F468249

General Info

Members Datasets Scaffolds Average Seq Length
603 266 1206 102

Family's Representative Sequence

Representative Sequence 3300005439|Ga0070711_101220837|Ga0070711_1012208371
Length 112
Sequence VPRAELAPVWPAIGHSAVPADAIGSIETFITVFVSVYVLLIFAFILSSWVKLPYSPWLNRIQRFLYDVCEPYLRLFRRLLPTFGPLDLSPIIAILVLYVVQRVIITVLERLH

Samples

Sample ID Description Type Environment
1 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
56 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
57 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
85 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
86 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
87 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
102 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
103 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
105 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
154 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
157 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
158 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
159 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
160 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
161 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
162 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
163 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
164 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
165 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
166 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
167 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
169 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
170 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
171 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
172 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
173 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
174 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
175 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
176 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
177 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
178 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
179 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
180 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
181 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
182 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
183 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
184 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
185 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
186 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
187 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
188 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
189 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
190 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
191 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
192 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
193 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
194 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
195 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
196 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
197 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
198 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
199 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
200 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
201 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
202 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
203 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
204 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
205 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
206 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
207 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
208 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
209 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
210 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
211 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
212 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
213 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
214 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
215 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
216 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
217 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
218 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
219 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
220 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
221 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
222 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
223 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
224 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
225 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
226 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
227 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
228 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
229 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
230 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
231 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
232 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
233 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
234 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
235 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
236 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
237 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
238 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
239 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
240 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
241 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
242 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
243 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
244 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
245 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
246 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
247 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
248 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
249 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
250 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
