858
69 Ga0105241_10279465 3300009174 Bacteria 1425
70 Ga0105248_10143522 3300009177 Bacteria 2694
71 Ga0105248_10221024 3300009177 Bacteria 2132
72 Ga0105237_10523685 3300009545 Bacteria 1192
73 Ga0105238_10173488 3300009551 Bacteria 2133
74 Ga0105238_10229342 3300009551 Bacteria 1834
75 Ga0105249_10002654 3300009553 Bacteria 15466
76 Ga0105246_10414496 3300011119 Bacteria 1122
77 Ga0157373_10164064 3300013100 Bacteria 1563
78 Ga0157373_10474897 3300013100 Bacteria 902
79 Ga0157371_10002619 3300013102 Bacteria 17080
80 Ga0157369_10086301 3300013105 Bacteria 3352
81 Ga0157369_10090512 3300013105 Bacteria 3267
82 Ga0157374_10083013 3300013296 Bacteria 3043
83 Ga0157378_10307537 3300013297 Bacteria 1536
84 Ga0157378_10801821 3300013297 Bacteria 967
85 Ga0163162_10083773 3300013306 Bacteria 3263
86 Ga0157375_10450717 3300013308 Bacteria 1452
87 Ga0157380_10046012 3300014326 Bacteria 3426
88 Ga0157377_10229845 3300014745 Bacteria 1192
89 Ga0157379_10014243 3300014968 Bacteria 6975
90 Ga0157376_10360010 3300014969 Bacteria 1395
91 Ga0182007_10000599 3300015262 Bacteria 21100
92 Ga0183361_10029 3300016635 Bacteria 57317
93 Ga0163161_10203940 3300017792 Bacteria 1525
94 Ga0213872_10000048 3300021361 Bacteria 109712
95 Ga0213872_10000090 3300021361 Bacteria 83813
96 Ga0213872_10000198 3300021361 Bacteria 53480
97 Ga0213872_10075202 3300021361 Bacteria 1520
98 Ga0213872_10090753 3300021361 Bacteria 1367
99 Ga0209435_100040 3300025206 Bacteria 115475
100 Ga0209672_100002 3300025228 Bacteria 1733325
101 Ga0209147_100003 3300025229 Bacteria 1733325
102 Ga0209147_100141 3300025229 Bacteria 115466
103 Ga0209258_100077 3300025242 Bacteria 264510
104 Ga0209258_100346 3300025242 Bacteria 66811
105 Ga0209646_1000218 3300025246 Bacteria 62078
106 Ga0209026_1000534 3300025250 Bacteria 26239
107 Ga0209148_1000006 3300025254 Bacteria 1733325
108 Ga0209759_1000170 3300025256 Bacteria 110023
109 Ga0209759_1000225 3300025256 Bacteria 84464
110 Ga0209759_1000447 3300025256 Bacteria 47749
111 Ga0209233_1000177 3300025261 Bacteria 141716
112 Ga0209455_1000140 3300025272 Bacteria 138610
113 Ga0209673_1003449 3300025273 Bacteria 9317
114 Ga0209564_1003018 3300025295 Bacteria 12027
115 Ga0209050_1000529 3300025298 Bacteria 63410
116 Ga0207426_1002025 3300025302 Bacteria 14230
117 Ga0207696_1036013 3300025711 Bacteria 1470
118 Ga0207655_1000680 3300025728 Bacteria 39547
119 Ga0207655_1004789 3300025728 Bacteria 9434
120 Ga0207713_1000201 3300025735 Bacteria 82948
121 Ga0207713_1035338 3300025735 Bacteria 2158
122 Ga0207680_10444967 3300025903 Bacteria 919
123 Ga0207647_10008442 3300025904 Bacteria 7386
124 Ga0207647_10012941 3300025904 Bacteria 5798
125 Ga0207643_10104386 3300025908 Bacteria 1664
126 Ga0207684_10069679 3300025910 Bacteria 2989
127 Ga0207654_10151545 3300025911 Bacteria 1489
128 Ga0207695_10027886 3300025913 Bacteria 6277
129 Ga0207671_10108981 3300025914 Bacteria 2105
130 Ga0207657_10019918 3300025919 Bacteria 6357
131 Ga0207657_10316247 3300025919 Bacteria 1235
132 Ga0207649_10021785 3300025920 Bacteria 3696
133 Ga0207694_10178768 3300025924 Bacteria 1720
134 Ga0207694_10197346 3300025924 Bacteria 1636
135 Ga0207659_10323269 3300025926 Bacteria 1273
136 Ga0207644_10136966 3300025931 Bacteria 1881
137 Ga0207690_10004776 3300025932 Bacteria 7992
138 Ga0207706_10251522 3300025933 Bacteria 1544
139 Ga0207709_10092847 3300025935 Bacteria 1977
140 Ga0207691_10020763 3300025940 Bacteria 6210
141 Ga0207711_10144984 3300025941 Bacteria 2139
142 Ga0207689_10014058 3300025942 Bacteria 6812
143 Ga0207667_10011956 3300025949 Bacteria 10049
144 Ga0207667_10020754 3300025949 Bacteria 7298
145 Ga0207667_10112240 3300025949 Bacteria 2811
146 Ga0207651_10020398 3300025960 Bacteria 3999
147 Ga0207712_10001874 3300025961 Bacteria 13812
148 Ga0207668_10245467 3300025972 Bacteria 1451
149 Ga0207678_10001071 3300026067 Bacteria 25052
150 Ga0207678_10100627 3300026067 Bacteria 2469
151 Ga0207678_10188094 3300026067 Bacteria 1764
152 Ga0207678_10236834 3300026067 Bacteria 1563
153 Ga0207648_10013272 3300026089 Bacteria 7676
154 Ga0207648_10195654 3300026089 Bacteria 1793
155 Ga0207683_10131105 3300026121 Bacteria 2255
156 Ga0207683_10288468 3300026121 Bacteria 1500
157 Ga0207698_10004477 3300026142 Bacteria 8523
158 Ga0209966_1000013 3300027695 Bacteria 83121
159 Ga0209813_10030101 3300027866 Bacteria 1593
160 Ga0307517_10240379 3300028786 Bacteria 1075
161 Ga0307515_10071276 3300028794 Bacteria 4712
162 Ga0265338_10000120 3300028800 Bacteria 145451
163 Ga0307509_10048850 3300031507 Bacteria 4541
164 Ga0307408_100008884 3300031548 Bacteria 6639
165 Ga0307408_100084519 3300031548 Bacteria 2381
166 Ga0307514_10000906 3300031649 Bacteria 45659
167 Ga0307514_10035292 3300031649 Bacteria 3980
168 Ga0307516_10000179 3300031730 Bacteria 81933
169 Ga0307516_10002516 3300031730 Bacteria 24408
170 Ga0307412_10000064 3300031911 Bacteria 125607
171 Ga0307409_100140554 3300031995 Bacteria 2080
172 Ga0307409_100286642 3300031995 Bacteria 1525
173 Ga0307416_100014850 3300032002 Bacteria 5355
174 Ga0395899_0000028 3300037312 Bacteria 334378
175 Ga0395899_0003039 3300037312 Bacteria 13398
176 Ga0395899_0004909 3300037312 Bacteria 10401
177 Ga0395900_0033177 3300037418 Bacteria 5313
178 Ga0395900_0273953 3300037418 Bacteria 1681
179 Ga0395905_0007912 3300037471 Bacteria 10515
180 Ga0395905_0020159 3300037471 Bacteria 6316
181 Ga0395901_0002361 3300038443 Bacteria 19197
182 Ga0395901_0028808 3300038443 Bacteria 5713
183 Ga0395901_0029714 3300038443 Bacteria 5627
184 Ga0436361_0108966 3300039447 Bacteria 2559
185 Ga0436361_0130338 3300039447 Bacteria 4746
186 Ga0436361_0692684 3300039447 Bacteria 133303
187 Ga0436361_0724069 3300039447 Bacteria 1480
188 Ga0436361_0749982 3300039447 Bacteria 2461
189 Ga0436361_0873243 3300039447 Bacteria 2537
190 Ga0436361_0943694 3300039447 Bacteria 119574
191 Ga0436361_1043638 3300039447 Bacteria 25534
192 Ga0451807_0879861 3300041486 Bacteria 1262
193 Ga0451853_1831623 3300041512 Bacteria 857
194 Ga0450898_023907 3300042134 Bacteria 1089
195 Ga0450898_027888 3300042134 Bacteria 1024
196 Ga0451577_0069483 3300042876 Bacteria 3141
197 Ga0451577_0641161 3300042876 Bacteria 963
198 Ga0466969_0013192 3300044656 Bacteria 4353
199 Ga0466969_0017188 3300044656 Bacteria 3780
200 Ga0466972_0000221 3300044658 Bacteria 40061
201 Ga0466972_0080186 3300044658 Bacteria 1554
202 Ga0466980_0139723 3300044668 Bacteria 1623
203 Ga0466965_0000873 3300044683 Bacteria 11498
204 Ga0466965_0005091 3300044683 Bacteria 5897
205 Ga0466961_0087529 3300044693 Bacteria 1968
206 Ga0466961_0174006 3300044693 Bacteria 1338
207 Ga0466963_0101884 3300044694 Bacteria 1966
208 Ga0466964_0015494 3300044706 Bacteria 2902
209 Ga0466964_0017207 3300044706 Bacteria 2766
210 Ga0453684_0154628 3300044712 Bacteria 2721
211 Ga0466968_0017488 3300044735 Bacteria 2866
212 Ga0466970_0075392 3300044765 Bacteria 1817
213 Ga0466957_0413833 3300044842 Bacteria 924
214 Ga0466959_0044750 3300045049 Bacteria 3260
215 Ga0466959_0058771 3300045049 Bacteria 2801
216 Ga0451576_0171131 3300045051 Bacteria 2267
217 Ga0466958_0007558 3300045836 Bacteria 5983
218 Ga0466958_0353684 3300045836 Bacteria 946
219 Ga0466967_0714204 3300045976 Bacteria 993
220 Ga0495592_0005360 3300046454 Bacteria 9466
221 Ga0495592_0016781 3300046454 Bacteria 5559
222 Ga0495603_0050479 3300046455 Bacteria 2473
223 Ga0495590_0004633 3300046457 Bacteria 5524
224 Ga0495590_0006989 3300046457 Bacteria 4376
225 Ga0495591_001444 3300046458 Bacteria 14751
226 Ga0495629_0000127 3300046459 Bacteria 66745
227 Ga0495629_0000603 3300046459 Bacteria 29262
228 Ga0495629_0011187 3300046459 Bacteria 6515
