F468366
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 604 | 338 | 1208 | 131 |
Family's Representative Sequence
| Representative Sequence | 3300006844|Ga0075428_100287212|Ga0075428_1002872121 |
| Length | 124 |
| Sequence | MIRWPARLTPDPILAGASDLRPRAGTGPGNAVITRTKPQTKKPNLYRVLLLNDDYTPMEFVVHVLERFFNKDREAATRIMLHVHHHGIGECGVFTYEVAETKVTQVMDFARKHQHPLQCVMEKK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 6 | 3300005276 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 30 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 33 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 39 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 40 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 41 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 42 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 43 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 44 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 45 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 47 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 48 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 49 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 50 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 53 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 54 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 55 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 56 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 57 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 58 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 59 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 60 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 62 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 63 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300012473 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 | Metagenome | Rhizosphere |
| 77 | 3300012482 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 | Metagenome | Rhizosphere |
| 78 | 3300012487 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 | Metagenome | Rhizosphere |
| 79 | 3300012490 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 | Metagenome | Rhizosphere |
| 80 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 81 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 93 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 94 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 95 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 96 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 97 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 98 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 99 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 146 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 150 | 3300031018 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 151 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 152 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 153 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 154 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 155 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 156 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 157 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 158 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 159 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 160 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 161 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 162 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 163 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 164 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 165 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 166 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 167 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 168 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 169 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 170 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 171 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 172 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 173 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 174 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 175 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 176 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 177 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 178 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 179 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 180 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 181 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 182 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 183 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 184 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 185 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 186 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 187 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 188 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 189 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 190 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 191 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 192 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 193 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 194 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 195 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 196 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 197 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 198 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 199 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 200 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 201 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 202 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 203 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 204 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 205 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 206 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 207 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 208 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 209 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 210 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 211 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 212 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 213 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 214 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 215 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 216 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 217 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 267 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 268 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 269 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 270 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 271 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 272 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 273 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 274 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 275 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 276 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 277 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 278 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 310 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 311 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 312 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 313 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 323 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 324 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 325 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 326 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 327 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 328 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 329 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 331 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 332 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 333 | 2508501114 | Microvirga lotononidis WSM3557 | Isolate | Nodule |