251 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
252 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
253 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
254 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
255 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
256 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
257 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
258 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
259 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
260 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
261 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
262 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
263 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
264 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
265 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
266 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.67
Metatranscriptomes 1.33
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.16
Nodule 0
Rhizoplane 16.58
Rhizosphere 80.93
Stem 0
Stem Tuber 0
Unclassified 12.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070711_101220837 3300005439 Bacteria 651
2 Ga0058863_11769592 3300004799 Bacteria 847
3 Ga0058861_11765624 3300004800 Bacteria 714
4 Ga0070658_10111170 3300005327 Unclassified 2270
5 Ga0070658_10178148 3300005327 Bacteria 1788
6 Ga0070658_10350818 3300005327 Bacteria 1263
7 Ga0070683_100005463 3300005329 Bacteria 10618
8 Ga0070683_100007546 3300005329 Bacteria 9191
9 Ga0070683_100052937 3300005329 Bacteria 3761
10 Ga0070683_100227585 3300005329 Bacteria 1772
11 Ga0070683_100233741 3300005329 Bacteria 1748
12 Ga0070683_100540625 3300005329 Bacteria 1114
13 Ga0070690_100344418 3300005330 Bacteria 1080
14 Ga0068869_101583370 3300005334 Bacteria 583
15 Ga0070680_100008678 3300005336 Bacteria 7791
16 Ga0070680_100058288 3300005336 Bacteria 3158
17 Ga0070680_100074712 3300005336 Bacteria 2789
18 Ga0070680_101981305 3300005336 Bacteria 505
19 Ga0070682_100010000 3300005337 Bacteria 5373
20 Ga0070682_100609203 3300005337 Bacteria 863
21 Ga0068868_100030281 3300005338 Bacteria 4150
22 Ga0068868_101568786 3300005338 Bacteria 618
23 Ga0070660_100033989 3300005339 Bacteria 3848
24 Ga0070660_100058319 3300005339 Bacteria 2993
25 Ga0070660_100068686 3300005339 Bacteria 2763
26 Ga0070660_100715462 3300005339 Bacteria 840
27 Ga0070687_100462901 3300005343 Bacteria 846
28 Ga0070661_100095886 3300005344 Bacteria 2201
29 Ga0070692_10151776 3300005345 Bacteria 1320
30 Ga0070668_100581156 3300005347 Bacteria 978
31 Ga0070675_101404713 3300005354 Bacteria 644
32 Ga0070671_100452341 3300005355 Unclassified 1102
33 Ga0070659_100050426 3300005366 Bacteria 3272
34 Ga0070659_100051045 3300005366 Bacteria 3251
35 Ga0070659_101137690 3300005366 Bacteria 689
36 Ga0070703_10040055 3300005406 Bacteria 1455
37 Ga0070709_10004518 3300005434 Bacteria 7506
38 Ga0070709_10239470 3300005434 Unclassified 1302
39 Ga0070709_10768712 3300005434 Bacteria 754
40 Ga0070714_100007151 3300005435 Bacteria 8659
41 Ga0070714_100135410 3300005435 Unclassified 2205
42 Ga0070714_100853970 3300005435 Bacteria 883
43 Ga0070713_100015415 3300005436 Bacteria 5713
44 Ga0070713_100051791 3300005436 Bacteria 3397
45 Ga0070713_100662047 3300005436 Bacteria 995
46 Ga0070710_10000589 3300005437 Bacteria 17269
47 Ga0070710_10060757 3300005437 Bacteria 2150
48 Ga0070710_11152706 3300005437 Unclassified 571
49 Ga0070701_10244375 3300005438 Bacteria 1081
50 Ga0070701_10930879 3300005438 Unclassified 602
51 Ga0070711_100028555 3300005439 Bacteria 3672
52 Ga0070711_100059978 3300005439 Bacteria 2643
53 Ga0070705_101248109 3300005440 Bacteria 614
54 Ga0070694_100270560 3300005444 Bacteria 1292
55 Ga0070694_100396904 3300005444 Bacteria 1079
56 Ga0070708_100013462 3300005445 Bacteria 6700
57 Ga0070708_101295738 3300005445 Bacteria 681
58 Ga0070708_101315748 3300005445 Bacteria 675
59 Ga0070708_101438205 3300005445 Bacteria 643
60 Ga0070708_101625479 3300005445 Bacteria 601
61 Ga0070708_101781307 3300005445 Unclassified 572
62 Ga0070708_101849518 3300005445 Bacteria 560
63 Ga0070678_100003222 3300005456 Bacteria 9060
64 Ga0070678_100568595 3300005456 Bacteria 1008
65 Ga0070662_100509875 3300005457 Bacteria 1004
66 Ga0070662_100839828 3300005457 Bacteria 782
67 Ga0070681_10005979 3300005458 Bacteria 11789
68 Ga0070681_10119501 3300005458 Bacteria 2571
69 Ga0070681_10129514 3300005458 Bacteria 2455
70 Ga0070681_10187444 3300005458 Bacteria 1989
71 Ga0070681_10423841 3300005458 Bacteria 1243
72 Ga0068867_102318508 3300005459 Unclassified 510
73 Ga0070707_100110992 3300005468 Unclassified 2659
74 Ga0070707_100545290 3300005468 Bacteria 1122
75 Ga0070707_100832738 3300005468 Bacteria 887
76 Ga0070707_101336484 3300005468 Bacteria 683
77 Ga0070698_100053629 3300005471 Bacteria 4097
78 Ga0070698_100090673 3300005471 Bacteria 3040
79 Ga0070698_100874622 3300005471 Bacteria 844
80 Ga0070698_100874689 3300005471 Bacteria 844
81 Ga0070699_100061914 3300005518 Bacteria 3242
82 Ga0070679_100019233 3300005530 Bacteria 6637
83 Ga0070679_100129725 3300005530 Unclassified 2502
84 Ga0070679_100155438 3300005530 Bacteria 2262
85 Ga0070679_100199135 3300005530 Bacteria 1969
86 Ga0070679_100350122 3300005530 Bacteria 1425
87 Ga0070679_101654708 3300005530 Unclassified 588
88 Ga0070679_101864244 3300005530 Unclassified 550
89 Ga0070684_100017138 3300005535 Bacteria 5937
90 Ga0070684_100060928 3300005535 Bacteria 3302
91 Ga0070684_100196926 3300005535 Bacteria 1835
92 Ga0070684_100272553 3300005535 Bacteria 1549
93 Ga0070684_101483218 3300005535 Bacteria 639
94 Ga0070684_102327906 3300005535 Unclassified 505
95 Ga0070697_100055952 3300005536 Bacteria 3208
96 Ga0070697_100180694 3300005536 Unclassified 1788
97 Ga0070697_100756691 3300005536 Bacteria 859
98 Ga0068853_100082856 3300005539 Bacteria 2810
99 Ga0070695_100005103 3300005545 Bacteria 7737
100 Ga0070695_100469237 3300005545 Bacteria 968
101 Ga0070695_100547191 3300005545 Bacteria 902
102 Ga0070695_100884073 3300005545 Bacteria 721
103 Ga0070696_101157581 3300005546 Bacteria 652
104 Ga0070665_101034891 3300005548 Unclassified 833
105 Ga0070704_100171840 3300005549 Bacteria 1725
106 Ga0070704_101265409 3300005549 Bacteria 674
107 Ga0070704_101844844 3300005549 Bacteria 560