229 Ga0495629_0019005 3300046459 Bacteria 4914
230 Ga0495629_0051706 3300046459 Bacteria 2875
231 Ga0495629_0065528 3300046459 Bacteria 2535
232 Ga0495638_0032417 3300046460 Bacteria 3349
233 Ga0495641_0006820 3300046461 Bacteria 7317
234 Ga0495641_0022933 3300046461 Bacteria 3113
235 Ga0495651_0006607 3300046462 Bacteria 8854
236 Ga0495651_0073026 3300046462 Bacteria 2605
237 Ga0495651_0095699 3300046462 Bacteria 2220
238 Ga0495653_0002324 3300046463 Bacteria 15084
239 Ga0495653_0011271 3300046463 Bacteria 7306
240 Ga0495653_0015485 3300046463 Bacteria 6215
241 Ga0495653_0092520 3300046463 Bacteria 2207
242 Ga0495650_0001004 3300046471 Bacteria 31821
243 Ga0495650_0005958 3300046471 Bacteria 7729
244 Ga0495650_0008440 3300046471 Bacteria 6015
245 Ga0495650_0014635 3300046471 Bacteria 4066
246 Ga0495650_0152519 3300046471 Bacteria 828
247 Ga0495580_0001549 3300046472 Bacteria 20228
248 Ga0495580_0004838 3300046472 Bacteria 11270
249 Ga0495580_0006350 3300046472 Bacteria 9643
250 Ga0495580_0021793 3300046472 Bacteria 4724
251 Ga0495580_0139794 3300046472 Bacteria 1678
252 Ga0495580_0281620 3300046472 Bacteria 1134
253 Ga0495582_0004473 3300046473 Bacteria 7859
254 Ga0495582_0012596 3300046473 Bacteria 4662
255 Ga0495605_0000944 3300046474 Bacteria 19826
256 Ga0495605_0012414 3300046474 Bacteria 4727
257 Ga0495662_0020829 3300046476 Bacteria 3172
258 Ga0495662_0282864 3300046476 Bacteria 816
259 Ga0495664_0001378 3300046477 Bacteria 12828
260 Ga0495664_0016627 3300046477 Bacteria 4193
261 Ga0495664_0046478 3300046477 Bacteria 2575
262 Ga0495664_0183470 3300046477 Bacteria 1268
263 Ga0495584_0000008 3300046491 Bacteria 283067
264 Ga0495585_0000175 3300046492 Bacteria 69100
265 Ga0495585_0002651 3300046492 Bacteria 12568
266 Ga0495585_0015949 3300046492 Bacteria 4357
267 Ga0495585_0030000 3300046492 Bacteria 3094
268 Ga0495585_0152672 3300046492 Bacteria 1203
269 Ga0495594_0093914 3300046499 Bacteria 1683
270 Ga0495596_0005401 3300046500 Bacteria 6044
271 Ga0495596_0013604 3300046500 Bacteria 3443
272 Ga0495596_0127819 3300046500 Bacteria 986
273 Ga0495607_0131857 3300046501 Bacteria 1299
274 Ga0495583_0000141 3300046506 Bacteria 121899
275 Ga0495583_0002629 3300046506 Bacteria 15017
276 Ga0495583_0121499 3300046506 Bacteria 1099
277 Ga0495606_0037283 3300046507 Bacteria 3303
278 Ga0495606_0042780 3300046507 Bacteria 3026
279 Ga0495608_0015899 3300046511 Bacteria 5208
280 Ga0495608_0024044 3300046511 Bacteria 4169
281 Ga0495610_0014171 3300046512 Bacteria 4699
282 Ga0495616_0003067 3300046513 Bacteria 10822
283 Ga0495616_0164678 3300046513 Bacteria 995
284 Ga0495618_0029433 3300046514 Bacteria 3427
285 Ga0495618_0049117 3300046514 Bacteria 2664
286 Ga0495618_0056254 3300046514 Bacteria 2490
287 Ga0495628_0005769 3300046516 Bacteria 10846
288 Ga0495628_0005872 3300046516 Bacteria 10749
289 Ga0495628_0017050 3300046516 Bacteria 6052
290 Ga0495628_0049185 3300046516 Bacteria 3338
291 Ga0495628_0052870 3300046516 Bacteria 3207
292 Ga0495628_0197993 3300046516 Bacteria 1514
293 Ga0495630_0015871 3300046517 Bacteria 5504
294 Ga0495630_0021737 3300046517 Bacteria 4737
295 Ga0495630_0034163 3300046517 Bacteria 3795
296 Ga0495630_0043518 3300046517 Bacteria 3355
297 Ga0495630_0054868 3300046517 Bacteria 2985
298 Ga0495631_0022433 3300046518 Bacteria 2935
299 Ga0495644_0017649 3300046523 Bacteria 2727
300 Ga0495644_0059622 3300046523 Bacteria 1435
301 Ga0495648_0000030 3300046524 Bacteria 216178
302 Ga0495648_0015785 3300046524 Bacteria 5463
303 Ga0495648_0023216 3300046524 Bacteria 4253
304 Ga0495648_0071949 3300046524 Bacteria 2002
305 Ga0495648_0081836 3300046524 Bacteria 1835
306 Ga0495666_0011871 3300046526 Bacteria 4346
307 Ga0495666_0013920 3300046526 Bacteria 4011
308 Ga0495666_0016408 3300046526 Bacteria 3687
309 Ga0495642_0008215 3300046528 Bacteria 3992
310 Ga0495642_0010192 3300046528 Bacteria 3599
311 Ga0495642_0048998 3300046528 Bacteria 1734
312 Ga0495652_0005978 3300046529 Bacteria 11378
313 Ga0495652_0020426 3300046529 Bacteria 5887
314 Ga0495652_0033538 3300046529 Bacteria 4482
315 Ga0495652_0108468 3300046529 Bacteria 2237
316 Ga0495665_0000847 3300046531 Bacteria 16030
317 Ga0495665_0014120 3300046531 Bacteria 4311
318 Ga0495665_0138519 3300046531 Bacteria 1272
319 Ga0495665_0156281 3300046531 Bacteria 1189
320 Ga0495640_0020674 3300046533 Bacteria 4842
321 Ga0495640_0031712 3300046533 Bacteria 3769
322 Ga0495586_0144530 3300046535 Bacteria 1336
323 Ga0495587_0005949 3300046536 Bacteria 7952
324 Ga0495587_0028884 3300046536 Bacteria 3369
325 Ga0495609_0002618 3300046538 Bacteria 10930
326 Ga0495609_0112673 3300046538 Bacteria 1173
327 Ga0495621_0057708 3300046539 Bacteria 1402
328 Ga0495597_0035020 3300046542 Bacteria 2267
329 Ga0495597_0094486 3300046542 Bacteria 1266
330 Ga0495597_0096180 3300046542 Bacteria 1252
331 Ga0495645_0002334 3300046543 Bacteria 12879
332 Ga0495645_0026100 3300046543 Bacteria 4240
333 Ga0495622_0000995 3300046557 Bacteria 15178
334 Ga0495633_0006214 3300046558 Bacteria 7133
335 Ga0495667_0024297 3300046559 Bacteria 4081
336 Ga0495667_0147104 3300046559 Bacteria 1517
337 Ga0495668_0004957 3300046616 Bacteria 9227
338 Ga0495668_0149396 3300046616 Bacteria 1279
339 Ga0495668_0214751 3300046616 Bacteria 1053
340 Ga0495634_0017475 3300046642 Bacteria 5117
341 Ga0495634_0101137 3300046642 Bacteria 1862
342 Ga0495634_0124473 3300046642 Bacteria 1648
343 Ga0495634_0257244 3300046642 Bacteria 1066
344 Ga0495611_0016162 3300046648 Bacteria 3190
345 Ga0495611_0027930 3300046648 Bacteria 2470
346 Ga0495625_0015782 3300046660 Bacteria 5963
347 Ga0495635_0019323 3300046663 Bacteria 4751
348 Ga0495635_0021864 3300046663 Bacteria 4458
349 Ga0495661_0000995 3300046665 Bacteria 25555
350 Ga0495661_0005074 3300046665 Bacteria 9393
351 Ga0495661_0045719 3300046665 Bacteria 2676
352 Ga0495588_0063201 3300046674 Bacteria 1919
353 Ga0495588_0110634 3300046674 Bacteria 1447
354 Ga0495657_0040168 3300046675 Bacteria 3211
355 Ga0495657_0238125 3300046675 Bacteria 1099
356 Ga0495657_0279075 3300046675 Bacteria 1000
357 Ga0495599_0161482 3300046678 Bacteria 1385
358 Ga0495623_0011654 3300046679 Bacteria 5695
359 Ga0495623_0013929 3300046679 Bacteria 5213
360 Ga0495623_0025430 3300046679 Bacteria 3814
361 Ga0495623_0050698 3300046679 Bacteria 2628
362 Ga0495646_0021632 3300046680 Bacteria 4062
363 Ga0495646_0035597 3300046680 Bacteria 3087
364 Ga0495646_0080632 3300046680 Bacteria 1898
365 Ga0495646_0134970 3300046680 Bacteria 1385
366 Ga0495669_0011276 3300046684 Bacteria 3794
367 Ga0495669_0019996 3300046684 Bacteria 2893
368 Ga0495669_0245093 3300046684 Bacteria 860
369 Ga0495613_0003616 3300046689 Bacteria 11586
370 Ga0495613_0012331 3300046689 Bacteria 6349
371 Ga0495613_0175314 3300046689 Bacteria 1520
372 Ga0495624_0003534 3300046690 Bacteria 11585
373 Ga0495624_0008211 3300046690 Bacteria 7299
374 Ga0495624_0014142 3300046690 Bacteria 5423
375 Ga0495624_0039792 3300046690 Bacteria 3013
376 Ga0495624_0084212 3300046690 Bacteria 1965
377 Ga0495670_0001279 3300046691 Bacteria 12294
378 Ga0495670_0035491 3300046691 Bacteria 2485
379 Ga0495671_0021947 3300046692 Bacteria 3348
380 Ga0495649_0001361 3300046694 Bacteria 18572
381 Ga0495649_0067014 3300046694 Bacteria 1926
382 Ga0495589_0002083 3300046794 Bacteria 11314
383 Ga0495589_0039129 3300046794 Bacteria 2371
384 Ga0495589_0065023 3300046794 Bacteria 1788
385 Ga0495589_0329173 3300046794 Bacteria 705
386 Ga0495600_0004954 3300046809 Bacteria 7995
387 Ga0495600_0012184 3300046809 Bacteria 5370
388 Ga0495600_0051493 3300046809 Bacteria 2687
389 Ga0495600_0106645 3300046809 Bacteria 1825
390 Ga0495581_0012898 3300047315 Bacteria 4842