| 334 | 2775506901 | Microvirga ossetica V5/3m | Isolate | Unclassified |
| 335 | 2835312727 | Microvirga calopogonii CCBAU 65841 | Isolate | Nodule |
| 336 | 2894232714 | Microvirga tunisiensis Lmie10 | Isolate | Nodule |
| 337 | 643348564 | Methylobacterium nodulans ORS 2060 | Isolate | Nodule |
| 338 | 8054563764 | Acuticoccus kalidii M5D2P5 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.68 |
| Metatranscriptomes | 1.32 |
| Isolates | 0.99 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.98 |
| Nodule | 0.66 |
| Rhizoplane | 2.81 |
| Rhizosphere | 92.05 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0075428_100287212 | 3300006844 | Bacteria | 1770 |
| 2 | SwRhRL2b_contig_1956784 | 2162886007 | Bacteria | 3196 |
| 3 | 2214600504 | 2209111006 | Bacteria | 5331 |
| 4 | JGI24737J22298_10004342 | 3300001990 | Bacteria | 4950 |
| 5 | JGI25405J52794_10002301 | 3300003911 | Bacteria | 3276 |
| 6 | Ga0065717_1002032 | 3300005276 | Bacteria | 3361 |
| 7 | Ga0070690_100050101 | 3300005330 | Bacteria | 2664 |
| 8 | Ga0068869_100256389 | 3300005334 | Bacteria | 1399 |
| 9 | Ga0070666_10029769 | 3300005335 | Bacteria | 3592 |
| 10 | Ga0070682_100061409 | 3300005337 | Bacteria | 2379 |
| 11 | Ga0070682_101295315 | 3300005337 | Bacteria | 619 |
| 12 | Ga0068868_100055976 | 3300005338 | Bacteria | 3113 |
| 13 | Ga0070689_100043543 | 3300005340 | Bacteria | 3451 |
| 14 | Ga0070687_100023438 | 3300005343 | Bacteria | 2934 |
| 15 | Ga0070661_100251619 | 3300005344 | Bacteria | 1363 |
| 16 | Ga0070671_100210429 | 3300005355 | Bacteria | 1649 |
| 17 | Ga0070674_100462947 | 3300005356 | Bacteria | 1049 |
| 18 | Ga0070673_100368550 | 3300005364 | Bacteria | 1278 |
| 19 | Ga0070688_100179728 | 3300005365 | Bacteria | 1466 |
| 20 | Ga0070659_100013896 | 3300005366 | Bacteria | 6007 |
| 21 | Ga0070667_100499009 | 3300005367 | Bacteria | 1115 |
| 22 | Ga0070709_10204684 | 3300005434 | Bacteria | 1399 |
| 23 | Ga0070709_10651171 | 3300005434 | Bacteria | 816 |
| 24 | Ga0070714_100486378 | 3300005435 | Bacteria | 1176 |
| 25 | Ga0070714_100733081 | 3300005435 | Bacteria | 955 |
| 26 | Ga0070710_10041620 | 3300005437 | Bacteria | 2537 |
| 27 | Ga0070710_10043662 | 3300005437 | Bacteria | 2484 |
| 28 | Ga0070701_10117835 | 3300005438 | Bacteria | 1492 |
| 29 | Ga0070711_100072347 | 3300005439 | Bacteria | 2432 |
| 30 | Ga0070711_100203823 | 3300005439 | Bacteria | 1528 |
| 31 | Ga0070663_100195199 | 3300005455 | Bacteria | 1577 |
| 32 | Ga0070678_100005474 | 3300005456 | Bacteria | 7346 |
| 33 | Ga0070662_100149638 | 3300005457 | Bacteria | 1816 |
| 34 | Ga0070662_100315066 | 3300005457 | Bacteria | 1274 |
| 35 | Ga0068867_100598996 | 3300005459 | Bacteria | 961 |
| 36 | Ga0070679_100120056 | 3300005530 | Bacteria | 2614 |
| 37 | Ga0070684_100304954 | 3300005535 | Bacteria | 1461 |
| 38 | Ga0068853_100744102 | 3300005539 | Bacteria | 937 |
| 39 | Ga0070672_100175698 | 3300005543 | Bacteria | 1783 |
| 40 | Ga0070696_100286868 | 3300005546 | Bacteria | 1256 |
| 41 | Ga0070696_101401134 | 3300005546 | Bacteria | 596 |
| 42 | Ga0070693_100423190 | 3300005547 | Bacteria | 928 |
| 43 | Ga0070665_100072696 | 3300005548 | Bacteria | 3446 |
| 44 | Ga0070664_100150916 | 3300005564 | Bacteria | 2051 |
| 45 | Ga0070664_100759301 | 3300005564 | Bacteria | 905 |
| 46 | Ga0068852_100171401 | 3300005616 | Bacteria | 2035 |
| 47 | Ga0068859_100137060 | 3300005617 | Bacteria | 2521 |
| 48 | Ga0068864_100060264 | 3300005618 | Bacteria | 3286 |
| 49 | Ga0068864_100172175 | 3300005618 | Bacteria | 1974 |
| 50 | Ga0068863_100151043 | 3300005841 | Bacteria | 2222 |
| 51 | Ga0068858_100316680 | 3300005842 | Bacteria | 1490 |
| 52 | Ga0068860_100040727 | 3300005843 | Bacteria | 4439 |
| 53 | Ga0081538_10016340 | 3300005981 | Bacteria | 5696 |
| 54 | Ga0070717_10013240 | 3300006028 | Bacteria | 6313 |
| 55 | Ga0075368_10202577 | 3300006042 | Bacteria | 840 |
| 56 | Ga0075363_100007985 | 3300006048 | Bacteria | 4904 |
| 57 | Ga0075364_10034557 | 3300006051 | Bacteria | 3262 |
| 58 | Ga0075432_10003971 | 3300006058 | Bacteria | 5042 |
| 59 | Ga0070716_100359254 | 3300006173 | Bacteria | 1034 |
| 60 | Ga0070716_100945485 | 3300006173 | Bacteria | 678 |
| 61 | Ga0070712_100162565 | 3300006175 | Bacteria | 1725 |
| 62 | Ga0070712_100760423 | 3300006175 | Bacteria | 830 |
| 63 | Ga0070712_101906145 | 3300006175 | Bacteria | 520 |
| 64 | Ga0075362_10103554 | 3300006177 | Bacteria | 1333 |
| 65 | Ga0075369_10362965 | 3300006186 | Bacteria | 680 |
| 66 | Ga0075366_10016254 | 3300006195 | Bacteria | 4275 |
| 67 | Ga0075370_10275059 | 3300006353 | Bacteria | 1000 |
| 68 | Ga0068871_100343385 | 3300006358 | Bacteria | 1319 |
| 69 | Ga0075428_101750303 | 3300006844 | Bacteria | 648 |
| 70 | Ga0075431_101815196 | 3300006847 | Bacteria | 566 |
| 71 | Ga0075434_100073097 | 3300006871 | Bacteria | 3421 |
| 72 | Ga0068865_100335418 | 3300006881 | Bacteria | 1220 |
| 73 | Ga0097620_100137065 | 3300006931 | Bacteria | 2521 |
| 74 | Ga0075435_100041956 | 3300007076 | Bacteria | 3658 |
| 75 | Ga0075435_100130620 | 3300007076 | Bacteria | 2102 |
| 76 | Ga0099795_10011001 | 3300007788 | Bacteria | 2686 |
| 77 | Ga0105251_10079612 | 3300009011 | Bacteria | 1516 |
| 78 | Ga0105250_10227992 | 3300009092 | Bacteria | 792 |
| 79 | Ga0111539_10013373 | 3300009094 | Bacteria | 10258 |
| 80 | Ga0111539_10415342 | 3300009094 | Bacteria | 1567 |
| 81 | Ga0111539_12700370 | 3300009094 | Bacteria | 575 |
| 82 | Ga0105245_10374706 | 3300009098 | Bacteria | 1416 |
| 83 | Ga0105245_11019497 | 3300009098 | Bacteria | 872 |
| 84 | Ga0105247_10082243 | 3300009101 | Bacteria | 2032 |
| 85 | Ga0105243_10055458 | 3300009148 | Bacteria | 3149 |
| 86 | Ga0105243_10097325 | 3300009148 | Bacteria | 2436 |
| 87 | Ga0105243_10347903 | 3300009148 | Bacteria | 1360 |
| 88 | Ga0105242_10131485 | 3300009176 | Bacteria | 2161 |
| 89 | Ga0105248_10035800 | 3300009177 | Bacteria | 5553 |
| 90 | Ga0105237_10169025 | 3300009545 | Bacteria | 2186 |
| 91 | Ga0105237_10327399 | 3300009545 | Bacteria | 1536 |
| 92 | Ga0105238_10065409 | 3300009551 | Bacteria | 3637 |
| 93 | Ga0105249_10065371 | 3300009553 | Bacteria | 3346 |
| 94 | Ga0105239_10169392 | 3300010375 | Bacteria | 2442 |
| 95 | Ga0105239_10399570 | 3300010375 | Bacteria | 1555 |
| 96 | Ga0105239_10627516 | 3300010375 | Bacteria | 1227 |
| 97 | Ga0105239_10890821 | 3300010375 | Bacteria | 1021 |
| 98 | Ga0105239_12165075 | 3300010375 | Bacteria | 646 |
| 99 | Ga0105246_10013325 | 3300011119 | Bacteria | 5152 |
| 100 | Ga0105246_10185241 | 3300011119 | Bacteria | 1606 |
| 101 | Ga0157340_1002148 | 3300012473 | Bacteria | 983 |
| 102 | Ga0157318_1003458 | 3300012482 | Bacteria | 917 |
| 103 | Ga0157321_1012648 | 3300012487 | Bacteria | 677 |
| 104 | Ga0157322_1005823 | 3300012490 | Bacteria | 861 |
| 105 | Ga0157345_1002420 | 3300012498 | Bacteria | 1320 |
| 106 | Ga0157373_10170400 | 3300013100 | Bacteria | 1532 |
| 107 | Ga0157371_10814365 | 3300013102 | Bacteria | 704 |
| 108 | Ga0157370_10032359 | 3300013104 | Bacteria | 5107 |
| 109 | Ga0157370_10074907 | 3300013104 | Bacteria | 3192 |
| 110 | Ga0157370_10270398 | 3300013104 | Bacteria | 1570 |
| 111 | Ga0157369_11460518 | 3300013105 | Bacteria | 696 |
| 112 | Ga0157374_10664069 | 3300013296 | Bacteria | 1055 |
| 113 | Ga0163162_10014117 | 3300013306 | Bacteria | 7806 |
| 114 | Ga0157372_10271385 | 3300013307 | Bacteria | 1971 |
| 115 | Ga0157372_10777076 | 3300013307 | Bacteria | 1113 |
| 116 | Ga0157375_11204811 | 3300013308 | Bacteria | 888 |
| 117 | Ga0163163_10263811 | 3300014325 | Bacteria | 1773 |
| 118 | Ga0157380_12149594 | 3300014326 | Bacteria | 621 |
| 119 | Ga0157376_10205597 | 3300014969 | Bacteria | 1814 |
| 120 | Ga0206356_10184827 | 3300020070 | Bacteria | 644 |
| 121 | Ga0206350_10997059 | 3300020080 | Bacteria | 2076 |
| 122 | Ga0206354_10093528 | 3300020081 | Bacteria | 692 |
| 123 | Ga0213875_10000089 | 3300021388 | Bacteria | 105772 |
| 124 | Ga0213875_10201638 | 3300021388 | Bacteria | 936 |
| 125 | Ga0224712_10136000 | 3300022467 | Bacteria | 1077 |
| 126 | Ga0224572_1022012 | 3300024225 | Bacteria | 1225 |
| 127 | Ga0228598_1035715 | 3300024227 | Bacteria | 980 |