108 Ga0068855_100853581 3300005563 Bacteria 965
109 Ga0068855_101054284 3300005563 Bacteria 852
110 Ga0070664_100046670 3300005564 Bacteria 3659
111 Ga0070664_100914430 3300005564 Bacteria 823
112 Ga0068857_100453705 3300005577 Bacteria 1199
113 Ga0068854_100087354 3300005578 Bacteria 2313
114 Ga0068854_100818477 3300005578 Bacteria 813
115 Ga0068856_100035013 3300005614 Bacteria 4920
116 Ga0068856_100100048 3300005614 Bacteria 2891
117 Ga0068856_100226049 3300005614 Unclassified 1887
118 Ga0070702_100043548 3300005615 Bacteria 2530
119 Ga0070702_100643351 3300005615 Bacteria 801
120 Ga0068852_100139785 3300005616 Bacteria 2240
121 Ga0068852_101594212 3300005616 Bacteria 675
122 Ga0068852_101804820 3300005616 Bacteria 634
123 Ga0068859_101320526 3300005617 Bacteria 795
124 Ga0068866_10288864 3300005718 Bacteria 1019
125 Ga0068862_100164107 3300005844 Bacteria 1985
126 Ga0068862_100663743 3300005844 Bacteria 1007
127 Ga0081455_10021153 3300005937 Bacteria 6109
128 Ga0070717_10007774 3300006028 Bacteria 7980
129 Ga0070717_10078603 3300006028 Bacteria 2765
130 Ga0075365_10234004 3300006038 Bacteria 1290
131 Ga0075365_10327086 3300006038 Bacteria 1080
132 Ga0075364_11240125 3300006051 Unclassified 505
133 Ga0070715_10001156 3300006163 Bacteria 7557
134 Ga0070715_10314346 3300006163 Bacteria 843
135 Ga0070716_100001585 3300006173 Bacteria 10228
136 Ga0070716_100012415 3300006173 Bacteria 4318
137 Ga0070716_100064626 3300006173 Bacteria 2128
138 Ga0070716_100264823 3300006173 Bacteria 1178
139 Ga0070712_100217663 3300006175 Bacteria 1510
140 Ga0070712_100291581 3300006175 Bacteria 1317
141 Ga0097621_101624698 3300006237 Bacteria 615
142 Ga0068871_102284093 3300006358 Bacteria 516
143 Ga0075428_100304727 3300006844 Bacteria 1713
144 Ga0075428_100706486 3300006844 Bacteria 1074
145 Ga0075428_100795252 3300006844 Bacteria 1005
146 Ga0075430_101294065 3300006846 Bacteria 600
147 Ga0075431_100056395 3300006847 Bacteria 4052
148 Ga0075433_10385164 3300006852 Bacteria 1238
149 Ga0075429_100214881 3300006880 Bacteria 1685
150 Ga0097620_101320681 3300006931 Bacteria 795
151 Ga0075435_100451135 3300007076 Bacteria 1109
152 Ga0075435_101109574 3300007076 Bacteria 692
153 Ga0105244_10379942 3300009036 Bacteria 650
154 Ga0105240_10005428 3300009093 Bacteria 19003
155 Ga0105240_10202280 3300009093 Bacteria 2327
156 Ga0105240_10353266 3300009093 Bacteria 1667
157 Ga0105240_10489928 3300009093 Unclassified 1369
158 Ga0111539_10315307 3300009094 Bacteria 1820
159 Ga0105245_10002363 3300009098 Bacteria 17055
160 Ga0105245_10108887 3300009098 Bacteria 2574
161 Ga0105245_10322174 3300009098 Bacteria 1523
162 Ga0105245_10452199 3300009098 Bacteria 1293
163 Ga0105245_11755974 3300009098 Bacteria 673
164 Ga0105247_10066675 3300009101 Bacteria 2242
165 Ga0105247_10609179 3300009101 Bacteria 811
166 Ga0105247_10845313 3300009101 Bacteria 702
167 Ga0114129_11610047 3300009147 Bacteria 795
168 Ga0105243_10125864 3300009148 Bacteria 2168
169 Ga0105243_10380862 3300009148 Bacteria 1305
170 Ga0105243_11245589 3300009148 Bacteria 759
171 Ga0105241_10127395 3300009174 Bacteria 2057
172 Ga0105241_10194385 3300009174 Bacteria 1690
173 Ga0105241_10406015 3300009174 Bacteria 1196
174 Ga0105241_10829731 3300009174 Bacteria 853
175 Ga0105242_10068348 3300009176 Bacteria 2939
176 Ga0105242_11755462 3300009176 Bacteria 658
177 Ga0105248_10573398 3300009177 Bacteria 1273
178 Ga0105248_12243991 3300009177 Bacteria 621
179 Ga0105237_10199936 3300009545 Unclassified 1998
180 Ga0105237_11270385 3300009545 Bacteria 743
181 Ga0105237_11420040 3300009545 Bacteria 700
182 Ga0105237_11565920 3300009545 Bacteria 666
183 Ga0105238_10569333 3300009551 Bacteria 1138
184 Ga0105238_10694426 3300009551 Bacteria 1029
185 Ga0105238_10926295 3300009551 Bacteria 890
186 Ga0105238_11639883 3300009551 Unclassified 674
187 Ga0105249_10364461 3300009553 Bacteria 1467
188 Ga0105249_10372811 3300009553 Bacteria 1451
189 Ga0105249_10692959 3300009553 Unclassified 1078
190 Ga0105249_10739350 3300009553 Bacteria 1045
191 Ga0105239_10230714 3300010375 Bacteria 2077
192 Ga0105239_10239215 3300010375 Bacteria 2038
193 Ga0105239_10722649 3300010375 Bacteria 1139
194 Ga0105239_11194805 3300010375 Bacteria 876
195 Ga0105239_11506930 3300010375 Unclassified 777
196 Ga0105239_11686493 3300010375 Bacteria 733
197 Ga0105246_10078552 3300011119 Bacteria 2344
198 Ga0105246_11237062 3300011119 Bacteria 689
199 Ga0157336_1030578 3300012477 Bacteria 537
200 Ga0157347_1018474 3300012502 Bacteria 799
201 Ga0157342_1004103 3300012507 Bacteria 1279
202 Ga0157315_1033304 3300012508 Unclassified 617
203 Ga0157373_10125746 3300013100 Bacteria 1803
204 Ga0157373_11087048 3300013100 Bacteria 600
205 Ga0157371_10800473 3300013102 Bacteria 710
206 Ga0157370_10106645 3300013104 Bacteria 2622
207 Ga0157370_11223927 3300013104 Bacteria 677
208 Ga0157370_11440772 3300013104 Bacteria 620
209 Ga0157369_10004504 3300013105 Bacteria 16412
210 Ga0157369_10045245 3300013105 Bacteria 4788
211 Ga0157369_10795413 3300013105 Bacteria 972
212 Ga0157369_10929054 3300013105 Bacteria 892
213 Ga0157374_10028824 3300013296 Bacteria 5019
214 Ga0157374_10084293 3300013296 Bacteria 3021
215 Ga0157374_10443211 3300013296 Bacteria 1299
216 Ga0157374_10593161 3300013296 Bacteria 1117
217 Ga0157374_12533269 3300013296 Unclassified 540
218 Ga0157374_12752988 3300013296 Bacteria 519
219 Ga0157378_10196376 3300013297 Unclassified 1906
220 Ga0157378_10242882 3300013297 Bacteria 1721
221 Ga0163162_11136078 3300013306 Bacteria 886
222 Ga0157372_10005876 3300013307 Bacteria 13060
223 Ga0157372_10231243 3300013307 Bacteria 2144
224 Ga0157372_10449293 3300013307 Unclassified 1502
225 Ga0157372_11210536 3300013307 Bacteria 873
226 Ga0157372_11284598 3300013307 Bacteria 845
227 Ga0157372_12666174 3300013307 Unclassified 573
228 Ga0157375_10295890 3300013308 Bacteria 1782
229 Ga0157375_12103536 3300013308 Bacteria 672
230 Ga0157375_13652185 3300013308 Unclassified 512
231 Ga0163163_10370328 3300014325 Bacteria 1489
232 Ga0157377_10016803 3300014745 Bacteria 3771
233 Ga0157379_10857926 3300014968 Bacteria 860
234 Ga0157379_11760659 3300014968 Bacteria 608
235 Ga0157376_10306219 3300014969 Bacteria 1506
236 Ga0157376_11419378 3300014969 Unclassified 726
237 Ga0157376_12811505 3300014969 Bacteria 526
238 Ga0182007_10234934 3300015262 Bacteria 652