391 Ga0495581_0014593 3300047315 Bacteria 4555
392 Ga0495581_0024420 3300047315 Bacteria 3502
393 Ga0495581_0032311 3300047315 Bacteria 3031
394 Ga0495604_0005547 3300047317 Bacteria 10005
395 Ga0495604_0027692 3300047317 Bacteria 4506
396 Ga0495604_0259877 3300047317 Bacteria 1180
397 Ga0495674_0006203 3300047319 Bacteria 11470
398 Ga0495674_0006309 3300047319 Bacteria 11367
399 Ga0495674_0036618 3300047319 Bacteria 4415
400 Ga0495674_0086792 3300047319 Bacteria 2678
401 Ga0495674_0100333 3300047319 Bacteria 2463
402 Ga0495674_0109928 3300047319 Bacteria 2338
403 Ga0495674_0125753 3300047319 Bacteria 2163
404 Ga0495672_0022940 3300047320 Bacteria 4049
405 Ga0495676_0021199 3300047321 Bacteria 5682
406 Ga0495676_0047773 3300047321 Bacteria 3457
407 Ga0495676_0108861 3300047321 Bacteria 2037
408 Ga0495680_0004752 3300047322 Bacteria 12901
409 Ga0495680_0028711 3300047322 Bacteria 4559
410 Ga0495680_0050261 3300047322 Bacteria 3261
411 Ga0495680_0061842 3300047322 Bacteria 2879
412 Ga0495680_0063766 3300047322 Bacteria 2828
413 Ga0495683_0000035 3300047323 Bacteria 146394
414 Ga0495683_0006782 3300047323 Bacteria 6225
415 Ga0495683_0007116 3300047323 Bacteria 6071
416 Ga0495683_0035969 3300047323 Bacteria 2516
417 Ga0495683_0038327 3300047323 Bacteria 2427
418 Ga0495687_007209 3300047443 Bacteria 6607
419 Ga0495687_010042 3300047443 Bacteria 5227
420 Ga0495687_015425 3300047443 Bacteria 3886
421 Ga0495675_0001845 3300047444 Bacteria 12628
422 Ga0495675_0033736 3300047444 Bacteria 3266
423 Ga0495675_0079918 3300047444 Bacteria 2059
424 Ga0495679_000104 3300047446 Bacteria 76092
425 Ga0495679_001217 3300047446 Bacteria 15271
426 Ga0495679_003894 3300047446 Bacteria 7056
427 Ga0495679_019704 3300047446 Bacteria 2363
428 Ga0495673_0004318 3300047469 Bacteria 8949
429 Ga0495673_0012567 3300047469 Bacteria 4482
430 Ga0495673_0019520 3300047469 Bacteria 3393
431 Ga0495673_0171024 3300047469 Bacteria 828
432 Ga0495681_0036505 3300047470 Bacteria 2429
433 Ga0495684_0134031 3300047471 Bacteria 1859
434 Ga0495684_0177554 3300047471 Bacteria 1580
435 Ga0495686_0021235 3300047472 Bacteria 4316
436 Ga0495686_0063235 3300047472 Bacteria 2294
437 Ga0495593_0005692 3300047673 Bacteria 7351
438 Ga0495593_0006096 3300047673 Bacteria 7090
439 Ga0495593_0010682 3300047673 Bacteria 5293
440 Ga0495593_0012212 3300047673 Bacteria 4910
441 Ga0495602_0007151 3300048088 Bacteria 11693
442 Ga0495602_0033357 3300048088 Bacteria 4830
443 Ga0495602_0108456 3300048088 Bacteria 2260
444 Ga0495602_0357369 3300048088 Bacteria 1052
445 Ga0495614_0003568 3300048089 Bacteria 6970
446 Ga0495614_0009011 3300048089 Bacteria 4428
447 Ga0495614_0048160 3300048089 Bacteria 1827
448 Ga0495626_0025254 3300048091 Bacteria 2907
449 Ga0496100_0005294 3300048903 Bacteria 6932
450 Ga0496100_0252308 3300048903 Bacteria 1305
451 Ga0496101_0010550 3300048904 Bacteria 6102
452 Ga0496101_0104932 3300048904 Bacteria 2120
453 Ga0496101_0286517 3300048904 Bacteria 1288
454 Ga0496101_0337911 3300048904 Bacteria 1182
455 Ga0496102_0014774 3300048905 Bacteria 6790
456 Ga0496102_0014898 3300048905 Bacteria 6765
457 Ga0496102_0053499 3300048905 Bacteria 3680
458 Ga0496102_0143693 3300048905 Bacteria 2238
459 Ga0496103_0002846 3300048906 Bacteria 10759
460 Ga0496103_0025808 3300048906 Bacteria 3553
461 Ga0496104_0108943 3300048907 Bacteria 2655
462 Ga0496104_0334559 3300048907 Bacteria 1427
463 Ga0496105_0092897 3300048908 Bacteria 2491
464 Ga0496105_0097774 3300048908 Bacteria 2424
465 Ga0496106_0000083 3300048909 Bacteria 75660
466 Ga0496106_0027088 3300048909 Bacteria 4268
467 Ga0496106_0040209 3300048909 Bacteria 3502
468 Ga0496106_0191487 3300048909 Bacteria 1626
469 Ga0496107_0062093 3300048910 Bacteria 2706
470 Ga0496107_0231494 3300048910 Bacteria 1375
471 Ga0496108_0505761 3300048911 Bacteria 1055
472 Ga0496108_0891392 3300048911 Bacteria 764
473 Ga0496109_0415519 3300048912 Bacteria 1271
474 Ga0496109_0449056 3300048912 Bacteria 1218
475 Ga0496110_0585424 3300048913 Bacteria 1013
476 Ga0496111_0026446 3300048914 Bacteria 4098
477 Ga0496112_0006936 3300048915 Bacteria 9998
478 Ga0496112_0283955 3300048915 Bacteria 1602
479 Ga0496113_0125646 3300048916 Bacteria 2008
480 Ga0496113_0206766 3300048916 Bacteria 1561
481 Ga0496114_0021726 3300048917 Bacteria 5223
482 Ga0496114_0264610 3300048917 Bacteria 1515
483 Ga0496115_0077567 3300048918 Bacteria 2702
484 Ga0496116_0017664 3300048919 Bacteria 5528
485 Ga0496116_0026925 3300048919 Bacteria 4193
486 Ga0496116_0045220 3300048919 Bacteria 2983
487 Ga0496117_0011341 3300048920 Bacteria 7988
488 Ga0496117_0018626 3300048920 Bacteria 5740
489 Ga0496117_0019578 3300048920 Bacteria 5553
490 Ga0496117_0038898 3300048920 Bacteria 3518
491 Ga0496117_0056734 3300048920 Bacteria 2725
492 Ga0496118_0007399 3300048921 Bacteria 11654
493 Ga0496118_0009653 3300048921 Bacteria 9701
494 Ga0496118_0016310 3300048921 Bacteria 6822
495 Ga0496118_0025547 3300048921 Bacteria 5059
496 Ga0496118_0027194 3300048921 Bacteria 4848
497 Ga0496118_0032723 3300048921 Bacteria 4276
498 Ga0496118_0080913 3300048921 Bacteria 2284
499 Ga0496119_0104676 3300048922 Bacteria 1582
500 Ga0496121_0002626 3300048924 Bacteria 27109
501 Ga0496121_0004727 3300048924 Bacteria 17990
502 Ga0496121_0007566 3300048924 Bacteria 13087
503 Ga0496121_0017043 3300048924 Bacteria 7452
504 Ga0496121_0055488 3300048924 Bacteria 3300
505 Ga0496121_0150803 3300048924 Bacteria 1711
506 Ga0496121_0191287 3300048924 Bacteria 1467
507 Ga0496121_0237310 3300048924 Bacteria 1273
508 Ga0496122_0000892 3300048925 Bacteria 55236
509 Ga0496122_0035611 3300048925 Bacteria 4044
510 Ga0496123_0016949 3300048926 Bacteria 5884
511 Ga0496123_0065386 3300048926 Bacteria 2312
512 Ga0496124_0027699 3300048927 Bacteria 5079
513 Ga0496124_0149691 3300048927 Bacteria 1833
514 Ga0496125_0003177 3300048928 Bacteria 20359
515 Ga0496125_0393547 3300048928 Bacteria 812
516 Ga0496126_0000032 3300048929 Bacteria 372456
517 Ga0496126_0003005 3300048929 Bacteria 21885
518 Ga0496126_0005317 3300048929 Bacteria 14770
519 Ga0496126_0006439 3300048929 Bacteria 13084
520 Ga0495678_031545 3300049459 Bacteria 2208
521 Ga0495682_0033614 3300049460 Bacteria 1892
522 Ga0501198_000004 3300049649 Bacteria 175146
523 Ga0501206_026247 3300049653 Bacteria 850
524 Ga0501222_000038 3300049662 Bacteria 51424
525 Ga0501238_002373 3300049671 Bacteria 2245
526 nmdc:mga03n38_186647_c1 3300050490 Bacteria 1066
527 nmdc:mga0yw44_246022_c1 3300050492 Bacteria 1190
528 nmdc:mga0k408_203968_c1 3300050493 Bacteria 1180
529 nmdc:mga0k408_45290_c1 3300050493 Bacteria 2538
530 nmdc:mga0k408_84648_c2 3300050493 Bacteria 1519
531 nmdc:mga06z11_57851_c1 3300050494 Bacteria 2010
532 nmdc:mga04h51_28050_c1 3300050495 Bacteria 1754
533 nmdc:mga07m45_53874_c1 3300050496 Bacteria 2274
534 nmdc:mga07m45_72628_c1 3300050496 Bacteria 1959
535 nmdc:mga0sz30_163004_c1 3300050516 Bacteria 988
536 Ga0500578_0001187 3300053086 Bacteria 27526
537 Ga0500562_038219 3300053108 Bacteria 1275
538 Ga0500597_155811 3300053120 Bacteria 979
539 Ga0500561_0012244 3300053137 Bacteria 1825
540 Ga0500561_0024980 3300053137 Bacteria 1448
541 Ga0500568_0001605 3300053139 Bacteria 14305

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046794 Ga0495589_0329173 Ga0495589_0329173_61_693 195
2 3300037312 Ga0395899_0004909 Ga0395899_0004909_3597_4304 198
3 3300048905 Ga0496102_0014774 Ga0496102_0014774_415_1062 199
4 3300025941 Ga0207711_10144984 Ga0207711_101449842 201
5 3300026067 Ga0207678_10100627 Ga0207678_101006273 201
6 3300046462 Ga0495651_0095699 Ga0495651_0095699_23_628 201
7 3300047469 Ga0495673_0171024 Ga0495673_0171024_204_809 201