| 128 | Ga0207673_1000584 | 3300025290 | Bacteria | 3874 |
| 129 | Ga0207713_1141502 | 3300025735 | Bacteria | 785 |
| 130 | Ga0207692_10013517 | 3300025898 | Bacteria | 3543 |
| 131 | Ga0207692_10048951 | 3300025898 | Bacteria | 2130 |
| 132 | Ga0207692_10255360 | 3300025898 | Bacteria | 1052 |
| 133 | Ga0207642_10206036 | 3300025899 | Bacteria | 1090 |
| 134 | Ga0207710_10008457 | 3300025900 | Bacteria | 4341 |
| 135 | Ga0207688_10028171 | 3300025901 | Bacteria | 3091 |
| 136 | Ga0207680_10056822 | 3300025903 | Bacteria | 2365 |
| 137 | Ga0207685_10103634 | 3300025905 | Bacteria | 1221 |
| 138 | Ga0207699_10429873 | 3300025906 | Bacteria | 944 |
| 139 | Ga0207699_10472296 | 3300025906 | Bacteria | 902 |
| 140 | Ga0207645_10374105 | 3300025907 | Bacteria | 955 |
| 141 | Ga0207654_10482044 | 3300025911 | Bacteria | 874 |
| 142 | Ga0207707_10796429 | 3300025912 | Bacteria | 788 |
| 143 | Ga0207707_11492061 | 3300025912 | Bacteria | 536 |
| 144 | Ga0207671_10044679 | 3300025914 | Bacteria | 3276 |
| 145 | Ga0207693_10608041 | 3300025915 | Bacteria | 851 |
| 146 | Ga0207693_10791329 | 3300025915 | Bacteria | 731 |
| 147 | Ga0207693_10927892 | 3300025915 | Bacteria | 667 |
| 148 | Ga0207663_10077549 | 3300025916 | Bacteria | 2163 |
| 149 | Ga0207663_10103623 | 3300025916 | Bacteria | 1917 |
| 150 | Ga0207660_10094284 | 3300025917 | Bacteria | 2225 |
| 151 | Ga0207649_10108617 | 3300025920 | Bacteria | 1849 |
| 152 | Ga0207694_10036460 | 3300025924 | Bacteria | 3775 |
| 153 | Ga0207700_10127987 | 3300025928 | Bacteria | 2069 |
| 154 | Ga0207664_10105111 | 3300025929 | Bacteria | 2339 |
| 155 | Ga0207664_10498153 | 3300025929 | Bacteria | 1091 |
| 156 | Ga0207664_10874422 | 3300025929 | Bacteria | 807 |
| 157 | Ga0207644_10186112 | 3300025931 | Bacteria | 1630 |
| 158 | Ga0207686_10019786 | 3300025934 | Bacteria | 3836 |
| 159 | Ga0207709_10161574 | 3300025935 | Bacteria | 1563 |
| 160 | Ga0207670_10192613 | 3300025936 | Bacteria | 1543 |
| 161 | Ga0207704_10088606 | 3300025938 | Bacteria | 2025 |
| 162 | Ga0207665_10005721 | 3300025939 | Bacteria | 8278 |
| 163 | Ga0207665_10305291 | 3300025939 | Bacteria | 1191 |
| 164 | Ga0207665_10584750 | 3300025939 | Bacteria | 870 |
| 165 | Ga0207711_10009494 | 3300025941 | Bacteria | 8117 |
| 166 | Ga0207711_10896309 | 3300025941 | Bacteria | 825 |
| 167 | Ga0207689_10286904 | 3300025942 | Bacteria | 1363 |
| 168 | Ga0207661_10075715 | 3300025944 | Bacteria | 2762 |
| 169 | Ga0207661_10995422 | 3300025944 | Bacteria | 772 |
| 170 | Ga0207679_10232199 | 3300025945 | Bacteria | 1558 |
| 171 | Ga0207651_11103522 | 3300025960 | Bacteria | 711 |
| 172 | Ga0207640_10474981 | 3300025981 | Bacteria | 1036 |
| 173 | Ga0207677_10317622 | 3300026023 | Bacteria | 1293 |
| 174 | Ga0207703_10034322 | 3300026035 | Bacteria | 4025 |
| 175 | Ga0207639_10221594 | 3300026041 | Bacteria | 1634 |
| 176 | Ga0207678_10024395 | 3300026067 | Bacteria | 5280 |
| 177 | Ga0207648_10058988 | 3300026089 | Bacteria | 3347 |
| 178 | Ga0207676_10055628 | 3300026095 | Bacteria | 3107 |
| 179 | Ga0207674_11244275 | 3300026116 | Bacteria | 714 |
| 180 | Ga0207675_100565239 | 3300026118 | Bacteria | 1138 |
| 181 | Ga0207683_10052783 | 3300026121 | Bacteria | 3563 |
| 182 | Ga0207698_10147809 | 3300026142 | Bacteria | 2035 |
| 183 | Ga0207698_11419808 | 3300026142 | Bacteria | 709 |
| 184 | Ga0209982_1003242 | 3300027552 | Bacteria | 2304 |
| 185 | Ga0210002_1001886 | 3300027617 | Bacteria | 3003 |
| 186 | Ga0209966_1032267 | 3300027695 | Bacteria | 1066 |
| 187 | Ga0209974_10245761 | 3300027876 | Bacteria | 672 |
| 188 | Ga0207428_10301480 | 3300027907 | Bacteria | 1186 |
| 189 | Ga0268266_10070500 | 3300028379 | Bacteria | 3028 |
| 190 | Ga0268265_10049667 | 3300028380 | Bacteria | 3156 |
| 191 | Ga0268264_10093517 | 3300028381 | Bacteria | 2597 |
| 192 | Ga0265318_10035965 | 3300028577 | Bacteria | 1902 |
| 193 | Ga0265773_1014771 | 3300031018 | Bacteria | 711 |
| 194 | Ga0265330_10053048 | 3300031235 | Bacteria | 1775 |
| 195 | Ga0265328_10046163 | 3300031239 | Bacteria | 1601 |
| 196 | Ga0265320_10229065 | 3300031240 | Bacteria | 826 |
| 197 | Ga0265325_10000048 | 3300031241 | Bacteria | 82899 |
| 198 | Ga0265325_10061491 | 3300031241 | Bacteria | 1904 |
| 199 | Ga0265325_10066451 | 3300031241 | Bacteria | 1818 |
| 200 | Ga0265329_10017411 | 3300031242 | Bacteria | 2473 |
| 201 | Ga0265329_10112693 | 3300031242 | Bacteria | 870 |
| 202 | Ga0265340_10124099 | 3300031247 | Bacteria | 1187 |
| 203 | Ga0265340_10181392 | 3300031247 | Bacteria | 951 |
| 204 | Ga0265339_10015418 | 3300031249 | Bacteria | 4580 |
| 205 | Ga0265339_10104822 | 3300031249 | Bacteria | 1468 |
| 206 | Ga0265331_10014416 | 3300031250 | Bacteria | 4210 |
| 207 | Ga0265331_10025667 | 3300031250 | Bacteria | 2971 |
| 208 | Ga0265327_10033019 | 3300031251 | Bacteria | 2890 |
| 209 | Ga0265316_10055076 | 3300031344 | Bacteria | 3112 |
| 210 | Ga0265316_10074661 | 3300031344 | Bacteria | 2609 |
| 211 | Ga0265316_10278415 | 3300031344 | Bacteria | 1223 |
| 212 | Ga0307408_100143674 | 3300031548 | Bacteria | 1876 |
| 213 | Ga0265313_10014452 | 3300031595 | Bacteria | 4662 |
| 214 | Ga0265313_10063547 | 3300031595 | Bacteria | 1720 |
| 215 | Ga0265314_10005957 | 3300031711 | Bacteria | 10889 |
| 216 | Ga0265314_10068193 | 3300031711 | Bacteria | 2392 |
| 217 | Ga0265342_10023758 | 3300031712 | Bacteria | 3875 |
| 218 | Ga0265342_10181243 | 3300031712 | Bacteria | 1153 |
| 219 | Ga0307410_10261154 | 3300031852 | Bacteria | 1351 |
| 220 | Ga0307409_101715911 | 3300031995 | Bacteria | 657 |
| 221 | Ga0307416_102585243 | 3300032002 | Bacteria | 605 |
| 222 | Ga0316593_10142484 | 3300032168 | Bacteria | 869 |
| 223 | Ga0373948_0000177 | 3300034817 | Bacteria | 7265 |
| 224 | Ga0373958_0009481 | 3300034819 | Bacteria | 1603 |
| 225 | Ga0373938_0013522 | 3300034957 | Bacteria | 1550 |
| 226 | Ga0373928_0000089 | 3300035084 | Bacteria | 15937 |
| 227 | Ga0373929_0022097 | 3300035085 | Bacteria | 1296 |
| 228 | Ga0373929_0099106 | 3300035085 | Bacteria | 732 |
| 229 | Ga0373934_0042477 | 3300035086 | Bacteria | 1796 |
| 230 | Ga0373940_0000034 | 3300035088 | Bacteria | 14984 |
| 231 | Ga0373944_0002861 | 3300035089 | Bacteria | 4417 |
| 232 | Ga0373949_0001494 | 3300035090 | Bacteria | 6649 |
| 233 | Ga0373949_0034390 | 3300035090 | Bacteria | 1221 |
| 234 | Ga0373952_0063562 | 3300035092 | Bacteria | 908 |
| 235 | Ga0373923_0001890 | 3300035111 | Bacteria | 6246 |
| 236 | Ga0373923_0042639 | 3300035111 | Bacteria | 1875 |
| 237 | Ga0373936_0027608 | 3300035113 | Bacteria | 2227 |
| 238 | Ga0373936_0222998 | 3300035113 | Bacteria | 837 |
| 239 | Ga0373939_0030987 | 3300035114 | Bacteria | 1543 |
| 240 | Ga0373945_0016960 | 3300035116 | Bacteria | 2463 |
| 241 | Ga0373945_0045946 | 3300035116 | Bacteria | 1592 |
| 242 | Ga0373953_0008309 | 3300035117 | Bacteria | 3520 |
| 243 | Ga0373953_0023055 | 3300035117 | Bacteria | 2354 |
| 244 | Ga0373954_0004193 | 3300035118 | Bacteria | 6181 |
| 245 | Ga0373956_0012952 | 3300035119 | Bacteria | 3465 |
| 246 | Ga0373957_0012987 | 3300035120 | Bacteria | 2817 |
| 247 | Ga0373957_0078751 | 3300035120 | Bacteria | 1298 |
| 248 | Ga0373957_0101288 | 3300035120 | Bacteria | 1153 |
| 249 | Ga0373943_0013226 | 3300035170 | Bacteria | 3724 |
| 250 | Ga0373943_0057338 | 3300035170 | Bacteria | 1935 |
| 251 | Ga0373943_0156087 | 3300035170 | Bacteria | 1239 |
| 252 | Ga0373946_0001530 | 3300035171 | Bacteria | 8040 |
| 253 | Ga0373955_0001031 | 3300035172 | Bacteria | 11831 |
| 254 | Ga0373961_0034912 | 3300035241 | Bacteria | 1424 |
| 255 | Ga0373961_0438314 | 3300035241 | Bacteria | 507 |
| 256 | Ga0373924_0002051 | 3300035410 | Bacteria | 6722 |
| 257 | Ga0373924_0035080 | 3300035410 | Bacteria | 2034 |
| 258 | Ga0373931_0190314 | 3300035691 | Bacteria | 1220 |
| 259 | Ga0373935_0003239 | 3300035692 | Bacteria | 9407 |
| 260 | Ga0373935_0079213 | 3300035692 | Bacteria | 2132 |
| 261 | Ga0373935_0094243 | 3300035692 | Bacteria | 1964 |
| 262 | Ga0373935_0160818 | 3300035692 | Bacteria | 1531 |
| 263 | Ga0373927_0007173 | 3300035695 | Bacteria | 7562 |
| 264 | Ga0373927_0032020 | 3300035695 | Bacteria | 3425 |
| 265 | Ga0373927_0194687 | 3300035695 | Bacteria | 1330 |