239 Ga0182005_1159325 3300015265 Unclassified 661
240 Ga0206356_10104702 3300020070 Bacteria 2178
241 Ga0206356_11143110 3300020070 Bacteria 1206
242 Ga0206355_1489610 3300020076 Unclassified 530
243 Ga0206350_11195411 3300020080 Bacteria 672
244 Ga0206353_12031984 3300020082 Bacteria 2897
245 Ga0224712_10088868 3300022467 Bacteria 1290
246 Ga0207653_10023404 3300025885 Bacteria 1967
247 Ga0207692_10001763 3300025898 Bacteria 8214
248 Ga0207710_10064183 3300025900 Bacteria 1672
249 Ga0207647_10439742 3300025904 Bacteria 732
250 Ga0207685_10043445 3300025905 Bacteria 1694
251 Ga0207699_10001650 3300025906 Bacteria 10571
252 Ga0207699_10404936 3300025906 Bacteria 972
253 Ga0207699_10715289 3300025906 Bacteria 734
254 Ga0207705_10072044 3300025909 Unclassified 2506
255 Ga0207705_10132721 3300025909 Bacteria 1854
256 Ga0207705_10230751 3300025909 Bacteria 1408
257 Ga0207654_10152567 3300025911 Bacteria 1484
258 Ga0207654_10635180 3300025911 Bacteria 764
259 Ga0207654_11054477 3300025911 Unclassified 592
260 Ga0207707_10028393 3300025912 Bacteria 4890
261 Ga0207707_10101056 3300025912 Bacteria 2520
262 Ga0207707_10164856 3300025912 Bacteria 1937
263 Ga0207707_10202488 3300025912 Bacteria 1730
264 Ga0207695_10027243 3300025913 Bacteria 6366
265 Ga0207695_10216720 3300025913 Bacteria 1823
266 Ga0207695_10285504 3300025913 Bacteria 1543
267 Ga0207671_10208212 3300025914 Bacteria 1529
268 Ga0207671_10529940 3300025914 Bacteria 939
269 Ga0207693_10000662 3300025915 Bacteria 30935
270 Ga0207693_10003428 3300025915 Bacteria 13527
271 Ga0207693_10160525 3300025915 Bacteria 1768
272 Ga0207693_10303774 3300025915 Bacteria 1250
273 Ga0207663_10000565 3300025916 Bacteria 16340
274 Ga0207663_10089591 3300025916 Bacteria 2037
275 Ga0207660_10007442 3300025917 Bacteria 7086
276 Ga0207660_10047570 3300025917 Bacteria 3033
277 Ga0207660_10329720 3300025917 Bacteria 1220
278 Ga0207660_10376828 3300025917 Bacteria 1140
279 Ga0207657_10000739 3300025919 Bacteria 34678
280 Ga0207657_10008781 3300025919 Bacteria 10227
281 Ga0207657_10030613 3300025919 Bacteria 4883
282 Ga0207649_10061616 3300025920 Bacteria 2362
283 Ga0207649_10309022 3300025920 Bacteria 1158
284 Ga0207649_10745300 3300025920 Bacteria 762
285 Ga0207652_10026188 3300025921 Bacteria 4854
286 Ga0207652_10033577 3300025921 Bacteria 4321
287 Ga0207652_10245352 3300025921 Bacteria 1615
288 Ga0207652_10527448 3300025921 Bacteria 1062
289 Ga0207652_10616296 3300025921 Bacteria 972
290 Ga0207652_10981926 3300025921 Unclassified 743
291 Ga0207646_10237298 3300025922 Bacteria 1647
292 Ga0207646_10447086 3300025922 Bacteria 1166
293 Ga0207681_10237627 3300025923 Bacteria 1417
294 Ga0207694_10405147 3300025924 Bacteria 1134
295 Ga0207694_11212971 3300025924 Bacteria 638
296 Ga0207659_10979185 3300025926 Bacteria 728
297 Ga0207687_10099357 3300025927 Bacteria 2138
298 Ga0207687_10199875 3300025927 Bacteria 1561
299 Ga0207700_10003047 3300025928 Bacteria 9669
300 Ga0207700_10858931 3300025928 Bacteria 812
301 Ga0207664_10005373 3300025929 Bacteria 8754
302 Ga0207664_10932838 3300025929 Bacteria 779
303 Ga0207664_11978587 3300025929 Unclassified 506
304 Ga0207644_10439671 3300025931 Bacteria 1070
305 Ga0207690_10126004 3300025932 Bacteria 1867
306 Ga0207690_10378339 3300025932 Bacteria 1125
307 Ga0207690_10839535 3300025932 Bacteria 760
308 Ga0207709_10078685 3300025935 Bacteria 2117
309 Ga0207665_10004251 3300025939 Bacteria 9518
310 Ga0207665_10021600 3300025939 Bacteria 4234
311 Ga0207665_10037509 3300025939 Bacteria 3226
312 Ga0207665_10103473 3300025939 Bacteria 1992
313 Ga0207691_11009918 3300025940 Unclassified 694
314 Ga0207711_11231276 3300025941 Bacteria 690
315 Ga0207689_10090728 3300025942 Bacteria 2511
316 Ga0207661_10011037 3300025944 Bacteria 6529
317 Ga0207661_10136284 3300025944 Bacteria 2108
318 Ga0207661_10182124 3300025944 Bacteria 1836
319 Ga0207661_10239910 3300025944 Bacteria 1608
320 Ga0207679_10204539 3300025945 Bacteria 1651
321 Ga0207667_10247904 3300025949 Bacteria 1822
322 Ga0207667_10748535 3300025949 Bacteria 977
323 Ga0207667_10837176 3300025949 Bacteria 915
324 Ga0207712_10570757 3300025961 Bacteria 975
325 Ga0207712_11137325 3300025961 Bacteria 696
326 Ga0207712_11334489 3300025961 Bacteria 641
327 Ga0207668_10506129 3300025972 Bacteria 1040
328 Ga0207640_10165868 3300025981 Bacteria 1640
329 Ga0207640_10268344 3300025981 Bacteria 1334
330 Ga0207640_10462097 3300025981 Bacteria 1048
331 Ga0207677_10019958 3300026023 Bacteria 4059
332 Ga0207639_10074732 3300026041 Bacteria 2662
333 Ga0207678_10282327 3300026067 Bacteria 1425
334 Ga0207708_11193053 3300026075 Bacteria 665
335 Ga0207702_10052319 3300026078 Bacteria 3455
336 Ga0207702_11410068 3300026078 Bacteria 690
337 Ga0207702_12455128 3300026078 Bacteria 508
338 Ga0207674_10355621 3300026116 Bacteria 1416
339 Ga0207674_11337600 3300026116 Bacteria 686
340 Ga0207683_10004028 3300026121 Bacteria 12708
341 Ga0207698_10275566 3300026142 Bacteria 1553
342 Ga0207698_11134476 3300026142 Bacteria 795
343 Ga0207428_10453888 3300027907 Unclassified 934
344 Ga0268265_10737994 3300028380 Unclassified 955
345 Ga0268264_11669741 3300028381 Bacteria 647
346 Ga0307410_11896756 3300031852 Unclassified 530
347 Ga0307412_11468317 3300031911 Unclassified 619
348 Ga0307409_100210954 3300031995 Unclassified 1745
349 Ga0307416_100058943 3300032002 Bacteria 3117
350 Ga0307416_100823691 3300032002 Unclassified 1025
351 Ga0307414_10191602 3300032004 Bacteria 1655
352 Ga0307415_100126724 3300032126 Bacteria 1925
353 Ga0373932_0289320 3300035112 Unclassified 608
354 Ga0373956_0047863 3300035119 Bacteria 1914
355 Ga0373955_0064179 3300035172 Bacteria 2035
356 Ga0373931_0236119 3300035691 Bacteria 1106
357 Ga0373933_0180915 3300035724 Bacteria 1345
358 Ga0373937_0027346 3300036401 Bacteria 5157
359 Ga0395899_0145263 3300037312 Bacteria 1685
360 Ga0395899_0226207 3300037312 Bacteria 1294
361 Ga0395899_0252968 3300037312 Bacteria 1208
362 Ga0395900_0017487 3300037418 Bacteria 7318
363 Ga0395900_0604005 3300037418 Bacteria 1037
364 Ga0395900_0767413 3300037418 Bacteria 894
365 Ga0395900_1106369 3300037418 Bacteria 709
366 Ga0395900_1623351 3300037418 Unclassified 558
367 Ga0395898_0036622 3300037466 Bacteria 4872
368 Ga0395898_0114420 3300037466 Bacteria 2585
369 Ga0395898_0236358 3300037466 Bacteria 1743
370 Ga0395898_0380652 3300037466 Bacteria 1346