8 iso_pu_bacteria 2884811622 2884815773 201
9 iso_pu_bacteria 2884836552 2884836805 201
10 iso_pu_bacteria 2884852848 2884853096 201
11 iso_pu_bacteria 2896154374 2896155786 201
12 iso_pu_bacteria 2643221660 2644337440 203
13 iso_pu_bacteria 2643221592 2643970878 205
14 iso_pu_bacteria 2643221625 2644138872 205
15 iso_pu_bacteria 2643221648 2644273897 205
16 3300003316 rootH1_10002706 rootH1_100027062 206
17 3300005459 Ga0068867_100286702 Ga0068867_1002867022 206
18 3300006178 Ga0075367_10379708 Ga0075367_103797081 206
19 3300009148 Ga0105243_10093819 Ga0105243_100938193 206
20 3300025935 Ga0207709_10092847 Ga0207709_100928472 206
21 3300026089 Ga0207648_10195654 Ga0207648_101956542 206
22 3300028794 Ga0307515_10071276 Ga0307515_100712762 206
23 3300031649 Ga0307514_10000906 Ga0307514_1000090619 206
24 3300041512 Ga0451853_1831623 Ga0451853_1831623_103_729 206
25 3300045051 Ga0451576_0171131 Ga0451576_0171131_1359_1997 206
26 3300003347 JGI26128J50194_1003029 JGI26128J50194_10030292 207
27 3300027695 Ga0209966_1000013 Ga0209966_100001336 207
28 3300006042 Ga0075368_10015235 Ga0075368_100152352 208
29 3300006051 Ga0075364_10064566 Ga0075364_100645663 208
30 3300006177 Ga0075362_10022249 Ga0075362_100222492 208
31 3300006178 Ga0075367_10013246 Ga0075367_100132463 208
32 3300006186 Ga0075369_10031907 Ga0075369_100319072 208
33 3300021361 Ga0213872_10000090 Ga0213872_1000009064 208
34 3300027866 Ga0209813_10030101 Ga0209813_100301012 208
35 3300039447 Ga0436361_0108966 Ga0436361_0108966_1151_1795 208
36 3300039447 Ga0436361_1043638 Ga0436361_1043638_3566_4210 208
37 3300042876 Ga0451577_0641161 Ga0451577_0641161_228_881 208
38 3300050490 nmdc:mga03n38_186647_c1 nmdc:mga03n38_186647_c1_166_810 208
39 3300050492 nmdc:mga0yw44_246022_c1 nmdc:mga0yw44_246022_c1_123_767 208
40 3300050494 nmdc:mga06z11_57851_c1 nmdc:mga06z11_57851_c1_707_1351 208
41 3300050495 nmdc:mga04h51_28050_c1 nmdc:mga04h51_28050_c1_550_1194 208
42 3300050496 nmdc:mga07m45_53874_c1 nmdc:mga07m45_53874_c1_308_952 208
43 3300050516 nmdc:mga0sz30_163004_c1 nmdc:mga0sz30_163004_c1_155_799 208
44 3300003791 Ga0055530_10018027 Ga0055530_100180272 209
45 3300005262 Ga0065165_1010048 Ga0065165_10100482 209
46 3300005334 Ga0068869_100015562 Ga0068869_1000155623 209
47 3300005338 Ga0068868_100195324 Ga0068868_1001953242 209
48 3300005338 Ga0068868_100252189 Ga0068868_1002521892 209
49 3300005354 Ga0070675_100036841 Ga0070675_1000368414 209
50 3300005355 Ga0070671_100303493 Ga0070671_1003034932 209
51 3300005364 Ga0070673_100006128 Ga0070673_1000061286 209
52 3300005455 Ga0070663_100000305 Ga0070663_10000030512 209
53 3300005456 Ga0070678_100176591 Ga0070678_1001765912 209
54 3300005457 Ga0070662_100150471 Ga0070662_1001504713 209
55 3300005459 Ga0068867_100007425 Ga0068867_1000074255 209
56 3300005467 Ga0070706_100079891 Ga0070706_1000798913 209
57 3300005543 Ga0070672_100010361 Ga0070672_1000103613 209
58 3300005563 Ga0068855_100095982 Ga0068855_1000959822 209
59 3300005577 Ga0068857_100124075 Ga0068857_1001240752 209
60 3300005842 Ga0068858_100354450 Ga0068858_1003544502 209
61 3300006195 Ga0075366_10001021 Ga0075366_100010217 209
62 3300006195 Ga0075366_10030594 Ga0075366_100305943 209
63 3300006195 Ga0075366_10219771 Ga0075366_102197712 209
64 3300006881 Ga0068865_100033482 Ga0068865_1000334823 209
65 3300009148 Ga0105243_10951483 Ga0105243_109514831 209
66 3300013100 Ga0157373_10474897 Ga0157373_104748972 209
67 3300013297 Ga0157378_10307537 Ga0157378_103075372 209
68 3300014326 Ga0157380_10046012 Ga0157380_100460122 209
69 3300014745 Ga0157377_10229845 Ga0157377_102298451 209
70 3300014968 Ga0157379_10014243 Ga0157379_100142434 209
71 3300025273 Ga0209673_1003449 Ga0209673_10034497 209
72 3300025298 Ga0209050_1000529 Ga0209050_100052921 209
73 3300025908 Ga0207643_10104386 Ga0207643_101043862 209
74 3300025910 Ga0207684_10069679 Ga0207684_100696792 209
75 3300025926 Ga0207659_10323269 Ga0207659_103232692 209
76 3300025931 Ga0207644_10136966 Ga0207644_101369662 209
77 3300025933 Ga0207706_10251522 Ga0207706_102515222 209
78 3300025940 Ga0207691_10020763 Ga0207691_100207633 209
79 3300025942 Ga0207689_10014058 Ga0207689_100140584 209
80 3300025949 Ga0207667_10011956 Ga0207667_100119569 209
81 3300025960 Ga0207651_10020398 Ga0207651_100203984 209
82 3300026067 Ga0207678_10001071 Ga0207678_1000107115 209
83 3300026067 Ga0207678_10236834 Ga0207678_102368342 209
84 3300026089 Ga0207648_10013272 Ga0207648_100132723 209
85 3300026121 Ga0207683_10131105 Ga0207683_101311053 209
86 3300026121 Ga0207683_10288468 Ga0207683_102884682 209
87 3300031649 Ga0307514_10035292 Ga0307514_100352923 209
88 3300031730 Ga0307516_10002516 Ga0307516_100025163 209
89 3300042134 Ga0450898_023907 Ga0450898_023907_350_997 209
90 3300042134 Ga0450898_027888 Ga0450898_027888_196_843 209
91 3300044712 Ga0453684_0154628 Ga0453684_0154628_1482_2129 209
92 3300049649 Ga0501198_000004 Ga0501198_000004_61074_61721 209
93 3300049653 Ga0501206_026247 Ga0501206_026247_125_772 209
94 3300049662 Ga0501222_000038 Ga0501222_000038_13277_13924 209
95 3300050493 nmdc:mga0k408_45290_c1 nmdc:mga0k408_45290_c1_287_934 209
96 3300050493 nmdc:mga0k408_84648_c2 nmdc:mga0k408_84648_c2_96_743 209
97 3300050496 nmdc:mga07m45_72628_c1 nmdc:mga07m45_72628_c1_289_963 209
98 3300053086 Ga0500578_0001187 Ga0500578_0001187_22450_23109 209
99 3300053108 Ga0500562_038219 Ga0500562_038219_279_938 209
100 3300053120 Ga0500597_155811 Ga0500597_155811_257_910 209
101 3300053137 Ga0500561_0024980 Ga0500561_0024980_329_988 209
102 iso_pu_bacteria 2643221665 2644362101 209
103 iso_pu_bacteria 2928515477 2928519498 209
104 3300021361 Ga0213872_10000048 Ga0213872_1000004887 210
105 3300021361 Ga0213872_10075202 Ga0213872_100752022 210
106 3300039447 Ga0436361_0724069 Ga0436361_0724069_552_1199 210
107 3300039447 Ga0436361_0873243 Ga0436361_0873243_1435_2082 210
108 3300039447 Ga0436361_0943694 Ga0436361_0943694_4397_5044 210
109 3300041486 Ga0451807_0879861 Ga0451807_0879861_461_1117 210
110 3300047472 Ga0495686_0021235 Ga0495686_0021235_456_1130 210
111 3300046539 Ga0495621_0057708 Ga0495621_0057708_42_704 211
112 3300050493 nmdc:mga0k408_203968_c1 nmdc:mga0k408_203968_c1_295_939 211
113 iso_pu_bacteria 2511231003 2511252102 211
114 iso_pu_bacteria 2548876994 2550693825 211
115 iso_pu_bacteria 2818991445 2819595102 211
116 3300003322 rootL2_10065344 rootL2_100653442 212
117 3300021361 Ga0213872_10000198 Ga0213872_100001988 212
118 3300028786 Ga0307517_10240379 Ga0307517_102403792 212
119 3300031507 Ga0307509_10048850 Ga0307509_100488505 212
120 3300031548 Ga0307408_100084519 Ga0307408_1000845192 212
121 3300031730 Ga0307516_10000179 Ga0307516_1000017914 212
122 3300031995 Ga0307409_100140554 Ga0307409_1001405542 212
123 3300039447 Ga0436361_0692684 Ga0436361_0692684_70808_71548 212
124 3300045836 Ga0466958_0353684 Ga0466958_0353684_254_913 212
125 3300053137 Ga0500561_0012244 Ga0500561_0012244_418_1086 212
126 iso_pu_bacteria 2643221603 2644029028 212
127 iso_pu_bacteria 2721755763 2723877107 212
128 3300005339 Ga0070660_100002267 Ga0070660_1000022679 213
129 3300005344 Ga0070661_100268590 Ga0070661_1002685902 213
130 3300005366 Ga0070659_100001282 Ga0070659_10000128214 213
131 3300005564 Ga0070664_100000666 Ga0070664_10000066620 213
132 3300009011 Ga0105251_10022094 Ga0105251_100220943 213
133 3300009036 Ga0105244_10277023 Ga0105244_102770231 213
134 3300009036 Ga0105244_10277224 Ga0105244_102772241 213
135 3300009092 Ga0105250_10013211 Ga0105250_100132113 213
136 3300009553 Ga0105249_10002654 Ga0105249_100026543 213
137 3300013102 Ga0157371_10002619 Ga0157371_100026192 213
138 3300017792 Ga0163161_10203940 Ga0163161_102039402 213