| 266 | Ga0373933_0002994 | 3300035724 | Bacteria | 9418 |
| 267 | Ga0373933_0004041 | 3300035724 | Bacteria | 8084 |
| 268 | Ga0373933_0031324 | 3300035724 | Bacteria | 3085 |
| 269 | Ga0373947_0009661 | 3300035725 | Bacteria | 5536 |
| 270 | Ga0373947_0016373 | 3300035725 | Bacteria | 4261 |
| 271 | Ga0373947_0142327 | 3300035725 | Bacteria | 1539 |
| 272 | Ga0373937_0003621 | 3300036401 | Bacteria | 13032 |
| 273 | Ga0373937_0017492 | 3300036401 | Bacteria | 6388 |
| 274 | Ga0373937_0032927 | 3300036401 | Bacteria | 4703 |
| 275 | Ga0373937_0547743 | 3300036401 | Bacteria | 1099 |
| 276 | Ga0373925_0002135 | 3300037068 | Bacteria | 16159 |
| 277 | Ga0436364_0038355 | 3300037853 | Bacteria | 1903 |
| 278 | Ga0436364_0065556 | 3300037853 | Bacteria | 1541 |
| 279 | Ga0436364_1470117 | 3300037853 | Bacteria | 17732 |
| 280 | Ga0436365_1123258 | 3300039437 | Bacteria | 931 |
| 281 | Ga0436365_1170985 | 3300039437 | Bacteria | 1903 |
| 282 | Ga0436361_0286937 | 3300039447 | Bacteria | 566 |
| 283 | Ga0436361_0456752 | 3300039447 | Bacteria | 724 |
| 284 | Ga0436362_0097262 | 3300039453 | Bacteria | 1510 |
| 285 | Ga0436362_1128732 | 3300039453 | Bacteria | 567 |
| 286 | Ga0451791_1042633 | 3300041451 | Bacteria | 525 |
| 287 | Ga0439450_176805 | 3300042008 | Bacteria | 566 |
| 288 | Ga0439460_0134653 | 3300042461 | Bacteria | 816 |
| 289 | Ga0439440_0128811 | 3300042993 | Bacteria | 710 |
| 290 | Ga0466965_0280592 | 3300044683 | Bacteria | 900 |
| 291 | Ga0466966_0203186 | 3300044684 | Bacteria | 1198 |
| 292 | Ga0466961_0430117 | 3300044693 | Bacteria | 800 |
| 293 | Ga0466963_0129921 | 3300044694 | Bacteria | 1739 |
| 294 | Ga0466971_0048304 | 3300044719 | Bacteria | 1913 |
| 295 | Ga0466971_0161164 | 3300044719 | Bacteria | 1050 |
| 296 | Ga0466971_0351673 | 3300044719 | Bacteria | 713 |
| 297 | Ga0466957_0015423 | 3300044842 | Bacteria | 4464 |
| 298 | Ga0466957_0224118 | 3300044842 | Bacteria | 1242 |
| 299 | Ga0466957_0659829 | 3300044842 | Bacteria | 736 |
| 300 | Ga0466959_0259910 | 3300045049 | Bacteria | 1195 |
| 301 | Ga0451576_0035029 | 3300045051 | Bacteria | 5328 |
| 302 | Ga0466958_0022944 | 3300045836 | Bacteria | 3659 |
| 303 | Ga0466967_1460695 | 3300045976 | Bacteria | 681 |
| 304 | Ga0495592_0022088 | 3300046454 | Bacteria | 4840 |
| 305 | Ga0495592_0060406 | 3300046454 | Bacteria | 2788 |
| 306 | Ga0495592_0083372 | 3300046454 | Bacteria | 2308 |
| 307 | Ga0495592_0107953 | 3300046454 | Bacteria | 1973 |
| 308 | Ga0495603_0070311 | 3300046455 | Bacteria | 2057 |
| 309 | Ga0495629_0000409 | 3300046459 | Bacteria | 35959 |
| 310 | Ga0495629_0695607 | 3300046459 | Bacteria | 675 |
| 311 | Ga0495641_0003224 | 3300046461 | Bacteria | 12382 |
| 312 | Ga0495641_0108933 | 3300046461 | Bacteria | 1236 |
| 313 | Ga0495651_0001051 | 3300046462 | Bacteria | 21350 |
| 314 | Ga0495651_0015585 | 3300046462 | Bacteria | 5881 |
| 315 | Ga0495651_0242477 | 3300046462 | Bacteria | 1235 |
| 316 | Ga0495651_0625704 | 3300046462 | Bacteria | 677 |
| 317 | Ga0495653_0001436 | 3300046463 | Bacteria | 18599 |
| 318 | Ga0495653_0012022 | 3300046463 | Bacteria | 7066 |
| 319 | Ga0495653_0038544 | 3300046463 | Bacteria | 3751 |
| 320 | Ga0495653_0106969 | 3300046463 | Bacteria | 2016 |
| 321 | Ga0495580_0008552 | 3300046472 | Bacteria | 8125 |
| 322 | Ga0495580_0295808 | 3300046472 | Bacteria | 1103 |
| 323 | Ga0495582_0017536 | 3300046473 | Bacteria | 3917 |
| 324 | Ga0495582_0147182 | 3300046473 | Bacteria | 1336 |
| 325 | Ga0495639_0017004 | 3300046475 | Bacteria | 3158 |
| 326 | Ga0495639_0527252 | 3300046475 | Bacteria | 604 |
| 327 | Ga0495662_0072456 | 3300046476 | Bacteria | 1670 |
| 328 | Ga0495664_0004802 | 3300046477 | Bacteria | 7392 |
| 329 | Ga0495664_0007982 | 3300046477 | Bacteria | 5893 |
| 330 | Ga0495664_0365228 | 3300046477 | Bacteria | 868 |
| 331 | Ga0495664_0390267 | 3300046477 | Bacteria | 836 |
| 332 | Ga0495594_0014136 | 3300046499 | Bacteria | 4179 |
| 333 | Ga0495608_0001582 | 3300046511 | Bacteria | 16261 |
| 334 | Ga0495608_0042109 | 3300046511 | Bacteria | 3054 |
| 335 | Ga0495608_0126807 | 3300046511 | Bacteria | 1634 |
| 336 | Ga0495618_0012253 | 3300046514 | Bacteria | 5205 |
| 337 | Ga0495618_0013450 | 3300046514 | Bacteria | 4976 |
| 338 | Ga0495618_0129924 | 3300046514 | Bacteria | 1612 |
| 339 | Ga0495618_0211329 | 3300046514 | Bacteria | 1226 |
| 340 | Ga0495628_0014768 | 3300046516 | Bacteria | 6536 |
| 341 | Ga0495628_0033756 | 3300046516 | Bacteria | 4121 |
| 342 | Ga0495628_0214617 | 3300046516 | Bacteria | 1446 |
| 343 | Ga0495630_0024797 | 3300046517 | Bacteria | 4433 |
| 344 | Ga0495630_0105033 | 3300046517 | Bacteria | 2138 |
| 345 | Ga0495630_0137890 | 3300046517 | Bacteria | 1854 |
| 346 | Ga0495637_0050069 | 3300046520 | Bacteria | 1753 |
| 347 | Ga0495644_0048673 | 3300046523 | Bacteria | 1592 |
| 348 | Ga0495666_0001411 | 3300046526 | Bacteria | 11639 |
| 349 | Ga0495652_0006651 | 3300046529 | Bacteria | 10734 |
| 350 | Ga0495652_0018617 | 3300046529 | Bacteria | 6188 |
| 351 | Ga0495652_0274002 | 3300046529 | Bacteria | 1239 |
| 352 | Ga0495652_0428137 | 3300046529 | Bacteria | 931 |
| 353 | Ga0495640_0006074 | 3300046533 | Bacteria | 9578 |
| 354 | Ga0495640_0007693 | 3300046533 | Bacteria | 8475 |
| 355 | Ga0495640_0246789 | 3300046533 | Bacteria | 1119 |
| 356 | Ga0495640_0285599 | 3300046533 | Bacteria | 1027 |
| 357 | Ga0495586_0006303 | 3300046535 | Bacteria | 6337 |
| 358 | Ga0495586_0007833 | 3300046535 | Bacteria | 5698 |
| 359 | Ga0495587_0009411 | 3300046536 | Bacteria | 6262 |
| 360 | Ga0495587_0169449 | 3300046536 | Bacteria | 1241 |
| 361 | Ga0495587_0284847 | 3300046536 | Bacteria | 926 |
| 362 | Ga0495645_0063830 | 3300046543 | Bacteria | 2665 |
| 363 | Ga0495645_0151962 | 3300046543 | Bacteria | 1607 |
| 364 | Ga0495645_0165073 | 3300046543 | Bacteria | 1528 |
| 365 | Ga0495645_0279359 | 3300046543 | Bacteria | 1099 |
| 366 | Ga0495622_0094505 | 3300046557 | Bacteria | 1372 |
| 367 | Ga0495633_0049088 | 3300046558 | Bacteria | 1992 |
| 368 | Ga0495667_0000449 | 3300046559 | Bacteria | 26331 |
| 369 | Ga0495667_0006887 | 3300046559 | Bacteria | 7719 |
| 370 | Ga0495667_0008187 | 3300046559 | Bacteria | 7094 |
| 371 | Ga0495667_0043178 | 3300046559 | Bacteria | 2988 |
| 372 | Ga0495667_0067493 | 3300046559 | Bacteria | 2337 |
| 373 | Ga0495634_0014785 | 3300046642 | Bacteria | 5616 |
| 374 | Ga0495634_0050415 | 3300046642 | Bacteria | 2795 |
| 375 | Ga0495634_0065529 | 3300046642 | Bacteria | 2407 |
| 376 | Ga0495634_0172108 | 3300046642 | Bacteria | 1360 |
| 377 | Ga0495634_0562229 | 3300046642 | Bacteria | 664 |
| 378 | Ga0495635_0002604 | 3300046663 | Bacteria | 12352 |
| 379 | Ga0495635_0007432 | 3300046663 | Bacteria | 7646 |
| 380 | Ga0495635_0013256 | 3300046663 | Bacteria | 5769 |
| 381 | Ga0495635_0054278 | 3300046663 | Bacteria | 2760 |
| 382 | Ga0495659_0001817 | 3300046664 | Bacteria | 7080 |
| 383 | Ga0495588_0002846 | 3300046674 | Bacteria | 7447 |
| 384 | Ga0495657_0005844 | 3300046675 | Bacteria | 9683 |
| 385 | Ga0495657_0038356 | 3300046675 | Bacteria | 3298 |
| 386 | Ga0495657_0254609 | 3300046675 | Bacteria | 1056 |
| 387 | Ga0495599_0036016 | 3300046678 | Bacteria | 3106 |
| 388 | Ga0495599_0041553 | 3300046678 | Bacteria | 2886 |
| 389 | Ga0495623_0005873 | 3300046679 | Bacteria | 7999 |
| 390 | Ga0495623_0007576 | 3300046679 | Bacteria | 7047 |
| 391 | Ga0495646_0017821 | 3300046680 | Bacteria | 4500 |
| 392 | Ga0495646_0085016 | 3300046680 | Bacteria | 1836 |
| 393 | Ga0495646_0213286 | 3300046680 | Bacteria | 1047 |
| 394 | Ga0495647_0001804 | 3300046681 | Bacteria | 6621 |
| 395 | Ga0495647_0028719 | 3300046681 | Bacteria | 2053 |
| 396 | Ga0495658_0006028 | 3300046683 | Bacteria | 5951 |
| 397 | Ga0495658_0046183 | 3300046683 | Bacteria | 2448 |
| 398 | Ga0495613_0201922 | 3300046689 | Bacteria | 1401 |
| 399 | Ga0495624_0024351 | 3300046690 | Bacteria | 3984 |
| 400 | Ga0495624_0388994 | 3300046690 | Bacteria | 837 |
| 401 | Ga0495624_0669110 | 3300046690 | Bacteria | 617 |
| 402 | Ga0495600_0005932 | 3300046809 | Bacteria | 7392 |
| 403 | Ga0495600_0008802 | 3300046809 | Bacteria | 6216 |
| 404 | Ga0495600_0052717 | 3300046809 | Bacteria | 2656 |