371 Ga0395898_0790495 3300037466 Bacteria 889
372 Ga0395898_1120078 3300037466 Bacteria 720
373 Ga0395898_1453204 3300037466 Bacteria 612
374 Ga0395905_0197544 3300037471 Bacteria 1886
375 Ga0395905_0265128 3300037471 Bacteria 1603
376 Ga0395905_0280331 3300037471 Bacteria 1553
377 Ga0395905_0759092 3300037471 Bacteria 872
378 Ga0395901_0019608 3300038443 Bacteria 6913
379 Ga0395901_0050390 3300038443 Bacteria 4326
380 Ga0395901_0052105 3300038443 Bacteria 4254
381 Ga0395901_0080644 3300038443 Bacteria 3398
382 Ga0395901_0081441 3300038443 Bacteria 3381
383 Ga0395901_0179442 3300038443 Bacteria 2221
384 Ga0395901_0318956 3300038443 Bacteria 1608
385 Ga0395901_0445038 3300038443 Bacteria 1326
386 Ga0395901_1117854 3300038443 Bacteria 758
387 Ga0395901_1248963 3300038443 Bacteria 707
388 Ga0395901_1487518 3300038443 Bacteria 633
389 Ga0395901_1629349 3300038443 Unclassified 598
390 Ga0436360_0702089 3300039438 Bacteria 1757
391 Ga0451789_1030471 3300041443 Bacteria 1027
392 Ga0451793_0054843 3300041452 Bacteria 1060
393 Ga0451798_0163159 3300041458 Bacteria 931
394 Ga0451800_0727387 3300041459 Bacteria 2279
395 Ga0451802_0324980 3300041460 Bacteria 1420
396 Ga0451807_0005119 3300041486 Bacteria 2215
397 Ga0451807_0802826 3300041486 Bacteria 607
398 Ga0451833_1295374 3300041491 Bacteria 972
399 Ga0451835_0127843 3300041492 Bacteria 734
400 Ga0451845_0472794 3300041501 Bacteria 3690
401 Ga0451847_0504058 3300041503 Bacteria 1474
402 Ga0451851_1149583 3300041507 Unclassified 519
403 Ga0451843_0079376 3300041509 Bacteria 939
404 Ga0451855_1792993 3300041511 Bacteria 980
405 Ga0451853_2291318 3300041512 Bacteria 2788
406 Ga0450920_012612 3300042122 Bacteria 1587
407 Ga0450905_022705 3300042142 Bacteria 933
408 Ga0450916_062945 3300042530 Bacteria 606
409 Ga0466965_0497582 3300044683 Bacteria 683
410 Ga0466963_0002476 3300044694 Bacteria 10328
411 Ga0466963_0017814 3300044694 Bacteria 4432
412 Ga0466963_0018348 3300044694 Bacteria 4373
413 Ga0466963_0045020 3300044694 Bacteria 2905
414 Ga0466963_0308437 3300044694 Bacteria 1113
415 Ga0466964_0000569 3300044706 Bacteria 11600
416 Ga0466964_0009904 3300044706 Bacteria 3592
417 Ga0466964_0017873 3300044706 Unclassified 2716
418 Ga0466964_0165428 3300044706 Bacteria 1037
419 Ga0466964_0632341 3300044706 Unclassified 590
420 Ga0466971_0251810 3300044719 Bacteria 841
421 Ga0466968_0050510 3300044735 Bacteria 1775
422 Ga0466968_0080712 3300044735 Unclassified 1429
423 Ga0466968_0124320 3300044735 Bacteria 1169
424 Ga0466957_0027825 3300044842 Unclassified 3361
425 Ga0466957_0056601 3300044842 Bacteria 2398
426 Ga0466957_0282539 3300044842 Bacteria 1111
427 Ga0466957_0661254 3300044842 Bacteria 735
428 Ga0466960_0015647 3300044901 Bacteria 3275
429 Ga0466960_0089970 3300044901 Bacteria 1563
430 Ga0466960_0097690 3300044901 Bacteria 1507
431 Ga0466960_0123750 3300044901 Bacteria 1357
432 Ga0466960_0323204 3300044901 Bacteria 874
433 Ga0466959_0272994 3300045049 Viruses 1162
434 Ga0451576_2129098 3300045051 Bacteria 577
435 Ga0466958_0122597 3300045836 Bacteria 1628
436 Ga0466967_0032639 3300045976 Bacteria 4398
437 Ga0466967_0036019 3300045976 Bacteria 4220
438 Ga0466967_0057653 3300045976 Bacteria 3429
439 Ga0466967_0077440 3300045976 Bacteria 2993
440 Ga0466967_0194818 3300045976 Bacteria 1917
441 Ga0466967_0208355 3300045976 Bacteria 1853
442 Ga0466967_0275540 3300045976 Bacteria 1613
443 Ga0466967_0308196 3300045976 Unclassified 1524
444 Ga0466967_0320278 3300045976 Bacteria 1495
445 Ga0466967_1613333 3300045976 Unclassified 646
446 Ga0495592_0000100 3300046454 Bacteria 76535
447 Ga0495592_0024391 3300046454 Bacteria 4598
448 Ga0495603_0467758 3300046455 Bacteria 722
449 Ga0495629_0682523 3300046459 Bacteria 683
450 Ga0495641_0039338 3300046461 Bacteria 2206
451 Ga0495651_0000008 3300046462 Bacteria 156989
452 Ga0495653_0000519 3300046463 Bacteria 29635
453 Ga0495653_0250241 3300046463 Bacteria 1176
454 Ga0495639_0475811 3300046475 Unclassified 636
455 Ga0495664_0207275 3300046477 Bacteria 1187
456 Ga0495608_0002853 3300046511 Bacteria 12379
457 Ga0495608_0118129 3300046511 Archaea 1701
458 Ga0495618_0002283 3300046514 Bacteria 12422
459 Ga0495628_0001255 3300046516 Bacteria 23210
460 Ga0495628_0084698 3300046516 Bacteria 2459
461 Ga0495666_0402406 3300046526 Unclassified 615
462 Ga0495652_0000888 3300046529 Bacteria 34393
463 Ga0495652_0027787 3300046529 Bacteria 4983
464 Ga0495587_0000048 3300046536 Bacteria 105358
465 Ga0495645_0000029 3300046543 Bacteria 113119
466 Ga0495667_0040139 3300046559 Bacteria 3109
467 Ga0495656_0239461 3300046615 Unclassified 913
468 Ga0495634_0183632 3300046642 Unclassified 1308
469 Ga0495635_0530057 3300046663 Bacteria 773
470 Ga0495657_0028894 3300046675 Bacteria 3893
471 Ga0495599_0012836 3300046678 Bacteria 5170
472 Ga0495623_0000093 3300046679 Bacteria 53441
473 Ga0495646_0019787 3300046680 Bacteria 4257
474 Ga0495658_0021178 3300046683 Bacteria 3425
475 Ga0495658_0532841 3300046683 Bacteria 752
476 Ga0495604_0000111 3300047317 Bacteria 68576
477 Ga0495674_0044849 3300047319 Bacteria 3929
478 Ga0495676_0169451 3300047321 Bacteria 1538
479 Ga0495680_0022218 3300047322 Bacteria 5293
480 Ga0495680_0337532 3300047322 Bacteria 1052
481 Ga0495675_0000376 3300047444 Bacteria 30923
482 Ga0495675_0439832 3300047444 Unclassified 756
483 Ga0495593_0066709 3300047673 Bacteria 1875
484 Ga0495602_0000141 3300048088 Bacteria 67940
485 Ga0495602_0006548 3300048088 Bacteria 12215
486 Ga0496100_0006457 3300048903 Bacteria 6393
487 Ga0496100_0142904 3300048903 Bacteria 1698
488 Ga0496100_0283283 3300048903 Bacteria 1236
489 Ga0496100_1261350 3300048903 Unclassified 583
490 Ga0496101_0013813 3300048904 Bacteria 5420
491 Ga0496101_0125801 3300048904 Bacteria 1942
492 Ga0496101_0395330 3300048904 Bacteria 1088
493 Ga0496102_0016855 3300048905 Bacteria 6391
494 Ga0496102_0025083 3300048905 Bacteria 5304
495 Ga0496102_0025463 3300048905 Bacteria 5267
496 Ga0496102_0143185 3300048905 Bacteria 2242
497 Ga0496102_1305846 3300048905 Unclassified 645
498 Ga0496103_0274083 3300048906 Unclassified 1085
499 Ga0496103_0312793 3300048906 Bacteria 1010
500 Ga0496104_0001048 3300048907 Bacteria 23633
501 Ga0496104_0047160 3300048907 Bacteria 4060
502 Ga0496104_0331245 3300048907 Bacteria 1435
503 Ga0496104_0542053 3300048907 Bacteria 1074