139 3300025711 Ga0207696_1036013 Ga0207696_10360132 213
140 3300025728 Ga0207655_1000680 Ga0207655_10006805 213
141 3300025728 Ga0207655_1004789 Ga0207655_10047896 213
142 3300025735 Ga0207713_1035338 Ga0207713_10353382 213
143 3300025919 Ga0207657_10019918 Ga0207657_100199184 213
144 3300025920 Ga0207649_10021785 Ga0207649_100217853 213
145 3300025932 Ga0207690_10004776 Ga0207690_100047765 213
146 3300025961 Ga0207712_10001874 Ga0207712_100018743 213
147 3300042876 Ga0451577_0069483 Ga0451577_0069483_1665_2330 213
148 3300002741 JGI25157J39369_1000206 JGI25157J39369_100020624 215
149 3300003758 Ga0055532_1000097 Ga0055532_100009733 215
150 3300005563 Ga0068855_100016531 Ga0068855_1000165315 215
151 3300005616 Ga0068852_100073896 Ga0068852_1000738963 215
152 3300009093 Ga0105240_10022845 Ga0105240_100228454 215
153 3300009551 Ga0105238_10229342 Ga0105238_102293422 215
154 3300013100 Ga0157373_10164064 Ga0157373_101640642 215
155 3300025206 Ga0209435_100040 Ga0209435_10004051 215
156 3300025229 Ga0209147_100141 Ga0209147_10014148 215
157 3300025242 Ga0209258_100346 Ga0209258_10034614 215
158 3300025246 Ga0209646_1000218 Ga0209646_10002184 215
159 3300025250 Ga0209026_1000534 Ga0209026_10005344 215
160 3300025256 Ga0209759_1000447 Ga0209759_10004474 215
161 3300025913 Ga0207695_10027886 Ga0207695_100278865 215
162 3300025924 Ga0207694_10197346 Ga0207694_101973462 215
163 3300025949 Ga0207667_10020754 Ga0207667_100207544 215
164 3300026142 Ga0207698_10004477 Ga0207698_100044773 215
165 3300037312 Ga0395899_0000028 Ga0395899_0000028_110968_111630 215
166 3300046491 Ga0495584_0000008 Ga0495584_0000008_86387_87079 215
167 3300046492 Ga0495585_0000175 Ga0495585_0000175_6642_7334 215
168 3300046492 Ga0495585_0015949 Ga0495585_0015949_388_1080 215
169 3300046506 Ga0495583_0000141 Ga0495583_0000141_11478_12170 215
170 3300046513 Ga0495616_0003067 Ga0495616_0003067_8050_8742 215
171 3300046524 Ga0495648_0000030 Ga0495648_0000030_113747_114439 215
172 3300046528 Ga0495642_0010192 Ga0495642_0010192_1389_2081 215
173 3300046542 Ga0495597_0096180 Ga0495597_0096180_408_1100 215
174 3300046558 Ga0495633_0006214 Ga0495633_0006214_2522_3214 215
175 3300046616 Ga0495668_0004957 Ga0495668_0004957_5622_6314 215
176 3300046660 Ga0495625_0015782 Ga0495625_0015782_536_1195 215
177 3300046684 Ga0495669_0245093 Ga0495669_0245093_105_797 215
178 3300046691 Ga0495670_0001279 Ga0495670_0001279_2445_3137 215
179 3300046691 Ga0495670_0035491 Ga0495670_0035491_119_811 215
180 3300047323 Ga0495683_0000035 Ga0495683_0000035_46867_47559 215
181 3300047470 Ga0495681_0036505 Ga0495681_0036505_1336_2028 215
182 3300048915 Ga0496112_0283955 Ga0496112_0283955_360_1052 215
183 3300048919 Ga0496116_0017664 Ga0496116_0017664_322_981 215
184 3300048924 Ga0496121_0017043 Ga0496121_0017043_4603_5262 215
185 3300048924 Ga0496121_0150803 Ga0496121_0150803_458_1117 215
186 3300048925 Ga0496122_0000892 Ga0496122_0000892_4991_5650 215
187 3300048926 Ga0496123_0016949 Ga0496123_0016949_465_1124 215
188 3300048927 Ga0496124_0149691 Ga0496124_0149691_112_771 215
189 3300048928 Ga0496125_0003177 Ga0496125_0003177_3716_4375 215
190 3300048928 Ga0496125_0393547 Ga0496125_0393547_73_732 215
191 3300005337 Ga0070682_100095962 Ga0070682_1000959622 216
192 3300005337 Ga0070682_100331423 Ga0070682_1003314232 216
193 3300037312 Ga0395899_0003039 Ga0395899_0003039_4965_5672 216
194 3300037418 Ga0395900_0033177 Ga0395900_0033177_3002_3721 216
195 3300037418 Ga0395900_0273953 Ga0395900_0273953_741_1448 216
196 3300037471 Ga0395905_0007912 Ga0395905_0007912_9832_10494 216
197 3300037471 Ga0395905_0020159 Ga0395905_0020159_1605_2288 216
198 3300038443 Ga0395901_0002361 Ga0395901_0002361_11487_12176 216
199 3300038443 Ga0395901_0028808 Ga0395901_0028808_3149_3868 216
200 3300038443 Ga0395901_0029714 Ga0395901_0029714_640_1347 216
201 3300039447 Ga0436361_0749982 Ga0436361_0749982_134_799 216
202 3300044658 Ga0466972_0000221 Ga0466972_0000221_34848_35513 216
203 3300044658 Ga0466972_0080186 Ga0466972_0080186_457_1125 216
204 3300044683 Ga0466965_0005091 Ga0466965_0005091_894_1562 216
205 3300044706 Ga0466964_0017207 Ga0466964_0017207_758_1426 216
206 3300044735 Ga0466968_0017488 Ga0466968_0017488_570_1289 216
207 3300046492 Ga0495585_0002651 Ga0495585_0002651_4697_5398 216
208 3300046492 Ga0495585_0152672 Ga0495585_0152672_457_1158 216
209 3300046500 Ga0495596_0013604 Ga0495596_0013604_376_1077 216
210 3300046518 Ga0495631_0022433 Ga0495631_0022433_1906_2607 216
211 3300046523 Ga0495644_0017649 Ga0495644_0017649_875_1576 216
212 3300046538 Ga0495609_0002618 Ga0495609_0002618_1601_2302 216
213 3300046616 Ga0495668_0149396 Ga0495668_0149396_193_894 216
214 3300046648 Ga0495611_0016162 Ga0495611_0016162_1204_1905 216
215 3300047320 Ga0495672_0022940 Ga0495672_0022940_2625_3326 216
216 3300047321 Ga0495676_0047773 Ga0495676_0047773_280_981 216
217 3300047469 Ga0495673_0012567 Ga0495673_0012567_1665_2366 216
218 3300048924 Ga0496121_0191287 Ga0496121_0191287_133_825 216
219 3300049671 Ga0501238_002373 Ga0501238_002373_209_880 216
220 3300039447 Ga0436361_0130338 Ga0436361_0130338_3886_4539 217
221 3300053139 Ga0500568_0001605 Ga0500568_0001605_6186_6875 218
222 3300044656 Ga0466969_0017188 Ga0466969_0017188_2798_3463 219
223 3300048911 Ga0496108_0891392 Ga0496108_0891392_54_743 219
224 3300044668 Ga0466980_0139723 Ga0466980_0139723_709_1434 221
225 3300002067 JGI24735J21928_10001474 JGI24735J21928_100014747 222
226 3300005327 Ga0070658_10190184 Ga0070658_101901842 222
227 3300005367 Ga0070667_100186497 Ga0070667_1001864972 222
228 3300005455 Ga0070663_100070832 Ga0070663_1000708322 222
229 3300009011 Ga0105251_10005917 Ga0105251_100059173 222
230 3300009093 Ga0105240_10152995 Ga0105240_101529953 222
231 3300009174 Ga0105241_10279465 Ga0105241_102794652 222
232 3300009177 Ga0105248_10143522 Ga0105248_101435223 222
233 3300009545 Ga0105237_10523685 Ga0105237_105236852 222
234 3300011119 Ga0105246_10414496 Ga0105246_104144961 222
235 3300013105 Ga0157369_10086301 Ga0157369_100863012 222
236 3300013296 Ga0157374_10083013 Ga0157374_100830132 222
237 3300013297 Ga0157378_10801821 Ga0157378_108018212 222
238 3300013306 Ga0163162_10083773 Ga0163162_100837732 222
239 3300013308 Ga0157375_10450717 Ga0157375_104507172 222
240 3300025302 Ga0207426_1002025 Ga0207426_100202515 222
241 3300025903 Ga0207680_10444967 Ga0207680_104449672 222
242 3300025904 Ga0207647_10008442 Ga0207647_100084428 222
243 3300025911 Ga0207654_10151545 Ga0207654_101515452 222
244 3300025914 Ga0207671_10108981 Ga0207671_101089813 222
245 3300025924 Ga0207694_10178768 Ga0207694_101787682 222
246 3300025972 Ga0207668_10245467 Ga0207668_102454672 222
247 3300044693 Ga0466961_0087529 Ga0466961_0087529_424_1092 222
248 3300044842 Ga0466957_0413833 Ga0466957_0413833_144_812 222
249 3300045049 Ga0466959_0058771 Ga0466959_0058771_1814_2482 222
250 3300045976 Ga0466967_0714204 Ga0466967_0714204_227_895 222
251 3300046457 Ga0495590_0004633 Ga0495590_0004633_1169_1837 222
252 3300046459 Ga0495629_0000603 Ga0495629_0000603_21292_21960 222
253 3300046459 Ga0495629_0019005 Ga0495629_0019005_2109_2777 222
254 3300046460 Ga0495638_0032417 Ga0495638_0032417_2128_2796 222
255 3300046463 Ga0495653_0015485 Ga0495653_0015485_4503_5171 222
256 3300046471 Ga0495650_0001004 Ga0495650_0001004_7170_7838 222
257 3300046472 Ga0495580_0006350 Ga0495580_0006350_2711_3379 222
258 3300046472 Ga0495580_0281620 Ga0495580_0281620_352_1020 222
259 3300046474 Ga0495605_0000944 Ga0495605_0000944_9980_10648 222
260 3300046476 Ga0495662_0282864 Ga0495662_0282864_41_709 222
261 3300046477 Ga0495664_0046478 Ga0495664_0046478_1652_2320 222