| 405 | Ga0495600_0400754 | 3300046809 | Bacteria | 854 |
| 406 | Ga0495581_0009356 | 3300047315 | Bacteria | 5669 |
| 407 | Ga0495581_0023682 | 3300047315 | Bacteria | 3557 |
| 408 | Ga0495581_0090982 | 3300047315 | Bacteria | 1770 |
| 409 | Ga0495604_0001090 | 3300047317 | Bacteria | 22540 |
| 410 | Ga0495604_0004234 | 3300047317 | Bacteria | 11355 |
| 411 | Ga0495604_0021957 | 3300047317 | Bacteria | 5094 |
| 412 | Ga0495604_0061899 | 3300047317 | Bacteria | 2861 |
| 413 | Ga0495674_0001004 | 3300047319 | Bacteria | 27097 |
| 414 | Ga0495674_0012552 | 3300047319 | Bacteria | 7980 |
| 415 | Ga0495674_0034532 | 3300047319 | Bacteria | 4573 |
| 416 | Ga0495674_0099490 | 3300047319 | Bacteria | 2475 |
| 417 | Ga0495674_0394896 | 3300047319 | Bacteria | 1117 |
| 418 | Ga0495676_0008886 | 3300047321 | Bacteria | 9176 |
| 419 | Ga0495676_0329467 | 3300047321 | Bacteria | 1024 |
| 420 | Ga0495680_0000795 | 3300047322 | Bacteria | 35314 |
| 421 | Ga0495680_0033335 | 3300047322 | Bacteria | 4171 |
| 422 | Ga0495680_0080399 | 3300047322 | Bacteria | 2463 |
| 423 | Ga0495680_0208510 | 3300047322 | Bacteria | 1399 |
| 424 | Ga0495680_0367235 | 3300047322 | Bacteria | 999 |
| 425 | Ga0495675_0002919 | 3300047444 | Bacteria | 10270 |
| 426 | Ga0495675_0148338 | 3300047444 | Bacteria | 1450 |
| 427 | Ga0495684_0004924 | 3300047471 | Bacteria | 10427 |
| 428 | Ga0495684_0042209 | 3300047471 | Bacteria | 3494 |
| 429 | Ga0495684_0060914 | 3300047471 | Bacteria | 2872 |
| 430 | Ga0495602_0000618 | 3300048088 | Bacteria | 33441 |
| 431 | Ga0495602_0018296 | 3300048088 | Bacteria | 7002 |
| 432 | Ga0495602_0231646 | 3300048088 | Bacteria | 1387 |
| 433 | Ga0495602_0243472 | 3300048088 | Bacteria | 1344 |
| 434 | Ga0495614_0042300 | 3300048089 | Bacteria | 1953 |
| 435 | Ga0496100_0332039 | 3300048903 | Bacteria | 1144 |
| 436 | Ga0496100_0978206 | 3300048903 | Bacteria | 666 |
| 437 | Ga0496101_0115746 | 3300048904 | Bacteria | 2022 |
| 438 | Ga0496102_0039450 | 3300048905 | Bacteria | 4267 |
| 439 | Ga0496102_0444421 | 3300048905 | Bacteria | 1216 |
| 440 | Ga0496103_0003651 | 3300048906 | Bacteria | 9370 |
| 441 | Ga0496105_0004873 | 3300048908 | Bacteria | 10137 |
| 442 | Ga0496105_0368616 | 3300048908 | Bacteria | 1144 |
| 443 | Ga0496106_0052077 | 3300048909 | Bacteria | 3087 |
| 444 | Ga0496106_0070937 | 3300048909 | Bacteria | 2661 |
| 445 | Ga0496107_0103713 | 3300048910 | Bacteria | 2086 |
| 446 | Ga0496108_0072721 | 3300048911 | Bacteria | 2902 |
| 447 | Ga0496110_0041662 | 3300048913 | Bacteria | 4007 |
| 448 | Ga0496111_0091448 | 3300048914 | Bacteria | 2229 |
| 449 | Ga0496112_0066014 | 3300048915 | Bacteria | 3570 |
| 450 | Ga0496114_0037981 | 3300048917 | Bacteria | 3983 |
| 451 | Ga0501031_0019344 | 3300049568 | Bacteria | 4436 |
| 452 | Ga0501031_0120786 | 3300049568 | Bacteria | 1712 |
| 453 | Ga0501032_0072459 | 3300049569 | Bacteria | 2296 |
| 454 | Ga0501032_0465134 | 3300049569 | Bacteria | 809 |
| 455 | Ga0501033_0024048 | 3300049570 | Bacteria | 4596 |
| 456 | Ga0501033_0107866 | 3300049570 | Bacteria | 2028 |
| 457 | Ga0501034_0001763 | 3300049571 | Bacteria | 27682 |
| 458 | Ga0501034_0042585 | 3300049571 | Bacteria | 4596 |
| 459 | Ga0501034_0043376 | 3300049571 | Bacteria | 4552 |
| 460 | Ga0501034_0097438 | 3300049571 | Bacteria | 2936 |
| 461 | Ga0501034_0178983 | 3300049571 | Bacteria | 2086 |
| 462 | Ga0501034_0221859 | 3300049571 | Bacteria | 1842 |
| 463 | Ga0501036_0006271 | 3300049572 | Bacteria | 9646 |
| 464 | Ga0501036_0058285 | 3300049572 | Bacteria | 3271 |
| 465 | Ga0501036_0168683 | 3300049572 | Bacteria | 1844 |
| 466 | Ga0501036_0235050 | 3300049572 | Bacteria | 1537 |
| 467 | Ga0501037_0077948 | 3300049573 | Bacteria | 2404 |
| 468 | Ga0501037_0091540 | 3300049573 | Bacteria | 2199 |
| 469 | Ga0501037_0452548 | 3300049573 | Bacteria | 875 |
| 470 | Ga0501038_0007470 | 3300049574 | Bacteria | 10084 |
| 471 | Ga0501038_0110175 | 3300049574 | Bacteria | 2281 |
| 472 | Ga0501038_0651786 | 3300049574 | Bacteria | 792 |
| 473 | Ga0501038_1002121 | 3300049574 | Bacteria | 613 |
| 474 | Ga0501039_0031311 | 3300049575 | Bacteria | 4100 |
| 475 | Ga0501039_0114885 | 3300049575 | Bacteria | 2106 |
| 476 | Ga0501039_0522723 | 3300049575 | Bacteria | 932 |
| 477 | Ga0501040_0225716 | 3300049576 | Bacteria | 1333 |
| 478 | Ga0501042_0030021 | 3300049578 | Bacteria | 3838 |
| 479 | Ga0501043_0011054 | 3300049579 | Bacteria | 7070 |
| 480 | Ga0501043_0125529 | 3300049579 | Bacteria | 2012 |
| 481 | Ga0501043_0203090 | 3300049579 | Bacteria | 1537 |
| 482 | Ga0501046_0024636 | 3300049580 | Bacteria | 4933 |
| 483 | Ga0501046_0088381 | 3300049580 | Bacteria | 2386 |
| 484 | Ga0501047_0009728 | 3300049581 | Bacteria | 9092 |
| 485 | Ga0501047_0051742 | 3300049581 | Bacteria | 3969 |
| 486 | Ga0501047_0225261 | 3300049581 | Bacteria | 1730 |
| 487 | Ga0501047_0410134 | 3300049581 | Bacteria | 1187 |
| 488 | Ga0501047_1048752 | 3300049581 | Bacteria | 628 |
| 489 | Ga0501048_0028348 | 3300049582 | Bacteria | 4063 |
| 490 | Ga0501067_0010797 | 3300049583 | Bacteria | 5052 |
| 491 | Ga0501067_0034380 | 3300049583 | Bacteria | 2813 |
| 492 | Ga0501067_0806361 | 3300049583 | Bacteria | 529 |
| 493 | Ga0501068_0041178 | 3300049584 | Bacteria | 2775 |
| 494 | Ga0501068_0059446 | 3300049584 | Bacteria | 2320 |
| 495 | Ga0501068_0468336 | 3300049584 | Bacteria | 816 |
| 496 | Ga0501069_0014794 | 3300049585 | Bacteria | 4175 |
| 497 | Ga0501069_0071355 | 3300049585 | Bacteria | 1946 |
| 498 | Ga0501069_0116897 | 3300049585 | Bacteria | 1521 |
| 499 | Ga0501069_0212718 | 3300049585 | Bacteria | 1122 |
| 500 | Ga0501069_0400214 | 3300049585 | Bacteria | 812 |
| 501 | Ga0501070_0009706 | 3300049586 | Bacteria | 8139 |
| 502 | Ga0501070_0018786 | 3300049586 | Bacteria | 5799 |
| 503 | Ga0501070_0036810 | 3300049586 | Bacteria | 4086 |
| 504 | Ga0501070_0066455 | 3300049586 | Bacteria | 2986 |
| 505 | Ga0501070_0085453 | 3300049586 | Bacteria | 2612 |
| 506 | Ga0501070_0242594 | 3300049586 | Bacteria | 1475 |
| 507 | Ga0501070_0478577 | 3300049586 | Bacteria | 1002 |
| 508 | Ga0501070_0640553 | 3300049586 | Bacteria | 844 |
| 509 | Ga0501071_0229114 | 3300049587 | Bacteria | 1399 |
| 510 | Ga0501071_0245753 | 3300049587 | Bacteria | 1350 |
| 511 | Ga0501071_0349639 | 3300049587 | Bacteria | 1125 |
| 512 | Ga0501072_0015813 | 3300049588 | Bacteria | 5785 |
| 513 | Ga0501072_0295108 | 3300049588 | Bacteria | 1288 |
| 514 | Ga0501072_0399338 | 3300049588 | Bacteria | 1090 |
| 515 | Ga0501073_0005996 | 3300049589 | Bacteria | 9068 |
| 516 | Ga0501073_0347163 | 3300049589 | Bacteria | 1024 |
| 517 | Ga0501073_0505514 | 3300049589 | Bacteria | 835 |
| 518 | Ga0501073_1283283 | 3300049589 | Bacteria | 502 |
| 519 | Ga0501074_0022206 | 3300049590 | Bacteria | 4610 |
| 520 | Ga0501074_0186194 | 3300049590 | Bacteria | 1480 |
| 521 | Ga0501074_0187820 | 3300049590 | Bacteria | 1473 |
| 522 | Ga0501074_0729730 | 3300049590 | Bacteria | 699 |
| 523 | Ga0501075_0740481 | 3300049591 | Bacteria | 748 |
| 524 | Ga0501077_0071632 | 3300049593 | Bacteria | 2197 |
| 525 | Ga0501077_0991480 | 3300049593 | Bacteria | 541 |
| 526 | Ga0501079_0191430 | 3300049741 | Bacteria | 1596 |
| 527 | Ga0501079_0283249 | 3300049741 | Bacteria | 1296 |
| 528 | Ga0501079_0348143 | 3300049741 | Bacteria | 1161 |
| 529 | Ga0501080_0037448 | 3300049742 | Bacteria | 4531 |
| 530 | Ga0501080_0108754 | 3300049742 | Bacteria | 2569 |
| 531 | Ga0501080_0144878 | 3300049742 | Bacteria | 2196 |
| 532 | Ga0501080_1353396 | 3300049742 | Bacteria | 608 |
| 533 | Ga0501081_0408254 | 3300049743 | Bacteria | 1006 |
| 534 | Ga0501083_0034206 | 3300049744 | Bacteria | 3475 |
| 535 | Ga0501083_0123891 | 3300049744 | Bacteria | 1694 |
| 536 | Ga0501083_0198702 | 3300049744 | Bacteria | 1308 |
| 537 | Ga0501083_0886928 | 3300049744 | Bacteria | 580 |
| 538 | Ga0501035_0033476 | 3300049822 | Bacteria | 4674 |
| 539 | Ga0501035_0084598 | 3300049822 | Bacteria | 2797 |
| 540 | Ga0501035_0485581 | 3300049822 | Bacteria | 1018 |
| 541 | Ga0501035_0584106 | 3300049822 | Bacteria | 912 |
| 542 | Ga0501035_0830046 | 3300049822 | Bacteria | 736 |
| 543 | Ga0501044_0025458 | 3300049823 | Bacteria | 6271 |