504 Ga0496105_0000594 3300048908 Bacteria 24087
505 Ga0496105_0096561 3300048908 Bacteria 2441
506 Ga0496105_0103454 3300048908 Bacteria 2352
507 Ga0496105_0162972 3300048908 Bacteria 1830
508 Ga0496105_0334597 3300048908 Bacteria 1211
509 Ga0496105_1163646 3300048908 Unclassified 569
510 Ga0496106_0008985 3300048909 Bacteria 7382
511 Ga0496106_0038127 3300048909 Bacteria 3596
512 Ga0496107_0003633 3300048910 Bacteria 10359
513 Ga0496107_0073243 3300048910 Bacteria 2491
514 Ga0496107_0270588 3300048910 Bacteria 1264
515 Ga0496108_0010409 3300048911 Bacteria 7553
516 Ga0496108_0072278 3300048911 Bacteria 2911
517 Ga0496108_0107672 3300048911 Bacteria 2380
518 Ga0496108_0214817 3300048911 Bacteria 1670
519 Ga0496108_0280338 3300048911 Bacteria 1451
520 Ga0496108_0471573 3300048911 Bacteria 1097
521 Ga0496108_0583121 3300048911 Bacteria 975
522 Ga0496109_0000463 3300048912 Bacteria 34599
523 Ga0496109_0029226 3300048912 Bacteria 4936
524 Ga0496109_0043356 3300048912 Bacteria 4078
525 Ga0496109_0136237 3300048912 Bacteria 2294
526 Ga0496109_0145236 3300048912 Bacteria 2219
527 Ga0496109_0147833 3300048912 Bacteria 2199
528 Ga0496109_0312694 3300048912 Bacteria 1482
529 Ga0496109_0387732 3300048912 Bacteria 1320
530 Ga0496109_0691165 3300048912 Unclassified 957
531 Ga0496109_1023625 3300048912 Unclassified 763
532 Ga0496110_0000563 3300048913 Bacteria 25359
533 Ga0496110_0019029 3300048913 Bacteria 5771
534 Ga0496110_0020550 3300048913 Bacteria 5576
535 Ga0496110_0081594 3300048913 Bacteria 2883
536 Ga0496110_0104217 3300048913 Bacteria 2545
537 Ga0496110_0217112 3300048913 Bacteria 1739
538 Ga0496110_0236360 3300048913 Bacteria 1663
539 Ga0496110_0432449 3300048913 Bacteria 1199
540 Ga0496110_0685637 3300048913 Unclassified 925
541 Ga0496110_1582680 3300048913 Bacteria 565
542 Ga0496111_0006472 3300048914 Bacteria 7609
543 Ga0496111_0010323 3300048914 Bacteria 6261
544 Ga0496111_0037754 3300048914 Bacteria 3458
545 Ga0496111_0044912 3300048914 Bacteria 3177
546 Ga0496111_0183365 3300048914 Unclassified 1556
547 Ga0496111_0186871 3300048914 Bacteria 1540
548 Ga0496111_0234879 3300048914 Bacteria 1362
549 Ga0496111_0257755 3300048914 Bacteria 1294
550 Ga0496111_0539508 3300048914 Bacteria 857
551 Ga0496112_0016172 3300048915 Bacteria 6980
552 Ga0496112_0020985 3300048915 Bacteria 6203
553 Ga0496112_0135570 3300048915 Bacteria 2432
554 Ga0496112_0269566 3300048915 Bacteria 1651
555 Ga0496112_0482811 3300048915 Bacteria 1175
556 Ga0496112_0600292 3300048915 Unclassified 1033
557 Ga0496112_0881047 3300048915 Bacteria 818
558 Ga0496113_0056786 3300048916 Bacteria 2940
559 Ga0496113_0126259 3300048916 Bacteria 2004
560 Ga0496113_0131667 3300048916 Bacteria 1963
561 Ga0496113_0195362 3300048916 Bacteria 1607
562 Ga0496113_0244608 3300048916 Bacteria 1431
563 Ga0496113_0277480 3300048916 Bacteria 1340
564 Ga0496113_0323450 3300048916 Bacteria 1236
565 Ga0496113_0477973 3300048916 Bacteria 1001
566 Ga0496113_0928609 3300048916 Unclassified 687
567 Ga0496114_0000690 3300048917 Bacteria 25130
568 Ga0496114_0001144 3300048917 Bacteria 20053
569 Ga0496114_0025920 3300048917 Bacteria 4796
570 Ga0496114_0118681 3300048917 Bacteria 2273
571 Ga0496114_0218669 3300048917 Bacteria 1672
572 Ga0496114_0382879 3300048917 Bacteria 1245
573 Ga0496114_0628841 3300048917 Bacteria 945
574 Ga0496114_1733999 3300048917 Unclassified 513
575 Ga0496115_0014466 3300048918 Bacteria 5973
576 Ga0496115_0188501 3300048918 Bacteria 1704
577 Ga0496115_0660943 3300048918 Bacteria 825
578 Ga0496115_0696675 3300048918 Bacteria 799
579 Ga0501069_0488754 3300049585 Bacteria 734
580 Ga0501074_0331090 3300049590 Bacteria 1081
581 Ga0501075_1324423 3300049591 Bacteria 546
582 Ga0501076_1763484 3300049592 Unclassified 508
583 nmdc:mga03683_140091_c1 3300050489 Bacteria 1087
584 nmdc:mga00v17_312968_c1 3300050491 Bacteria 1020
585 nmdc:mga0yw44_35012_c1 3300050492 Bacteria 2947
586 nmdc:mga0yw44_794125_c1 3300050492 Bacteria 643
587 nmdc:mga09592_174129_c1 3300050508 Unclassified 1861
588 nmdc:mga08y16_204637_c1 3300050511 Bacteria 2045
589 nmdc:mga0n895_607240_c1 3300050512 Bacteria 1096
590 nmdc:mga0n895_92201_c1 3300050512 Bacteria 3032
591 nmdc:mga0rr50_1023321_c1 3300050513 Bacteria 703
592 nmdc:mga0rr50_1632811_c1 3300050513 Bacteria 544
593 nmdc:mga0rr50_514800_c1 3300050513 Bacteria 1018
594 nmdc:mga08x19_220463_c1 3300050514 Bacteria 1303
595 nmdc:mga08x19_507757_c1 3300050514 Bacteria 851
596 nmdc:mga0a205_215669_c1 3300050515 Unclassified 1806
597 nmdc:mga0a205_216636_c1 3300050515 Bacteria 1801
598 Ga0495601_0000206 3300053077 Bacteria 31438
599 Ga0495595_0397696 3300053084 Unclassified 698
600 Ga0495619_0000291 3300053085 Bacteria 35704
601 Ga0495619_1115876 3300053085 Unclassified 524
602 Ga0501084_0205119 3300054114 Bacteria 1664
603 Ga0501082_0100046 3300060353 Bacteria 2507
604 Ga0070711_101220837
605 Ga0058863_11769592
606 Ga0058861_11765624
607 Ga0070658_10111170
608 Ga0070658_10178148
609 Ga0070658_10350818
610 Ga0070683_100005463
611 Ga0070683_100007546
612 Ga0070683_100052937
613 Ga0070683_100227585
614 Ga0070683_100233741
615 Ga0070683_100540625
616 Ga0070690_100344418
617 Ga0068869_101583370
618 Ga0070680_100008678
619 Ga0070680_100058288
620 Ga0070680_100074712
621 Ga0070680_101981305
622 Ga0070682_100010000
623 Ga0070682_100609203
624 Ga0068868_100030281
625 Ga0068868_101568786
626 Ga0070660_100033989
627 Ga0070660_100058319
628 Ga0070660_100068686
629 Ga0070660_100715462
630 Ga0070687_100462901
631 Ga0070661_100095886
632 Ga0070692_10151776
633 Ga0070668_100581156
634 Ga0070675_101404713
635 Ga0070671_100452341
636 Ga0070659_100050426
637 Ga0070659_100051045
638 Ga0070659_101137690
639 Ga0070703_10040055
640 Ga0070709_10004518
641 Ga0070709_10239470
642 Ga0070709_10768712
643 Ga0070714_100007151
644 Ga0070714_100135410
645 Ga0070714_100853970
646 Ga0070713_100015415
647 Ga0070713_100051791
648 Ga0070713_100662047
649 Ga0070710_10000589
650 Ga0070710_10060757
651 Ga0070710_11152706
652 Ga0070701_10244375
653 Ga0070701_10930879
654 Ga0070711_100028555
655 Ga0070711_100059978
656 Ga0070705_101248109
657 Ga0070694_100270560
658 Ga0070694_100396904
659 Ga0070708_100013462
660 Ga0070708_101295738
661 Ga0070708_101315748
662 Ga0070708_101438205
663 Ga0070708_101625479
664 Ga0070708_101781307
665 Ga0070708_101849518
666 Ga0070678_100003222