262 3300046492 Ga0495585_0030000 Ga0495585_0030000_2399_3067 222
263 3300046501 Ga0495607_0131857 Ga0495607_0131857_531_1199 222
264 3300046506 Ga0495583_0121499 Ga0495583_0121499_311_979 222
265 3300046507 Ga0495606_0037283 Ga0495606_0037283_213_881 222
266 3300046516 Ga0495628_0005872 Ga0495628_0005872_6800_7468 222
267 3300046517 Ga0495630_0043518 Ga0495630_0043518_503_1171 222
268 3300046528 Ga0495642_0008215 Ga0495642_0008215_2918_3586 222
269 3300046529 Ga0495652_0005978 Ga0495652_0005978_3667_4335 222
270 3300046531 Ga0495665_0000847 Ga0495665_0000847_10278_10946 222
271 3300046535 Ga0495586_0144530 Ga0495586_0144530_76_744 222
272 3300046542 Ga0495597_0094486 Ga0495597_0094486_582_1250 222
273 3300046543 Ga0495645_0026100 Ga0495645_0026100_256_924 222
274 3300046559 Ga0495667_0024297 Ga0495667_0024297_2948_3616 222
275 3300046642 Ga0495634_0257244 Ga0495634_0257244_144_812 222
276 3300046674 Ga0495588_0110634 Ga0495588_0110634_399_1067 222
277 3300046678 Ga0495599_0161482 Ga0495599_0161482_265_933 222
278 3300046679 Ga0495623_0013929 Ga0495623_0013929_3528_4196 222
279 3300046680 Ga0495646_0080632 Ga0495646_0080632_688_1356 222
280 3300046684 Ga0495669_0011276 Ga0495669_0011276_755_1423 222
281 3300046684 Ga0495669_0019996 Ga0495669_0019996_1636_2304 222
282 3300046689 Ga0495613_0175314 Ga0495613_0175314_135_803 222
283 3300046690 Ga0495624_0003534 Ga0495624_0003534_3437_4105 222
284 3300046694 Ga0495649_0067014 Ga0495649_0067014_1161_1829 222
285 3300046794 Ga0495589_0065023 Ga0495589_0065023_385_1053 222
286 3300046809 Ga0495600_0012184 Ga0495600_0012184_1910_2578 222
287 3300046809 Ga0495600_0106645 Ga0495600_0106645_527_1195 222
288 3300047315 Ga0495581_0032311 Ga0495581_0032311_2188_2856 222
289 3300047317 Ga0495604_0027692 Ga0495604_0027692_1139_1807 222
290 3300047319 Ga0495674_0006203 Ga0495674_0006203_682_1350 222
291 3300047319 Ga0495674_0006309 Ga0495674_0006309_10517_11185 222
292 3300047322 Ga0495680_0050261 Ga0495680_0050261_168_836 222
293 3300047323 Ga0495683_0007116 Ga0495683_0007116_931_1599 222
294 3300047323 Ga0495683_0035969 Ga0495683_0035969_153_821 222
295 3300047443 Ga0495687_010042 Ga0495687_010042_2762_3472 222
296 3300047446 Ga0495679_019704 Ga0495679_019704_162_830 222
297 3300047673 Ga0495593_0012212 Ga0495593_0012212_602_1270 222
298 3300048088 Ga0495602_0007151 Ga0495602_0007151_4979_5647 222
299 3300048903 Ga0496100_0005294 Ga0496100_0005294_5768_6436 222
300 3300048903 Ga0496100_0252308 Ga0496100_0252308_339_1007 222
301 3300048904 Ga0496101_0010550 Ga0496101_0010550_3393_4061 222
302 3300048904 Ga0496101_0104932 Ga0496101_0104932_548_1216 222
303 3300048904 Ga0496101_0286517 Ga0496101_0286517_579_1247 222
304 3300048905 Ga0496102_0053499 Ga0496102_0053499_2605_3273 222
305 3300048906 Ga0496103_0002846 Ga0496103_0002846_1204_1872 222
306 3300048907 Ga0496104_0108943 Ga0496104_0108943_480_1148 222
307 3300048907 Ga0496104_0334559 Ga0496104_0334559_351_1019 222
308 3300048908 Ga0496105_0092897 Ga0496105_0092897_1126_1794 222
309 3300048909 Ga0496106_0027088 Ga0496106_0027088_2086_2754 222
310 3300048909 Ga0496106_0040209 Ga0496106_0040209_653_1321 222
311 3300048909 Ga0496106_0191487 Ga0496106_0191487_495_1163 222
312 3300048910 Ga0496107_0062093 Ga0496107_0062093_370_1038 222
313 3300048910 Ga0496107_0231494 Ga0496107_0231494_497_1165 222
314 3300048911 Ga0496108_0505761 Ga0496108_0505761_260_928 222
315 3300048912 Ga0496109_0415519 Ga0496109_0415519_272_940 222
316 3300048912 Ga0496109_0449056 Ga0496109_0449056_394_1062 222
317 3300048914 Ga0496111_0026446 Ga0496111_0026446_2276_2944 222
318 3300048916 Ga0496113_0206766 Ga0496113_0206766_510_1178 222
319 3300048917 Ga0496114_0021726 Ga0496114_0021726_839_1507 222
320 3300048917 Ga0496114_0264610 Ga0496114_0264610_644_1312 222
321 3300048918 Ga0496115_0077567 Ga0496115_0077567_1188_1856 222
322 3300048919 Ga0496116_0026925 Ga0496116_0026925_608_1276 222
323 3300048920 Ga0496117_0056734 Ga0496117_0056734_768_1436 222
324 3300048921 Ga0496118_0016310 Ga0496118_0016310_785_1453 222
325 3300048922 Ga0496119_0104676 Ga0496119_0104676_427_1095 222
326 3300048924 Ga0496121_0007566 Ga0496121_0007566_7600_8268 222
327 3300048925 Ga0496122_0035611 Ga0496122_0035611_2087_2755 222
328 3300048926 Ga0496123_0065386 Ga0496123_0065386_496_1164 222
329 3300048927 Ga0496124_0027699 Ga0496124_0027699_2180_2848 222
330 iso_pu_bacteria 2501025501 2501076439 222
331 iso_pu_bacteria 2501025504 2501412105 222
332 iso_pu_bacteria 2510917014 2511101739 222
333 iso_pu_bacteria 2510917015 2511107753 222
334 iso_pu_bacteria 2513237082 2513553471 222
335 iso_pu_bacteria 2513237083 2513559603 222
336 iso_pu_bacteria 2515154189 2516018040 222
337 iso_pu_bacteria 2883087390 2883088345 222
338 iso_pu_bacteria 8003955200 8003956554 222
339 3300048905 Ga0496102_0143693 Ga0496102_0143693_478_1152 224
340 3300048920 Ga0496117_0011341 Ga0496117_0011341_5933_6607 224
341 3300048921 Ga0496118_0009653 Ga0496118_0009653_6065_6739 224
342 3300048929 Ga0496126_0000032 Ga0496126_0000032_200396_201070 224
343 iso_pu_bacteria 2501025502 2501079873 224
344 iso_pu_bacteria 2510917013 2511087767 224
345 iso_pu_bacteria 2856287931 2856289743 227
346 iso_pu_bacteria 2857357740 2857363218 227
347 3300028800 Ga0265338_10000120 Ga0265338_10000120150 228
348 iso_pu_bacteria 2515154123 2515690299 228
349 iso_pu_bacteria 642555112 642596127 228
350 3300009011 Ga0105251_10000229 Ga0105251_1000022944 229
351 3300009177 Ga0105248_10221024 Ga0105248_102210242 229
352 3300015262 Ga0182007_10000599 Ga0182007_1000059918 229
353 3300016635 Ga0183361_10029 Ga0183361_1002927 229
354 3300025735 Ga0207713_1000201 Ga0207713_100020124 229
355 3300025904 Ga0207647_10012941 Ga0207647_100129414 229
356 3300048919 Ga0496116_0045220 Ga0496116_0045220_1720_2439 229
357 3300048921 Ga0496118_0025547 Ga0496118_0025547_3191_3889 229
358 3300048924 Ga0496121_0237310 Ga0496121_0237310_128_859 229
359 iso_pu_bacteria 2818991450 2819623809 229
360 iso_pu_bacteria 2928108538 2928112919 229
361 iso_pu_bacteria 2928135762 2928139848 229
362 iso_pu_bacteria 2928503688 2928506989 229
363 iso_pu_bacteria 2600255067 2600814076 230
364 iso_pu_bacteria 2842324504 2842326091 230
365 iso_pu_bacteria 2842348783 2842351389 230
366 iso_pu_bacteria 2842454564 2842455411 230
367 iso_pu_bacteria 2900634093 2900639407 230
368 iso_pu_bacteria 642555113 642617870 230
369 3300044683 Ga0466965_0000873 Ga0466965_0000873_8365_9060 231
370 3300044694 Ga0466963_0101884 Ga0466963_0101884_580_1275 231
371 3300044706 Ga0466964_0015494 Ga0466964_0015494_762_1457 231
372 3300045049 Ga0466959_0044750 Ga0466959_0044750_340_1035 231
373 3300045836 Ga0466958_0007558 Ga0466958_0007558_5141_5836 231
374 3300003323 rootH1_10230904 rootH1_102309042 232
375 3300025295 Ga0209564_1003018 Ga0209564_10030182 232
376 3300044656 Ga0466969_0013192 Ga0466969_0013192_2293_3003 232
377 3300044693 Ga0466961_0174006 Ga0466961_0174006_75_785 232
378 3300044765 Ga0466970_0075392 Ga0466970_0075392_530_1240 232
379 3300046513 Ga0495616_0164678 Ga0495616_0164678_169_876 232
380 3300048904 Ga0496101_0337911 Ga0496101_0337911_64_771 232
381 3300048908 Ga0496105_0097774 Ga0496105_0097774_1623_2330 232
382 3300048913 Ga0496110_0585424 Ga0496110_0585424_185_892 232
383 3300048915 Ga0496112_0006936 Ga0496112_0006936_7433_8140 232
384 3300048916 Ga0496113_0125646 Ga0496113_0125646_592_1299 232
385 3300048921 Ga0496118_0080913 Ga0496118_0080913_1159_1866 232
386 3300048929 Ga0496126_0005317 Ga0496126_0005317_10516_11223 232
387 3300046457 Ga0495590_0006989 Ga0495590_0006989_1343_2053 233
388 3300046471 Ga0495650_0005958 Ga0495650_0005958_3345_4055 233