| 544 | Ga0501044_0047267 | 3300049823 | Bacteria | 4451 |
| 545 | Ga0501044_0077969 | 3300049823 | Bacteria | 3359 |
| 546 | Ga0501044_0423985 | 3300049823 | Bacteria | 1240 |
| 547 | Ga0501044_0625568 | 3300049823 | Bacteria | 967 |
| 548 | Ga0501045_0227967 | 3300049824 | Bacteria | 1387 |
| 549 | nmdc:mga03683_53914_c1 | 3300050489 | Bacteria | 1685 |
| 550 | nmdc:mga03n38_146606_c1 | 3300050490 | Bacteria | 1184 |
| 551 | nmdc:mga00v17_22204_c1 | 3300050491 | Bacteria | 3659 |
| 552 | nmdc:mga0k408_12843_c1 | 3300050493 | Bacteria | 4585 |
| 553 | nmdc:mga06r32_1295917_c1 | 3300050510 | Bacteria | 672 |
| 554 | nmdc:mga08y16_48293_c1 | 3300050511 | Bacteria | 4454 |
| 555 | nmdc:mga08y16_704984_c1 | 3300050511 | Bacteria | 1009 |
| 556 | nmdc:mga0n895_1066454_c1 | 3300050512 | Bacteria | 787 |
| 557 | nmdc:mga0rr50_176088_c1 | 3300050513 | Bacteria | 1746 |
| 558 | nmdc:mga08x19_23_c1 | 3300050514 | Bacteria | 288286 |
| 559 | nmdc:mga08x19_333374_c1 | 3300050514 | Bacteria | 1057 |
| 560 | Ga0495601_0000507 | 3300053077 | Bacteria | 20511 |
| 561 | Ga0495601_0010162 | 3300053077 | Bacteria | 5593 |
| 562 | Ga0495601_0012444 | 3300053077 | Bacteria | 5104 |
| 563 | Ga0495601_0027402 | 3300053077 | Bacteria | 3522 |
| 564 | Ga0495601_0036135 | 3300053077 | Bacteria | 3084 |
| 565 | Ga0495612_0000967 | 3300053078 | Bacteria | 11812 |
| 566 | Ga0495612_0008438 | 3300053078 | Bacteria | 4179 |
| 567 | Ga0495612_0010242 | 3300053078 | Bacteria | 3793 |
| 568 | Ga0495612_0012393 | 3300053078 | Bacteria | 3436 |
| 569 | Ga0495612_0131619 | 3300053078 | Bacteria | 1081 |
| 570 | Ga0495595_0000513 | 3300053084 | Bacteria | 14746 |
| 571 | Ga0495595_0003895 | 3300053084 | Bacteria | 5954 |
| 572 | Ga0495595_0004855 | 3300053084 | Bacteria | 5418 |
| 573 | Ga0495595_0008078 | 3300053084 | Bacteria | 4313 |
| 574 | Ga0495595_0021187 | 3300053084 | Bacteria | 2837 |
| 575 | Ga0495619_0000043 | 3300053085 | Bacteria | 109865 |
| 576 | Ga0495619_0001190 | 3300053085 | Bacteria | 17140 |
| 577 | Ga0495619_0045572 | 3300053085 | Bacteria | 2881 |
| 578 | Ga0495619_0073422 | 3300053085 | Bacteria | 2292 |
| 579 | Ga0495619_0078568 | 3300053085 | Bacteria | 2218 |
| 580 | Ga0500644_0000854 | 3300053088 | Bacteria | 10057 |
| 581 | Ga0500566_0216642 | 3300053094 | Bacteria | 955 |
| 582 | Ga0500597_236184 | 3300053120 | Bacteria | 754 |
| 583 | Ga0500652_002948 | 3300053131 | Bacteria | 5128 |
| 584 | Ga0500616_0000002 | 3300053153 | Bacteria | 1611257 |
| 585 | Ga0500639_140675 | 3300053163 | Bacteria | 1129 |
| 586 | Ga0500645_000568 | 3300053730 | Bacteria | 24115 |
| 587 | Ga0501084_0047466 | 3300054114 | Bacteria | 3596 |
| 588 | Ga0501084_0095066 | 3300054114 | Bacteria | 2502 |
| 589 | Ga0501084_0301809 | 3300054114 | Bacteria | 1353 |
| 590 | Ga0501084_0359262 | 3300054114 | Bacteria | 1231 |
| 591 | Ga0501084_1053420 | 3300054114 | Bacteria | 683 |
| 592 | Ga0501084_1430148 | 3300054114 | Bacteria | 579 |
| 593 | Ga0501084_1757168 | 3300054114 | Bacteria | 518 |
| 594 | Ga0587078_066662 | 3300059646 | Bacteria | 555 |
| 595 | Ga0587071_157778 | 3300060344 | Bacteria | 568 |
| 596 | Ga0501082_0000390 | 3300060353 | Bacteria | 38912 |
| 597 | Ga0501082_1482166 | 3300060353 | Bacteria | 592 |
| 598 | Ga0501082_1510951 | 3300060353 | Bacteria | 586 |
| 599 | 2509078819 | 2508501114 | Bacteria | 7082538 |
| 600 | 2776260085 | 2775506901 | Bacteria | 9631051 |
| 601 | 2835317313 | 2835312727 | Bacteria | 7413381 |
| 602 | 2894234040 | 2894232714 | Bacteria | 8834183 |
| 603 | 643598130 | 643348564 | Bacteria | 8839022 |
| 604 | 8054567899 | 8054563764 | Bacteria | 5592885 |
| 605 | Ga0075428_100287212 | |||
| 606 | SwRhRL2b_contig_1956784 | |||
| 607 | 2214600504 | |||
| 608 | JGI24737J22298_10004342 | |||
| 609 | JGI25405J52794_10002301 | |||
| 610 | Ga0065717_1002032 | |||
| 611 | Ga0070690_100050101 | |||
| 612 | Ga0068869_100256389 | |||
| 613 | Ga0070666_10029769 | |||
| 614 | Ga0070682_100061409 | |||
| 615 | Ga0070682_101295315 | |||
| 616 | Ga0068868_100055976 | |||
| 617 | Ga0070689_100043543 | |||
| 618 | Ga0070687_100023438 | |||
| 619 | Ga0070661_100251619 | |||
| 620 | Ga0070671_100210429 | |||
| 621 | Ga0070674_100462947 | |||
| 622 | Ga0070673_100368550 | |||
| 623 | Ga0070688_100179728 | |||
| 624 | Ga0070659_100013896 | |||
| 625 | Ga0070667_100499009 | |||
| 626 | Ga0070709_10204684 | |||
| 627 | Ga0070709_10651171 | |||
| 628 | Ga0070714_100486378 | |||
| 629 | Ga0070714_100733081 | |||
| 630 | Ga0070710_10041620 | |||
| 631 | Ga0070710_10043662 | |||
| 632 | Ga0070701_10117835 | |||
| 633 | Ga0070711_100072347 | |||
| 634 | Ga0070711_100203823 | |||
| 635 | Ga0070663_100195199 | |||
| 636 | Ga0070678_100005474 | |||
| 637 | Ga0070662_100149638 | |||
| 638 | Ga0070662_100315066 | |||
| 639 | Ga0068867_100598996 | |||
| 640 | Ga0070679_100120056 | |||
| 641 | Ga0070684_100304954 | |||
| 642 | Ga0068853_100744102 | |||
| 643 | Ga0070672_100175698 | |||
| 644 | Ga0070696_100286868 | |||
| 645 | Ga0070696_101401134 | |||
| 646 | Ga0070693_100423190 | |||
| 647 | Ga0070665_100072696 | |||
| 648 | Ga0070664_100150916 | |||
| 649 | Ga0070664_100759301 | |||
| 650 | Ga0068852_100171401 | |||
| 651 | Ga0068859_100137060 | |||
| 652 | Ga0068864_100060264 | |||
| 653 | Ga0068864_100172175 | |||
| 654 | Ga0068863_100151043 | |||
| 655 | Ga0068858_100316680 | |||
| 656 | Ga0068860_100040727 | |||
| 657 | Ga0081538_10016340 | |||
| 658 | Ga0070717_10013240 | |||
| 659 | Ga0075368_10202577 | |||
| 660 | Ga0075363_100007985 | |||
| 661 | Ga0075364_10034557 | |||
| 662 | Ga0075432_10003971 | |||
| 663 | Ga0070716_100359254 | |||
| 664 | Ga0070716_100945485 | |||
| 665 | Ga0070712_100162565 | |||
| 666 | Ga0070712_100760423 | |||
| 667 | Ga0070712_101906145 | |||
| 668 | Ga0075362_10103554 | |||
| 669 | Ga0075369_10362965 | |||
| 670 | Ga0075366_10016254 | |||
| 671 | Ga0075370_10275059 | |||
| 672 | Ga0068871_100343385 | |||
| 673 | Ga0075428_101750303 | |||
| 674 | Ga0075431_101815196 | |||
| 675 | Ga0075434_100073097 | |||
| 676 | Ga0068865_100335418 | |||
| 677 | Ga0097620_100137065 | |||
| 678 | Ga0075435_100041956 | |||
| 679 | Ga0075435_100130620 | |||
| 680 | Ga0099795_10011001 | |||
| 681 | Ga0105251_10079612 | |||
| 682 | Ga0105250_10227992 | |||
| 683 | Ga0111539_10013373 | |||
| 684 | Ga0111539_10415342 | |||
| 685 | Ga0111539_12700370 | |||
| 686 | Ga0105245_10374706 | |||
| 687 | Ga0105245_11019497 | |||
| 688 | Ga0105247_10082243 | |||
| 689 | Ga0105243_10055458 | |||
| 690 | Ga0105243_10097325 | |||
| 691 | Ga0105243_10347903 | |||
| 692 | Ga0105242_10131485 | |||
| 693 | Ga0105248_10035800 | |||
| 694 | Ga0105237_10169025 | |||
| 695 | Ga0105237_10327399 | |||
| 696 | Ga0105238_10065409 | |||
| 697 | Ga0105249_10065371 | |||
| 698 | Ga0105239_10169392 | |||
| 699 | Ga0105239_10399570 | |||
| 700 | Ga0105239_10627516 | |||
| 701 | Ga0105239_10890821 | |||
| 702 | Ga0105239_12165075 | |||
| 703 | Ga0105246_10013325 | |||
| 704 | Ga0105246_10185241 | |||
| 705 | Ga0157340_1002148 | |||
| 706 | Ga0157318_1003458 | |||
| 707 | Ga0157321_1012648 | |||
| 708 | Ga0157322_1005823 | |||
| 709 | Ga0157345_1002420 | |||
| 710 | Ga0157373_10170400 | |||
| 711 | Ga0157371_10814365 | |||
| 712 | Ga0157370_10032359 | |||
| 713 | Ga0157370_10074907 | |||
| 714 | Ga0157370_10270398 | |||
| 715 | Ga0157369_11460518 | |||
| 716 | Ga0157374_10664069 | |||
| 717 | Ga0163162_10014117 | |||
| 718 | Ga0157372_10271385 | |||
| 719 | Ga0157372_10777076 | |||
| 720 | Ga0157375_11204811 | |||
| 721 | Ga0163163_10263811 | |||
| 722 | Ga0157380_12149594 | |||
| 723 | Ga0157376_10205597 | |||
| 724 | Ga0206356_10184827 | |||
| 725 | Ga0206350_10997059 | |||
| 726 | Ga0206354_10093528 | |||
| 727 | Ga0213875_10000089 | |||
| 728 | Ga0213875_10201638 | |||
| 729 | Ga0224712_10136000 | |||
| 730 | Ga0224572_1022012 | |||
| 731 | Ga0228598_1035715 | |||
| 732 | Ga0207673_1000584 | |||
| 733 | Ga0207713_1141502 | |||
| 734 | Ga0207692_10013517 | |||
| 735 | Ga0207692_10048951 | |||
| 736 | Ga0207692_10255360 | |||
| 737 | Ga0207642_10206036 | |||
| 738 | Ga0207710_10008457 | |||
| 739 | Ga0207688_10028171 | |||
| 740 | Ga0207680_10056822 | |||
| 741 | Ga0207685_10103634 | |||