667 Ga0070678_100568595
668 Ga0070662_100509875
669 Ga0070662_100839828
670 Ga0070681_10005979
671 Ga0070681_10119501
672 Ga0070681_10129514
673 Ga0070681_10187444
674 Ga0070681_10423841
675 Ga0068867_102318508
676 Ga0070707_100110992
677 Ga0070707_100545290
678 Ga0070707_100832738
679 Ga0070707_101336484
680 Ga0070698_100053629
681 Ga0070698_100090673
682 Ga0070698_100874622
683 Ga0070698_100874689
684 Ga0070699_100061914
685 Ga0070679_100019233
686 Ga0070679_100129725
687 Ga0070679_100155438
688 Ga0070679_100199135
689 Ga0070679_100350122
690 Ga0070679_101654708
691 Ga0070679_101864244
692 Ga0070684_100017138
693 Ga0070684_100060928
694 Ga0070684_100196926
695 Ga0070684_100272553
696 Ga0070684_101483218
697 Ga0070684_102327906
698 Ga0070697_100055952
699 Ga0070697_100180694
700 Ga0070697_100756691
701 Ga0068853_100082856
702 Ga0070695_100005103
703 Ga0070695_100469237
704 Ga0070695_100547191
705 Ga0070695_100884073
706 Ga0070696_101157581
707 Ga0070665_101034891
708 Ga0070704_100171840
709 Ga0070704_101265409
710 Ga0070704_101844844
711 Ga0068855_100853581
712 Ga0068855_101054284
713 Ga0070664_100046670
714 Ga0070664_100914430
715 Ga0068857_100453705
716 Ga0068854_100087354
717 Ga0068854_100818477
718 Ga0068856_100035013
719 Ga0068856_100100048
720 Ga0068856_100226049
721 Ga0070702_100043548
722 Ga0070702_100643351
723 Ga0068852_100139785
724 Ga0068852_101594212
725 Ga0068852_101804820
726 Ga0068859_101320526
727 Ga0068866_10288864
728 Ga0068862_100164107
729 Ga0068862_100663743
730 Ga0081455_10021153
731 Ga0070717_10007774
732 Ga0070717_10078603
733 Ga0075365_10234004
734 Ga0075365_10327086
735 Ga0075364_11240125
736 Ga0070715_10001156
737 Ga0070715_10314346
738 Ga0070716_100001585
739 Ga0070716_100012415
740 Ga0070716_100064626
741 Ga0070716_100264823
742 Ga0070712_100217663
743 Ga0070712_100291581
744 Ga0097621_101624698
745 Ga0068871_102284093
746 Ga0075428_100304727
747 Ga0075428_100706486
748 Ga0075428_100795252
749 Ga0075430_101294065
750 Ga0075431_100056395
751 Ga0075433_10385164
752 Ga0075429_100214881
753 Ga0097620_101320681
754 Ga0075435_100451135
755 Ga0075435_101109574
756 Ga0105244_10379942
757 Ga0105240_10005428
758 Ga0105240_10202280
759 Ga0105240_10353266
760 Ga0105240_10489928
761 Ga0111539_10315307
762 Ga0105245_10002363
763 Ga0105245_10108887
764 Ga0105245_10322174
765 Ga0105245_10452199
766 Ga0105245_11755974
767 Ga0105247_10066675
768 Ga0105247_10609179
769 Ga0105247_10845313
770 Ga0114129_11610047
771 Ga0105243_10125864
772 Ga0105243_10380862
773 Ga0105243_11245589
774 Ga0105241_10127395
775 Ga0105241_10194385
776 Ga0105241_10406015
777 Ga0105241_10829731
778 Ga0105242_10068348
779 Ga0105242_11755462
780 Ga0105248_10573398
781 Ga0105248_12243991
782 Ga0105237_10199936
783 Ga0105237_11270385
784 Ga0105237_11420040
785 Ga0105237_11565920
786 Ga0105238_10569333
787 Ga0105238_10694426
788 Ga0105238_10926295
789 Ga0105238_11639883
790 Ga0105249_10364461
791 Ga0105249_10372811
792 Ga0105249_10692959
793 Ga0105249_10739350
794 Ga0105239_10230714
795 Ga0105239_10239215
796 Ga0105239_10722649
797 Ga0105239_11194805
798 Ga0105239_11506930
799 Ga0105239_11686493
800 Ga0105246_10078552
801 Ga0105246_11237062
802 Ga0157336_1030578
803 Ga0157347_1018474
804 Ga0157342_1004103
805 Ga0157315_1033304
806 Ga0157373_10125746
807 Ga0157373_11087048
808 Ga0157371_10800473
809 Ga0157370_10106645
810 Ga0157370_11223927
811 Ga0157370_11440772
812 Ga0157369_10004504
813 Ga0157369_10045245
814 Ga0157369_10795413
815 Ga0157369_10929054
816 Ga0157374_10028824
817 Ga0157374_10084293
818 Ga0157374_10443211
819 Ga0157374_10593161
820 Ga0157374_12533269
821 Ga0157374_12752988
822 Ga0157378_10196376
823 Ga0157378_10242882
824 Ga0163162_11136078
825 Ga0157372_10005876
826 Ga0157372_10231243
827 Ga0157372_10449293
828 Ga0157372_11210536
829 Ga0157372_11284598
830 Ga0157372_12666174
831 Ga0157375_10295890
832 Ga0157375_12103536
833 Ga0157375_13652185
834 Ga0163163_10370328
835 Ga0157377_10016803
836 Ga0157379_10857926
837 Ga0157379_11760659
838 Ga0157376_10306219
839 Ga0157376_11419378
840 Ga0157376_12811505
841 Ga0182007_10234934
842 Ga0182005_1159325
843 Ga0206356_10104702
844 Ga0206356_11143110
845 Ga0206355_1489610
846 Ga0206350_11195411
847 Ga0206353_12031984
848 Ga0224712_10088868
849 Ga0207653_10023404
850 Ga0207692_10001763
851 Ga0207710_10064183
852 Ga0207647_10439742
853 Ga0207685_10043445
854 Ga0207699_10001650
855 Ga0207699_10404936
856 Ga0207699_10715289
857 Ga0207705_10072044
858 Ga0207705_10132721
859 Ga0207705_10230751
860 Ga0207654_10152567
861 Ga0207654_10635180
862 Ga0207654_11054477
863 Ga0207707_10028393
864 Ga0207707_10101056
865 Ga0207707_10164856
866 Ga0207707_10202488
867 Ga0207695_10027243
868 Ga0207695_10216720
869 Ga0207695_10285504
870 Ga0207671_10208212
871 Ga0207671_10529940
872 Ga0207693_10000662
873 Ga0207693_10003428
874 Ga0207693_10160525
875 Ga0207693_10303774
876 Ga0207663_10000565
877 Ga0207663_10089591
878 Ga0207660_10007442
879 Ga0207660_10047570
880 Ga0207660_10329720
881 Ga0207660_10376828
882 Ga0207657_10000739
883 Ga0207657_10008781
884 Ga0207657_10030613
885 Ga0207649_10061616
886 Ga0207649_10309022
887 Ga0207649_10745300
888 Ga0207652_10026188
889 Ga0207652_10033577
890 Ga0207652_10245352
891 Ga0207652_10527448
892 Ga0207652_10616296
893 Ga0207652_10981926
894 Ga0207646_10237298
895 Ga0207646_10447086
896 Ga0207681_10237627
897 Ga0207694_10405147
898 Ga0207694_11212971
899 Ga0207659_10979185
900 Ga0207687_10099357
901 Ga0207687_10199875
902 Ga0207700_10003047
903 Ga0207700_10858931
904 Ga0207664_10005373
905 Ga0207664_10932838
906 Ga0207664_11978587
907 Ga0207644_10439671
908 Ga0207690_10126004
909 Ga0207690_10378339
910 Ga0207690_10839535
911 Ga0207709_10078685
912 Ga0207665_10004251
913 Ga0207665_10021600
914 Ga0207665_10037509
915 Ga0207665_10103473
916 Ga0207691_11009918
917 Ga0207711_11231276
918 Ga0207689_10090728
919 Ga0207661_10011037
920 Ga0207661_10136284
921 Ga0207661_10182124
922 Ga0207661_10239910
923 Ga0207679_10204539
924 Ga0207667_10247904
925 Ga0207667_10748535
926 Ga0207667_10837176
927 Ga0207712_10570757
928 Ga0207712_11137325
929 Ga0207712_11334489
930 Ga0207668_10506129
931 Ga0207640_10165868
932 Ga0207640_10268344
933 Ga0207640_10462097
934 Ga0207677_10019958
935 Ga0207639_10074732
936 Ga0207678_10282327
937 Ga0207708_11193053
938 Ga0207702_10052319