389 3300046472 Ga0495580_0139794 Ga0495580_0139794_458_1168 233
390 3300046506 Ga0495583_0002629 Ga0495583_0002629_156_866 233
391 3300046538 Ga0495609_0112673 Ga0495609_0112673_88_798 233
392 3300046542 Ga0495597_0035020 Ga0495597_0035020_264_974 233
393 3300046616 Ga0495668_0214751 Ga0495668_0214751_327_1037 233
394 3300046665 Ga0495661_0045719 Ga0495661_0045719_582_1292 233
395 3300047319 Ga0495674_0086792 Ga0495674_0086792_83_793 233
396 3300047323 Ga0495683_0038327 Ga0495683_0038327_915_1625 233
397 3300047443 Ga0495687_015425 Ga0495687_015425_1384_2094 233
398 3300047446 Ga0495679_000104 Ga0495679_000104_70549_71259 233
399 3300047469 Ga0495673_0019520 Ga0495673_0019520_792_1502 233
400 3300047472 Ga0495686_0063235 Ga0495686_0063235_428_1138 233
401 3300048091 Ga0495626_0025254 Ga0495626_0025254_657_1367 233
402 3300048920 Ga0496117_0038898 Ga0496117_0038898_772_1482 233
403 3300048921 Ga0496118_0032723 Ga0496118_0032723_1353_2063 233
404 3300048924 Ga0496121_0004727 Ga0496121_0004727_7625_8335 233
405 3300048924 Ga0496121_0055488 Ga0496121_0055488_748_1458 233
406 3300048929 Ga0496126_0003005 Ga0496126_0003005_9525_10235 233
407 3300049459 Ga0495678_031545 Ga0495678_031545_851_1561 233
408 3300049460 Ga0495682_0033614 Ga0495682_0033614_1106_1816 233
409 iso_pu_bacteria 2510065045 2510248198 233
410 iso_pu_bacteria 2512047030 2512349873 233
411 iso_pu_bacteria 2515154122 2515684996 233
412 iso_pu_bacteria 2718217991 2719643373 233
413 iso_pu_bacteria 2885270888 2885276519 233
414 iso_pu_bacteria 2902682994 2902684027 233
415 3300002705 JGI25156J39149_1002634 JGI25156J39149_10026343 234
416 3300003214 JGI25165J46597_1001354 JGI25165J46597_10013549 234
417 3300003758 Ga0055532_1000069 Ga0055532_100006976 234
418 3300003760 Ga0055527_1000034 Ga0055527_100003476 234
419 3300003761 Ga0055535_1000049 Ga0055535_100004976 234
420 3300003762 Ga0055542_1000077 Ga0055542_100007757 234
421 3300003763 Ga0055529_1000090 Ga0055529_100009075 234
422 3300013105 Ga0157369_10090512 Ga0157369_100905123 234
423 3300025228 Ga0209672_100002 Ga0209672_1000021420 234
424 3300025229 Ga0209147_100003 Ga0209147_1000031420 234
425 3300025242 Ga0209258_100077 Ga0209258_10007775 234
426 3300025254 Ga0209148_1000006 Ga0209148_10000061420 234
427 3300025256 Ga0209759_1000170 Ga0209759_100017053 234
428 3300025256 Ga0209759_1000225 Ga0209759_100022558 234
429 3300025261 Ga0209233_1000177 Ga0209233_100017753 234
430 3300025272 Ga0209455_1000140 Ga0209455_100014055 234
431 3300031548 Ga0307408_100008884 Ga0307408_1000088843 234
432 3300031995 Ga0307409_100286642 Ga0307409_1002866422 234
433 3300032002 Ga0307416_100014850 Ga0307416_1000148503 234
434 3300046454 Ga0495592_0016781 Ga0495592_0016781_2854_3579 234
435 3300046455 Ga0495603_0050479 Ga0495603_0050479_958_1671 234
436 3300046459 Ga0495629_0000127 Ga0495629_0000127_4826_5539 234
437 3300046459 Ga0495629_0011187 Ga0495629_0011187_2836_3549 234
438 3300046459 Ga0495629_0051706 Ga0495629_0051706_391_1116 234
439 3300046461 Ga0495641_0006820 Ga0495641_0006820_3243_3956 234
440 3300046461 Ga0495641_0022933 Ga0495641_0022933_2011_2736 234
441 3300046462 Ga0495651_0073026 Ga0495651_0073026_387_1100 234
442 3300046463 Ga0495653_0002324 Ga0495653_0002324_7383_8096 234
443 3300046463 Ga0495653_0011271 Ga0495653_0011271_4133_4846 234
444 3300046463 Ga0495653_0092520 Ga0495653_0092520_698_1423 234
445 3300046471 Ga0495650_0008440 Ga0495650_0008440_3783_4496 234
446 3300046471 Ga0495650_0014635 Ga0495650_0014635_654_1379 234
447 3300046471 Ga0495650_0152519 Ga0495650_0152519_95_808 234
448 3300046472 Ga0495580_0001549 Ga0495580_0001549_1632_2345 234
449 3300046472 Ga0495580_0004838 Ga0495580_0004838_3624_4337 234
450 3300046473 Ga0495582_0004473 Ga0495582_0004473_2967_3680 234
451 3300046473 Ga0495582_0012596 Ga0495582_0012596_2799_3524 234
452 3300046476 Ga0495662_0020829 Ga0495662_0020829_733_1446 234
453 3300046477 Ga0495664_0001378 Ga0495664_0001378_140_853 234
454 3300046477 Ga0495664_0016627 Ga0495664_0016627_3411_4124 234
455 3300046477 Ga0495664_0183470 Ga0495664_0183470_526_1251 234
456 3300046499 Ga0495594_0093914 Ga0495594_0093914_235_948 234
457 3300046507 Ga0495606_0042780 Ga0495606_0042780_1764_2477 234
458 3300046511 Ga0495608_0024044 Ga0495608_0024044_2927_3652 234
459 3300046514 Ga0495618_0049117 Ga0495618_0049117_1559_2284 234
460 3300046514 Ga0495618_0056254 Ga0495618_0056254_623_1336 234
461 3300046516 Ga0495628_0005769 Ga0495628_0005769_7382_8095 234
462 3300046516 Ga0495628_0017050 Ga0495628_0017050_4770_5483 234
463 3300046516 Ga0495628_0052870 Ga0495628_0052870_1103_1816 234
464 3300046516 Ga0495628_0197993 Ga0495628_0197993_618_1343 234
465 3300046517 Ga0495630_0021737 Ga0495630_0021737_2026_2751 234
466 3300046517 Ga0495630_0034163 Ga0495630_0034163_116_829 234
467 3300046517 Ga0495630_0054868 Ga0495630_0054868_373_1086 234
468 3300046524 Ga0495648_0015785 Ga0495648_0015785_1893_2606 234
469 3300046524 Ga0495648_0071949 Ga0495648_0071949_702_1415 234
470 3300046524 Ga0495648_0081836 Ga0495648_0081836_983_1696 234
471 3300046526 Ga0495666_0013920 Ga0495666_0013920_1573_2298 234
472 3300046526 Ga0495666_0016408 Ga0495666_0016408_185_898 234
473 3300046529 Ga0495652_0020426 Ga0495652_0020426_3092_3817 234
474 3300046529 Ga0495652_0033538 Ga0495652_0033538_2967_3680 234
475 3300046531 Ga0495665_0014120 Ga0495665_0014120_3276_3989 234
476 3300046531 Ga0495665_0138519 Ga0495665_0138519_172_897 234
477 3300046531 Ga0495665_0156281 Ga0495665_0156281_395_1108 234
478 3300046533 Ga0495640_0031712 Ga0495640_0031712_2428_3153 234
479 3300046536 Ga0495587_0005949 Ga0495587_0005949_3485_4198 234
480 3300046543 Ga0495645_0002334 Ga0495645_0002334_580_1293 234
481 3300046559 Ga0495667_0147104 Ga0495667_0147104_140_865 234
482 3300046642 Ga0495634_0017475 Ga0495634_0017475_2886_3611 234
483 3300046642 Ga0495634_0101137 Ga0495634_0101137_545_1258 234
484 3300046648 Ga0495611_0027930 Ga0495611_0027930_1402_2115 234
485 3300046663 Ga0495635_0021864 Ga0495635_0021864_3357_4082 234
486 3300046665 Ga0495661_0000995 Ga0495661_0000995_23462_24175 234
487 3300046674 Ga0495588_0063201 Ga0495588_0063201_951_1664 234
488 3300046675 Ga0495657_0040168 Ga0495657_0040168_2022_2747 234
489 3300046675 Ga0495657_0238125 Ga0495657_0238125_137_850 234
490 3300046679 Ga0495623_0011654 Ga0495623_0011654_320_1033 234
491 3300046679 Ga0495623_0050698 Ga0495623_0050698_1732_2457 234
492 3300046680 Ga0495646_0021632 Ga0495646_0021632_3003_3716 234
493 3300046680 Ga0495646_0134970 Ga0495646_0134970_617_1342 234
494 3300046689 Ga0495613_0012331 Ga0495613_0012331_1504_2217 234
495 3300046690 Ga0495624_0008211 Ga0495624_0008211_4254_4967 234
496 3300046690 Ga0495624_0014142 Ga0495624_0014142_230_943 234
497 3300046690 Ga0495624_0039792 Ga0495624_0039792_172_897 234
498 3300046694 Ga0495649_0001361 Ga0495649_0001361_14565_15290 234
499 3300046794 Ga0495589_0039129 Ga0495589_0039129_437_1162 234
500 3300046809 Ga0495600_0051493 Ga0495600_0051493_1346_2071 234
501 3300047315 Ga0495581_0012898 Ga0495581_0012898_3308_4021 234
502 3300047315 Ga0495581_0024420 Ga0495581_0024420_1065_1790 234
503 3300047317 Ga0495604_0005547 Ga0495604_0005547_4353_5066 234
504 3300047317 Ga0495604_0259877 Ga0495604_0259877_44_769 234
505 3300047319 Ga0495674_0036618 Ga0495674_0036618_3308_4021 234
506 3300047319 Ga0495674_0109928 Ga0495674_0109928_1078_1791 234
507 3300047319 Ga0495674_0125753 Ga0495674_0125753_1267_1992 234
508 3300047321 Ga0495676_0108861 Ga0495676_0108861_400_1125 234
509 3300047322 Ga0495680_0004752 Ga0495680_0004752_4285_4998 234
510 3300047322 Ga0495680_0061842 Ga0495680_0061842_384_1097 234