| 742 | Ga0207699_10429873 | |||
| 743 | Ga0207699_10472296 | |||
| 744 | Ga0207645_10374105 | |||
| 745 | Ga0207654_10482044 | |||
| 746 | Ga0207707_10796429 | |||
| 747 | Ga0207707_11492061 | |||
| 748 | Ga0207671_10044679 | |||
| 749 | Ga0207693_10608041 | |||
| 750 | Ga0207693_10791329 | |||
| 751 | Ga0207693_10927892 | |||
| 752 | Ga0207663_10077549 | |||
| 753 | Ga0207663_10103623 | |||
| 754 | Ga0207660_10094284 | |||
| 755 | Ga0207649_10108617 | |||
| 756 | Ga0207694_10036460 | |||
| 757 | Ga0207700_10127987 | |||
| 758 | Ga0207664_10105111 | |||
| 759 | Ga0207664_10498153 | |||
| 760 | Ga0207664_10874422 | |||
| 761 | Ga0207644_10186112 | |||
| 762 | Ga0207686_10019786 | |||
| 763 | Ga0207709_10161574 | |||
| 764 | Ga0207670_10192613 | |||
| 765 | Ga0207704_10088606 | |||
| 766 | Ga0207665_10005721 | |||
| 767 | Ga0207665_10305291 | |||
| 768 | Ga0207665_10584750 | |||
| 769 | Ga0207711_10009494 | |||
| 770 | Ga0207711_10896309 | |||
| 771 | Ga0207689_10286904 | |||
| 772 | Ga0207661_10075715 | |||
| 773 | Ga0207661_10995422 | |||
| 774 | Ga0207679_10232199 | |||
| 775 | Ga0207651_11103522 | |||
| 776 | Ga0207640_10474981 | |||
| 777 | Ga0207677_10317622 | |||
| 778 | Ga0207703_10034322 | |||
| 779 | Ga0207639_10221594 | |||
| 780 | Ga0207678_10024395 | |||
| 781 | Ga0207648_10058988 | |||
| 782 | Ga0207676_10055628 | |||
| 783 | Ga0207674_11244275 | |||
| 784 | Ga0207675_100565239 | |||
| 785 | Ga0207683_10052783 | |||
| 786 | Ga0207698_10147809 | |||
| 787 | Ga0207698_11419808 | |||
| 788 | Ga0209982_1003242 | |||
| 789 | Ga0210002_1001886 | |||
| 790 | Ga0209966_1032267 | |||
| 791 | Ga0209974_10245761 | |||
| 792 | Ga0207428_10301480 | |||
| 793 | Ga0268266_10070500 | |||
| 794 | Ga0268265_10049667 | |||
| 795 | Ga0268264_10093517 | |||
| 796 | Ga0265318_10035965 | |||
| 797 | Ga0265773_1014771 | |||
| 798 | Ga0265330_10053048 | |||
| 799 | Ga0265328_10046163 | |||
| 800 | Ga0265320_10229065 | |||
| 801 | Ga0265325_10000048 | |||
| 802 | Ga0265325_10061491 | |||
| 803 | Ga0265325_10066451 | |||
| 804 | Ga0265329_10017411 | |||
| 805 | Ga0265329_10112693 | |||
| 806 | Ga0265340_10124099 | |||
| 807 | Ga0265340_10181392 | |||
| 808 | Ga0265339_10015418 | |||
| 809 | Ga0265339_10104822 | |||
| 810 | Ga0265331_10014416 | |||
| 811 | Ga0265331_10025667 | |||
| 812 | Ga0265327_10033019 | |||
| 813 | Ga0265316_10055076 | |||
| 814 | Ga0265316_10074661 | |||
| 815 | Ga0265316_10278415 | |||
| 816 | Ga0307408_100143674 | |||
| 817 | Ga0265313_10014452 | |||
| 818 | Ga0265313_10063547 | |||
| 819 | Ga0265314_10005957 | |||
| 820 | Ga0265314_10068193 | |||
| 821 | Ga0265342_10023758 | |||
| 822 | Ga0265342_10181243 | |||
| 823 | Ga0307410_10261154 | |||
| 824 | Ga0307409_101715911 | |||
| 825 | Ga0307416_102585243 | |||
| 826 | Ga0316593_10142484 | |||
| 827 | Ga0373948_0000177 | |||
| 828 | Ga0373958_0009481 | |||
| 829 | Ga0373938_0013522 | |||
| 830 | Ga0373928_0000089 | |||
| 831 | Ga0373929_0022097 | |||
| 832 | Ga0373929_0099106 | |||
| 833 | Ga0373934_0042477 | |||
| 834 | Ga0373940_0000034 | |||
| 835 | Ga0373944_0002861 | |||
| 836 | Ga0373949_0001494 | |||
| 837 | Ga0373949_0034390 | |||
| 838 | Ga0373952_0063562 | |||
| 839 | Ga0373923_0001890 | |||
| 840 | Ga0373923_0042639 | |||
| 841 | Ga0373936_0027608 | |||
| 842 | Ga0373936_0222998 | |||
| 843 | Ga0373939_0030987 | |||
| 844 | Ga0373945_0016960 | |||
| 845 | Ga0373945_0045946 | |||
| 846 | Ga0373953_0008309 | |||
| 847 | Ga0373953_0023055 | |||
| 848 | Ga0373954_0004193 | |||
| 849 | Ga0373956_0012952 | |||
| 850 | Ga0373957_0012987 | |||
| 851 | Ga0373957_0078751 | |||
| 852 | Ga0373957_0101288 | |||
| 853 | Ga0373943_0013226 | |||
| 854 | Ga0373943_0057338 | |||
| 855 | Ga0373943_0156087 | |||
| 856 | Ga0373946_0001530 | |||
| 857 | Ga0373955_0001031 | |||
| 858 | Ga0373961_0034912 | |||
| 859 | Ga0373961_0438314 | |||
| 860 | Ga0373924_0002051 | |||
| 861 | Ga0373924_0035080 | |||
| 862 | Ga0373931_0190314 | |||
| 863 | Ga0373935_0003239 | |||
| 864 | Ga0373935_0079213 | |||
| 865 | Ga0373935_0094243 | |||
| 866 | Ga0373935_0160818 | |||
| 867 | Ga0373927_0007173 | |||
| 868 | Ga0373927_0032020 | |||
| 869 | Ga0373927_0194687 | |||
| 870 | Ga0373933_0002994 | |||
| 871 | Ga0373933_0004041 | |||
| 872 | Ga0373933_0031324 | |||
| 873 | Ga0373947_0009661 | |||
| 874 | Ga0373947_0016373 | |||
| 875 | Ga0373947_0142327 | |||
| 876 | Ga0373937_0003621 | |||
| 877 | Ga0373937_0017492 | |||
| 878 | Ga0373937_0032927 | |||
| 879 | Ga0373937_0547743 | |||
| 880 | Ga0373925_0002135 | |||
| 881 | Ga0436364_0038355 | |||
| 882 | Ga0436364_0065556 | |||
| 883 | Ga0436364_1470117 | |||
| 884 | Ga0436365_1123258 | |||
| 885 | Ga0436365_1170985 | |||
| 886 | Ga0436361_0286937 | |||
| 887 | Ga0436361_0456752 | |||
| 888 | Ga0436362_0097262 | |||
| 889 | Ga0436362_1128732 | |||
| 890 | Ga0451791_1042633 | |||
| 891 | Ga0439450_176805 | |||
| 892 | Ga0439460_0134653 | |||
| 893 | Ga0439440_0128811 | |||
| 894 | Ga0466965_0280592 | |||
| 895 | Ga0466966_0203186 | |||
| 896 | Ga0466961_0430117 | |||
| 897 | Ga0466963_0129921 | |||
| 898 | Ga0466971_0048304 | |||
| 899 | Ga0466971_0161164 | |||
| 900 | Ga0466971_0351673 | |||
| 901 | Ga0466957_0015423 | |||
| 902 | Ga0466957_0224118 | |||
| 903 | Ga0466957_0659829 | |||
| 904 | Ga0466959_0259910 | |||
| 905 | Ga0451576_0035029 | |||
| 906 | Ga0466958_0022944 | |||
| 907 | Ga0466967_1460695 | |||
| 908 | Ga0495592_0022088 | |||
| 909 | Ga0495592_0060406 | |||
| 910 | Ga0495592_0083372 | |||
| 911 | Ga0495592_0107953 | |||
| 912 | Ga0495603_0070311 | |||
| 913 | Ga0495629_0000409 | |||
| 914 | Ga0495629_0695607 | |||
| 915 | Ga0495641_0003224 | |||
| 916 | Ga0495641_0108933 | |||
| 917 | Ga0495651_0001051 | |||
| 918 | Ga0495651_0015585 | |||
| 919 | Ga0495651_0242477 | |||
| 920 | Ga0495651_0625704 | |||
| 921 | Ga0495653_0001436 | |||
| 922 | Ga0495653_0012022 | |||
| 923 | Ga0495653_0038544 | |||
| 924 | Ga0495653_0106969 | |||
| 925 | Ga0495580_0008552 | |||
| 926 | Ga0495580_0295808 | |||
| 927 | Ga0495582_0017536 | |||
| 928 | Ga0495582_0147182 | |||
| 929 | Ga0495639_0017004 | |||
| 930 | Ga0495639_0527252 | |||
| 931 | Ga0495662_0072456 | |||
| 932 | Ga0495664_0004802 | |||
| 933 | Ga0495664_0007982 | |||
| 934 | Ga0495664_0365228 | |||
| 935 | Ga0495664_0390267 | |||
| 936 | Ga0495594_0014136 | |||
| 937 | Ga0495608_0001582 | |||
| 938 | Ga0495608_0042109 | |||
| 939 | Ga0495608_0126807 | |||
| 940 | Ga0495618_0012253 | |||
| 941 | Ga0495618_0013450 | |||
| 942 | Ga0495618_0129924 | |||
| 943 | Ga0495618_0211329 | |||
| 944 | Ga0495628_0014768 | |||
| 945 | Ga0495628_0033756 | |||
| 946 | Ga0495628_0214617 | |||
| 947 | Ga0495630_0024797 | |||
| 948 | Ga0495630_0105033 | |||
| 949 | Ga0495630_0137890 | |||
| 950 | Ga0495637_0050069 | |||
| 951 | Ga0495644_0048673 | |||
| 952 | Ga0495666_0001411 | |||
| 953 | Ga0495652_0006651 | |||
| 954 | Ga0495652_0018617 | |||
| 955 | Ga0495652_0274002 | |||
| 956 | Ga0495652_0428137 | |||
| 957 | Ga0495640_0006074 | |||
| 958 | Ga0495640_0007693 | |||
| 959 | Ga0495640_0246789 | |||
| 960 | Ga0495640_0285599 | |||
| 961 | Ga0495586_0006303 | |||
| 962 | Ga0495586_0007833 | |||
| 963 | Ga0495587_0009411 | |||
| 964 | Ga0495587_0169449 | |||
| 965 | Ga0495587_0284847 | |||
| 966 | Ga0495645_0063830 | |||
| 967 | Ga0495645_0151962 | |||
| 968 | Ga0495645_0165073 | |||
| 969 | Ga0495645_0279359 | |||
| 970 | Ga0495622_0094505 | |||
| 971 | Ga0495633_0049088 | |||
| 972 | Ga0495667_0000449 | |||
| 973 | Ga0495667_0006887 | |||
| 974 | Ga0495667_0008187 | |||
| 975 | Ga0495667_0043178 | |||
| 976 | Ga0495667_0067493 | |||
| 977 | Ga0495634_0014785 | |||
| 978 | Ga0495634_0050415 | |||
| 979 | Ga0495634_0065529 | |||
| 980 | Ga0495634_0172108 | |||
| 981 | Ga0495634_0562229 | |||
| 982 | Ga0495635_0002604 | |||
| 983 | Ga0495635_0007432 | |||
| 984 | Ga0495635_0013256 | |||
| 985 | Ga0495635_0054278 | |||
| 986 | Ga0495659_0001817 | |||
| 987 | Ga0495588_0002846 | |||
| 988 | Ga0495657_0005844 | |||
| 989 | Ga0495657_0038356 | |||
| 990 | Ga0495657_0254609 | |||
| 991 | Ga0495599_0036016 | |||
| 992 | Ga0495599_0041553 | |||
| 993 | Ga0495623_0005873 | |||
| 994 | Ga0495623_0007576 | |||