939 Ga0207702_11410068
940 Ga0207702_12455128
941 Ga0207674_10355621
942 Ga0207674_11337600
943 Ga0207683_10004028
944 Ga0207698_10275566
945 Ga0207698_11134476
946 Ga0207428_10453888
947 Ga0268265_10737994
948 Ga0268264_11669741
949 Ga0307410_11896756
950 Ga0307412_11468317
951 Ga0307409_100210954
952 Ga0307416_100058943
953 Ga0307416_100823691
954 Ga0307414_10191602
955 Ga0307415_100126724
956 Ga0373932_0289320
957 Ga0373956_0047863
958 Ga0373955_0064179
959 Ga0373931_0236119
960 Ga0373933_0180915
961 Ga0373937_0027346
962 Ga0395899_0145263
963 Ga0395899_0226207
964 Ga0395899_0252968
965 Ga0395900_0017487
966 Ga0395900_0604005
967 Ga0395900_0767413
968 Ga0395900_1106369
969 Ga0395900_1623351
970 Ga0395898_0036622
971 Ga0395898_0114420
972 Ga0395898_0236358
973 Ga0395898_0380652
974 Ga0395898_0790495
975 Ga0395898_1120078
976 Ga0395898_1453204
977 Ga0395905_0197544
978 Ga0395905_0265128
979 Ga0395905_0280331
980 Ga0395905_0759092
981 Ga0395901_0019608
982 Ga0395901_0050390
983 Ga0395901_0052105
984 Ga0395901_0080644
985 Ga0395901_0081441
986 Ga0395901_0179442
987 Ga0395901_0318956
988 Ga0395901_0445038
989 Ga0395901_1117854
990 Ga0395901_1248963
991 Ga0395901_1487518
992 Ga0395901_1629349
993 Ga0436360_0702089
994 Ga0451789_1030471
995 Ga0451793_0054843
996 Ga0451798_0163159
997 Ga0451800_0727387
998 Ga0451802_0324980
999 Ga0451807_0005119
1000 Ga0451807_0802826
1001 Ga0451833_1295374
1002 Ga0451835_0127843
1003 Ga0451845_0472794
1004 Ga0451847_0504058
1005 Ga0451851_1149583
1006 Ga0451843_0079376
1007 Ga0451855_1792993
1008 Ga0451853_2291318
1009 Ga0450920_012612
1010 Ga0450905_022705
1011 Ga0450916_062945
1012 Ga0466965_0497582
1013 Ga0466963_0002476
1014 Ga0466963_0017814
1015 Ga0466963_0018348
1016 Ga0466963_0045020
1017 Ga0466963_0308437
1018 Ga0466964_0000569
1019 Ga0466964_0009904
1020 Ga0466964_0017873
1021 Ga0466964_0165428
1022 Ga0466964_0632341
1023 Ga0466971_0251810
1024 Ga0466968_0050510
1025 Ga0466968_0080712
1026 Ga0466968_0124320
1027 Ga0466957_0027825
1028 Ga0466957_0056601
1029 Ga0466957_0282539
1030 Ga0466957_0661254
1031 Ga0466960_0015647
1032 Ga0466960_0089970
1033 Ga0466960_0097690
1034 Ga0466960_0123750
1035 Ga0466960_0323204
1036 Ga0466959_0272994
1037 Ga0451576_2129098
1038 Ga0466958_0122597
1039 Ga0466967_0032639
1040 Ga0466967_0036019
1041 Ga0466967_0057653
1042 Ga0466967_0077440
1043 Ga0466967_0194818
1044 Ga0466967_0208355
1045 Ga0466967_0275540
1046 Ga0466967_0308196
1047 Ga0466967_0320278
1048 Ga0466967_1613333
1049 Ga0495592_0000100
1050 Ga0495592_0024391
1051 Ga0495603_0467758
1052 Ga0495629_0682523
1053 Ga0495641_0039338
1054 Ga0495651_0000008
1055 Ga0495653_0000519
1056 Ga0495653_0250241
1057 Ga0495639_0475811
1058 Ga0495664_0207275
1059 Ga0495608_0002853
1060 Ga0495608_0118129
1061 Ga0495618_0002283
1062 Ga0495628_0001255
1063 Ga0495628_0084698
1064 Ga0495666_0402406
1065 Ga0495652_0000888
1066 Ga0495652_0027787
1067 Ga0495587_0000048
1068 Ga0495645_0000029
1069 Ga0495667_0040139
1070 Ga0495656_0239461
1071 Ga0495634_0183632
1072 Ga0495635_0530057
1073 Ga0495657_0028894
1074 Ga0495599_0012836
1075 Ga0495623_0000093
1076 Ga0495646_0019787
1077 Ga0495658_0021178
1078 Ga0495658_0532841
1079 Ga0495604_0000111
1080 Ga0495674_0044849
1081 Ga0495676_0169451
1082 Ga0495680_0022218
1083 Ga0495680_0337532
1084 Ga0495675_0000376
1085 Ga0495675_0439832
1086 Ga0495593_0066709
1087 Ga0495602_0000141
1088 Ga0495602_0006548
1089 Ga0496100_0006457
1090 Ga0496100_0142904
1091 Ga0496100_0283283
1092 Ga0496100_1261350
1093 Ga0496101_0013813
1094 Ga0496101_0125801
1095 Ga0496101_0395330
1096 Ga0496102_0016855
1097 Ga0496102_0025083
1098 Ga0496102_0025463
1099 Ga0496102_0143185
1100 Ga0496102_1305846
1101 Ga0496103_0274083
1102 Ga0496103_0312793
1103 Ga0496104_0001048
1104 Ga0496104_0047160
1105 Ga0496104_0331245
1106 Ga0496104_0542053
1107 Ga0496105_0000594
1108 Ga0496105_0096561
1109 Ga0496105_0103454
1110 Ga0496105_0162972
1111 Ga0496105_0334597
1112 Ga0496105_1163646
1113 Ga0496106_0008985
1114 Ga0496106_0038127
1115 Ga0496107_0003633
1116 Ga0496107_0073243
1117 Ga0496107_0270588
1118 Ga0496108_0010409
1119 Ga0496108_0072278
1120 Ga0496108_0107672
1121 Ga0496108_0214817
1122 Ga0496108_0280338
1123 Ga0496108_0471573
1124 Ga0496108_0583121
1125 Ga0496109_0000463
1126 Ga0496109_0029226
1127 Ga0496109_0043356
1128 Ga0496109_0136237
1129 Ga0496109_0145236
1130 Ga0496109_0147833
1131 Ga0496109_0312694
1132 Ga0496109_0387732
1133 Ga0496109_0691165
1134 Ga0496109_1023625
1135 Ga0496110_0000563
1136 Ga0496110_0019029
1137 Ga0496110_0020550
1138 Ga0496110_0081594
1139 Ga0496110_0104217
1140 Ga0496110_0217112
1141 Ga0496110_0236360
1142 Ga0496110_0432449
1143 Ga0496110_0685637
1144 Ga0496110_1582680
1145 Ga0496111_0006472
1146 Ga0496111_0010323
1147 Ga0496111_0037754
1148 Ga0496111_0044912
1149 Ga0496111_0183365
1150 Ga0496111_0186871
1151 Ga0496111_0234879
1152 Ga0496111_0257755
1153 Ga0496111_0539508
1154 Ga0496112_0016172
1155 Ga0496112_0020985
1156 Ga0496112_0135570
1157 Ga0496112_0269566
1158 Ga0496112_0482811
1159 Ga0496112_0600292
1160 Ga0496112_0881047
1161 Ga0496113_0056786
1162 Ga0496113_0126259
1163 Ga0496113_0131667
1164 Ga0496113_0195362
1165 Ga0496113_0244608
1166 Ga0496113_0277480
1167 Ga0496113_0323450
1168 Ga0496113_0477973
1169 Ga0496113_0928609
1170 Ga0496114_0000690
1171 Ga0496114_0001144
1172 Ga0496114_0025920
1173 Ga0496114_0118681
1174 Ga0496114_0218669
1175 Ga0496114_0382879
1176 Ga0496114_0628841
1177 Ga0496114_1733999
1178 Ga0496115_0014466
1179 Ga0496115_0188501
1180 Ga0496115_0660943
1181 Ga0496115_0696675
1182 Ga0501069_0488754
1183 Ga0501074_0331090
1184 Ga0501075_1324423
1185 Ga0501076_1763484
1186 nmdc:mga03683_140091_c1
1187 nmdc:mga00v17_312968_c1
1188 nmdc:mga0yw44_35012_c1
1189 nmdc:mga0yw44_794125_c1
1190 nmdc:mga09592_174129_c1
1191 nmdc:mga08y16_204637_c1
1192 nmdc:mga0n895_607240_c1
1193 nmdc:mga0n895_92201_c1
1194 nmdc:mga0rr50_1023321_c1
1195 nmdc:mga0rr50_1632811_c1
1196 nmdc:mga0rr50_514800_c1
1197 nmdc:mga08x19_220463_c1
1198 nmdc:mga08x19_507757_c1
1199 nmdc:mga0a205_215669_c1
1200 nmdc:mga0a205_216636_c1
1201 Ga0495601_0000206
1202 Ga0495595_0397696
1203 Ga0495619_0000291
1204 Ga0495619_1115876
1205 Ga0501084_0205119
1206 Ga0501082_0100046

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02325

YGGT

YGGT family

31

104

0.95

Map