511 3300047322 Ga0495680_0063766 Ga0495680_0063766_730_1455 234
512 3300047444 Ga0495675_0033736 Ga0495675_0033736_1734_2459 234
513 3300047444 Ga0495675_0079918 Ga0495675_0079918_278_991 234
514 3300047446 Ga0495679_003894 Ga0495679_003894_2461_3174 234
515 3300047471 Ga0495684_0134031 Ga0495684_0134031_1110_1823 234
516 3300047471 Ga0495684_0177554 Ga0495684_0177554_771_1484 234
517 3300047673 Ga0495593_0006096 Ga0495593_0006096_2103_2828 234
518 3300047673 Ga0495593_0010682 Ga0495593_0010682_4456_5169 234
519 3300048088 Ga0495602_0033357 Ga0495602_0033357_1152_1865 234
520 3300048088 Ga0495602_0108456 Ga0495602_0108456_728_1441 234
521 3300048088 Ga0495602_0357369 Ga0495602_0357369_156_881 234
522 3300048089 Ga0495614_0003568 Ga0495614_0003568_1632_2345 234
523 3300048089 Ga0495614_0009011 Ga0495614_0009011_653_1378 234
524 3300048929 Ga0496126_0006439 Ga0496126_0006439_3672_4385 234
525 iso_pu_bacteria 2744054900 2746090742 234
526 iso_pu_bacteria 2744054901 2746092397 234
527 iso_pu_bacteria 2751185846 2753567442 234
528 iso_pu_bacteria 2919527303 2919533476 234
529 3300021361 Ga0213872_10090753 Ga0213872_100907532 235
530 3300046523 Ga0495644_0059622 Ga0495644_0059622_258_977 236
531 3300046454 Ga0495592_0005360 Ga0495592_0005360_8723_9448 238
532 3300046458 Ga0495591_001444 Ga0495591_001444_4426_5151 238
533 3300046459 Ga0495629_0065528 Ga0495629_0065528_1792_2517 238
534 3300046462 Ga0495651_0006607 Ga0495651_0006607_4475_5200 238
535 3300046472 Ga0495580_0021793 Ga0495580_0021793_3878_4603 238
536 3300046500 Ga0495596_0005401 Ga0495596_0005401_3697_4422 238
537 3300046511 Ga0495608_0015899 Ga0495608_0015899_2389_3114 238
538 3300046514 Ga0495618_0029433 Ga0495618_0029433_19_744 238
539 3300046516 Ga0495628_0049185 Ga0495628_0049185_1222_1947 238
540 3300046517 Ga0495630_0015871 Ga0495630_0015871_2425_3150 238
541 3300046524 Ga0495648_0023216 Ga0495648_0023216_2079_2804 238
542 3300046526 Ga0495666_0011871 Ga0495666_0011871_1543_2268 238
543 3300046529 Ga0495652_0108468 Ga0495652_0108468_19_744 238
544 3300046533 Ga0495640_0020674 Ga0495640_0020674_2841_3566 238
545 3300046536 Ga0495587_0028884 Ga0495587_0028884_1642_2367 238
546 3300046557 Ga0495622_0000995 Ga0495622_0000995_6413_7159 238
547 3300046642 Ga0495634_0124473 Ga0495634_0124473_905_1630 238
548 3300046663 Ga0495635_0019323 Ga0495635_0019323_1349_2074 238
549 3300046665 Ga0495661_0005074 Ga0495661_0005074_7898_8623 238
550 3300046675 Ga0495657_0279075 Ga0495657_0279075_94_819 238
551 3300046679 Ga0495623_0025430 Ga0495623_0025430_1992_2717 238
552 3300046680 Ga0495646_0035597 Ga0495646_0035597_958_1683 238
553 3300046689 Ga0495613_0003616 Ga0495613_0003616_9092_9817 238
554 3300046690 Ga0495624_0084212 Ga0495624_0084212_19_744 238
555 3300046692 Ga0495671_0021947 Ga0495671_0021947_1516_2241 238
556 3300046794 Ga0495589_0002083 Ga0495589_0002083_8820_9545 238
557 3300046809 Ga0495600_0004954 Ga0495600_0004954_2374_3099 238
558 3300047315 Ga0495581_0014593 Ga0495581_0014593_1315_2040 238
559 3300047319 Ga0495674_0100333 Ga0495674_0100333_1222_1947 238
560 3300047321 Ga0495676_0021199 Ga0495676_0021199_3403_4128 238
561 3300047322 Ga0495680_0028711 Ga0495680_0028711_2430_3155 238
562 3300047323 Ga0495683_0006782 Ga0495683_0006782_3639_4364 238
563 3300047444 Ga0495675_0001845 Ga0495675_0001845_4480_5205 238
564 3300047446 Ga0495679_001217 Ga0495679_001217_13325_14050 238
565 3300047469 Ga0495673_0004318 Ga0495673_0004318_4384_5109 238
566 3300047673 Ga0495593_0005692 Ga0495593_0005692_4676_5401 238
567 3300048089 Ga0495614_0048160 Ga0495614_0048160_1033_1758 238
568 3300048905 Ga0496102_0014898 Ga0496102_0014898_1967_2692 238
569 3300048906 Ga0496103_0025808 Ga0496103_0025808_418_1143 238
570 3300048920 Ga0496117_0019578 Ga0496117_0019578_807_1532 238
571 3300048921 Ga0496118_0027194 Ga0496118_0027194_98_823 238
572 iso_pu_bacteria 2513237151 2513962746 238
573 3300001979 JGI24740J21852_10005813 JGI24740J21852_100058133 239
574 3300001989 JGI24739J22299_10005845 JGI24739J22299_100058453 239
575 3300002075 JGI24738J21930_10000246 JGI24738J21930_1000024613 239
576 3300005339 Ga0070660_100203612 Ga0070660_1002036122 239
577 3300005455 Ga0070663_100164165 Ga0070663_1001641652 239
578 3300009551 Ga0105238_10173488 Ga0105238_101734882 239
579 3300014969 Ga0157376_10360010 Ga0157376_103600102 239
580 3300025919 Ga0207657_10316247 Ga0207657_103162472 239
581 3300025949 Ga0207667_10112240 Ga0207667_101122402 239
582 3300026067 Ga0207678_10188094 Ga0207678_101880942 239
583 3300031911 Ga0307412_10000064 Ga0307412_1000006442 239
584 3300046474 Ga0495605_0012414 Ga0495605_0012414_3605_4327 239
585 3300046500 Ga0495596_0127819 Ga0495596_0127819_117_836 239
586 3300046512 Ga0495610_0014171 Ga0495610_0014171_3558_4277 239
587 3300046528 Ga0495642_0048998 Ga0495642_0048998_112_834 239
588 3300047443 Ga0495687_007209 Ga0495687_007209_4365_5084 239
589 3300048909 Ga0496106_0000083 Ga0496106_0000083_11309_12046 239
590 3300048920 Ga0496117_0018626 Ga0496117_0018626_4307_5026 239
591 3300048921 Ga0496118_0007399 Ga0496118_0007399_3245_3964 239
592 3300048924 Ga0496121_0002626 Ga0496121_0002626_17201_17938 239
593 iso_pu_bacteria 2508501125 2509130930 239
594 iso_pu_bacteria 2526164713 2527079646 239
595 iso_pu_bacteria 2738541296 2738823657 239
596 iso_pu_bacteria 2738541298 2738836079 239
597 iso_pu_bacteria 2738541306 2738877609 239
598 iso_pu_bacteria 2738543002 2739189284 239
599 iso_pu_bacteria 2738543008 2739224202 239
600 iso_pu_bacteria 2945934425 2945941034 239
601 iso_pu_bacteria 2990703756 2990708078 239
602 iso_pu_bacteria 641736151 642421895 239

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00697

PRAI

N-(5'phosphoribosyl)anthranilate (PRA) isomerase

37

241

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1lbm-assembly1.cif.gz_A crystal structure of phosphoribosyl anthranilate isomerase (prai) in complex with reduced 1-(o-carboxyphenylamino)-1-deoxyribulose 5-phosphate (rcdrp) 0.9371 26 235
1dl3-assembly1.cif.gz_A crystal structure of mutually generated monomers of dimeric phosphoribosylantranilate isomerase from thermotoga maritima 0.9317 26 234
1lbm-assembly1.cif.gz_A crystal structure of phosphoribosyl anthranilate isomerase (prai) in complex with reduced 1-(o-carboxyphenylamino)-1-deoxyribulose 5-phosphate (rcdrp) 0.9232 26 235
1dl3-assembly2.cif.gz_B crystal structure of mutually generated monomers of dimeric phosphoribosylantranilate isomerase from thermotoga maritima 0.9184 26 235
1nsj-assembly1.cif.gz_A-2 crystal structure of phosphoribosyl anthranilate isomerase from thermotoga maritima 0.9156 26 235
ID Description Score Start End Superfamily
1dl3A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9317 26 234 3.20.20.70
1dl3A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9131 26 234 3.20.20.70
af_P00909_260_447_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8864 31 229 3.20.20.70
af_P00909_260_447_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.873 31 229 3.20.20.70
4aajA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8683 25 235 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A7Z0FG75-F1-model_v4 deleted 0.9782 31 239
AF-I1XKU1-F1-model_v4 N-(5'-phosphoribosyl)anthranilate isomerase (PRAI) (EC 5.3.1.24) 0.9777 25 158 GO:0000162
GO:0004640
GO:0006568
AF-A0A3C1AM95-F1-model_v4 deleted 0.9696 26 148
AF-A0A7Z0FG75-F1-model_v4 deleted 0.9691 31 239
AF-A0A661DZE8-F1-model_v4 N-(5'-phosphoribosyl)anthranilate isomerase (EC 5.3.1.24) 0.9689 25 157 GO:0000162
GO:0004640
GO:0006568

Feature Viewer

pLDDT pTM Quality
86.83 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map