| 995 | Ga0495646_0017821 | |||
| 996 | Ga0495646_0085016 | |||
| 997 | Ga0495646_0213286 | |||
| 998 | Ga0495647_0001804 | |||
| 999 | Ga0495647_0028719 | |||
| 1000 | Ga0495658_0006028 | |||
| 1001 | Ga0495658_0046183 | |||
| 1002 | Ga0495613_0201922 | |||
| 1003 | Ga0495624_0024351 | |||
| 1004 | Ga0495624_0388994 | |||
| 1005 | Ga0495624_0669110 | |||
| 1006 | Ga0495600_0005932 | |||
| 1007 | Ga0495600_0008802 | |||
| 1008 | Ga0495600_0052717 | |||
| 1009 | Ga0495600_0400754 | |||
| 1010 | Ga0495581_0009356 | |||
| 1011 | Ga0495581_0023682 | |||
| 1012 | Ga0495581_0090982 | |||
| 1013 | Ga0495604_0001090 | |||
| 1014 | Ga0495604_0004234 | |||
| 1015 | Ga0495604_0021957 | |||
| 1016 | Ga0495604_0061899 | |||
| 1017 | Ga0495674_0001004 | |||
| 1018 | Ga0495674_0012552 | |||
| 1019 | Ga0495674_0034532 | |||
| 1020 | Ga0495674_0099490 | |||
| 1021 | Ga0495674_0394896 | |||
| 1022 | Ga0495676_0008886 | |||
| 1023 | Ga0495676_0329467 | |||
| 1024 | Ga0495680_0000795 | |||
| 1025 | Ga0495680_0033335 | |||
| 1026 | Ga0495680_0080399 | |||
| 1027 | Ga0495680_0208510 | |||
| 1028 | Ga0495680_0367235 | |||
| 1029 | Ga0495675_0002919 | |||
| 1030 | Ga0495675_0148338 | |||
| 1031 | Ga0495684_0004924 | |||
| 1032 | Ga0495684_0042209 | |||
| 1033 | Ga0495684_0060914 | |||
| 1034 | Ga0495602_0000618 | |||
| 1035 | Ga0495602_0018296 | |||
| 1036 | Ga0495602_0231646 | |||
| 1037 | Ga0495602_0243472 | |||
| 1038 | Ga0495614_0042300 | |||
| 1039 | Ga0496100_0332039 | |||
| 1040 | Ga0496100_0978206 | |||
| 1041 | Ga0496101_0115746 | |||
| 1042 | Ga0496102_0039450 | |||
| 1043 | Ga0496102_0444421 | |||
| 1044 | Ga0496103_0003651 | |||
| 1045 | Ga0496105_0004873 | |||
| 1046 | Ga0496105_0368616 | |||
| 1047 | Ga0496106_0052077 | |||
| 1048 | Ga0496106_0070937 | |||
| 1049 | Ga0496107_0103713 | |||
| 1050 | Ga0496108_0072721 | |||
| 1051 | Ga0496110_0041662 | |||
| 1052 | Ga0496111_0091448 | |||
| 1053 | Ga0496112_0066014 | |||
| 1054 | Ga0496114_0037981 | |||
| 1055 | Ga0501031_0019344 | |||
| 1056 | Ga0501031_0120786 | |||
| 1057 | Ga0501032_0072459 | |||
| 1058 | Ga0501032_0465134 | |||
| 1059 | Ga0501033_0024048 | |||
| 1060 | Ga0501033_0107866 | |||
| 1061 | Ga0501034_0001763 | |||
| 1062 | Ga0501034_0042585 | |||
| 1063 | Ga0501034_0043376 | |||
| 1064 | Ga0501034_0097438 | |||
| 1065 | Ga0501034_0178983 | |||
| 1066 | Ga0501034_0221859 | |||
| 1067 | Ga0501036_0006271 | |||
| 1068 | Ga0501036_0058285 | |||
| 1069 | Ga0501036_0168683 | |||
| 1070 | Ga0501036_0235050 | |||
| 1071 | Ga0501037_0077948 | |||
| 1072 | Ga0501037_0091540 | |||
| 1073 | Ga0501037_0452548 | |||
| 1074 | Ga0501038_0007470 | |||
| 1075 | Ga0501038_0110175 | |||
| 1076 | Ga0501038_0651786 | |||
| 1077 | Ga0501038_1002121 | |||
| 1078 | Ga0501039_0031311 | |||
| 1079 | Ga0501039_0114885 | |||
| 1080 | Ga0501039_0522723 | |||
| 1081 | Ga0501040_0225716 | |||
| 1082 | Ga0501042_0030021 | |||
| 1083 | Ga0501043_0011054 | |||
| 1084 | Ga0501043_0125529 | |||
| 1085 | Ga0501043_0203090 | |||
| 1086 | Ga0501046_0024636 | |||
| 1087 | Ga0501046_0088381 | |||
| 1088 | Ga0501047_0009728 | |||
| 1089 | Ga0501047_0051742 | |||
| 1090 | Ga0501047_0225261 | |||
| 1091 | Ga0501047_0410134 | |||
| 1092 | Ga0501047_1048752 | |||
| 1093 | Ga0501048_0028348 | |||
| 1094 | Ga0501067_0010797 | |||
| 1095 | Ga0501067_0034380 | |||
| 1096 | Ga0501067_0806361 | |||
| 1097 | Ga0501068_0041178 | |||
| 1098 | Ga0501068_0059446 | |||
| 1099 | Ga0501068_0468336 | |||
| 1100 | Ga0501069_0014794 | |||
| 1101 | Ga0501069_0071355 | |||
| 1102 | Ga0501069_0116897 | |||
| 1103 | Ga0501069_0212718 | |||
| 1104 | Ga0501069_0400214 | |||
| 1105 | Ga0501070_0009706 | |||
| 1106 | Ga0501070_0018786 | |||
| 1107 | Ga0501070_0036810 | |||
| 1108 | Ga0501070_0066455 | |||
| 1109 | Ga0501070_0085453 | |||
| 1110 | Ga0501070_0242594 | |||
| 1111 | Ga0501070_0478577 | |||
| 1112 | Ga0501070_0640553 | |||
| 1113 | Ga0501071_0229114 | |||
| 1114 | Ga0501071_0245753 | |||
| 1115 | Ga0501071_0349639 | |||
| 1116 | Ga0501072_0015813 | |||
| 1117 | Ga0501072_0295108 | |||
| 1118 | Ga0501072_0399338 | |||
| 1119 | Ga0501073_0005996 | |||
| 1120 | Ga0501073_0347163 | |||
| 1121 | Ga0501073_0505514 | |||
| 1122 | Ga0501073_1283283 | |||
| 1123 | Ga0501074_0022206 | |||
| 1124 | Ga0501074_0186194 | |||
| 1125 | Ga0501074_0187820 | |||
| 1126 | Ga0501074_0729730 | |||
| 1127 | Ga0501075_0740481 | |||
| 1128 | Ga0501077_0071632 | |||
| 1129 | Ga0501077_0991480 | |||
| 1130 | Ga0501079_0191430 | |||
| 1131 | Ga0501079_0283249 | |||
| 1132 | Ga0501079_0348143 | |||
| 1133 | Ga0501080_0037448 | |||
| 1134 | Ga0501080_0108754 | |||
| 1135 | Ga0501080_0144878 | |||
| 1136 | Ga0501080_1353396 | |||
| 1137 | Ga0501081_0408254 | |||
| 1138 | Ga0501083_0034206 | |||
| 1139 | Ga0501083_0123891 | |||
| 1140 | Ga0501083_0198702 | |||
| 1141 | Ga0501083_0886928 | |||
| 1142 | Ga0501035_0033476 | |||
| 1143 | Ga0501035_0084598 | |||
| 1144 | Ga0501035_0485581 | |||
| 1145 | Ga0501035_0584106 | |||
| 1146 | Ga0501035_0830046 | |||
| 1147 | Ga0501044_0025458 | |||
| 1148 | Ga0501044_0047267 | |||
| 1149 | Ga0501044_0077969 | |||
| 1150 | Ga0501044_0423985 | |||
| 1151 | Ga0501044_0625568 | |||
| 1152 | Ga0501045_0227967 | |||
| 1153 | nmdc:mga03683_53914_c1 | |||
| 1154 | nmdc:mga03n38_146606_c1 | |||
| 1155 | nmdc:mga00v17_22204_c1 | |||
| 1156 | nmdc:mga0k408_12843_c1 | |||
| 1157 | nmdc:mga06r32_1295917_c1 | |||
| 1158 | nmdc:mga08y16_48293_c1 | |||
| 1159 | nmdc:mga08y16_704984_c1 | |||
| 1160 | nmdc:mga0n895_1066454_c1 | |||
| 1161 | nmdc:mga0rr50_176088_c1 | |||
| 1162 | nmdc:mga08x19_23_c1 | |||
| 1163 | nmdc:mga08x19_333374_c1 | |||
| 1164 | Ga0495601_0000507 | |||
| 1165 | Ga0495601_0010162 | |||
| 1166 | Ga0495601_0012444 | |||
| 1167 | Ga0495601_0027402 | |||
| 1168 | Ga0495601_0036135 | |||
| 1169 | Ga0495612_0000967 | |||
| 1170 | Ga0495612_0008438 | |||
| 1171 | Ga0495612_0010242 | |||
| 1172 | Ga0495612_0012393 | |||
| 1173 | Ga0495612_0131619 | |||
| 1174 | Ga0495595_0000513 | |||
| 1175 | Ga0495595_0003895 | |||
| 1176 | Ga0495595_0004855 | |||
| 1177 | Ga0495595_0008078 | |||
| 1178 | Ga0495595_0021187 | |||
| 1179 | Ga0495619_0000043 | |||
| 1180 | Ga0495619_0001190 | |||
| 1181 | Ga0495619_0045572 | |||
| 1182 | Ga0495619_0073422 | |||
| 1183 | Ga0495619_0078568 | |||
| 1184 | Ga0500644_0000854 | |||
| 1185 | Ga0500566_0216642 | |||
| 1186 | Ga0500597_236184 | |||
| 1187 | Ga0500652_002948 | |||
| 1188 | Ga0500616_0000002 | |||
| 1189 | Ga0500639_140675 | |||
| 1190 | Ga0500645_000568 | |||
| 1191 | Ga0501084_0047466 | |||
| 1192 | Ga0501084_0095066 | |||
| 1193 | Ga0501084_0301809 | |||
| 1194 | Ga0501084_0359262 | |||
| 1195 | Ga0501084_1053420 | |||
| 1196 | Ga0501084_1430148 | |||
| 1197 | Ga0501084_1757168 | |||
| 1198 | Ga0587078_066662 | |||
| 1199 | Ga0587071_157778 | |||
| 1200 | Ga0501082_0000390 | |||
| 1201 | Ga0501082_1482166 | |||
| 1202 | Ga0501082_1510951 | |||
| 1203 | 2509078819 | |||
| 1204 | 2776260085 | |||
| 1205 | 2835317313 | |||
| 1206 | 2894234040 | |||
| 1207 | 643598130 | |||
| 1208 | 8054567899 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3g3p-assembly1.cif.gz_B | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.9946 | 49 | 130 |
| 3dnj-assembly2.cif.gz_A | the structure of the caulobacter crescentus clps protease adaptor protein in complex with a n-end rule peptide | 0.9927 | 52 | 130 |
| 3gq1-assembly2.cif.gz_B | the structure of the caulobacter crescentus clps protease adaptor protein in complex with a wlfvqrdske decapeptide | 0.988 | 46 | 130 |
| 3o1f-assembly2.cif.gz_B | p1 crystal form of e. coli clps at 1.4 a resolution | 0.9859 | 51 | 130 |
| 3o1f-assembly1.cif.gz_A | p1 crystal form of e. coli clps at 1.4 a resolution | 0.9832 | 51 | 130 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3o1fA00 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L7/L12, C-terminal domain/Adaptor protein ClpS | 0.9832 | 51 | 130 | 3.30.1390.10 |
| 4ykaD00 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L7/L12, C-terminal domain/Adaptor protein ClpS | 0.9644 | 48 | 130 | 3.30.1390.10 |
| 3o1fA00 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L7/L12, C-terminal domain/Adaptor protein ClpS | 0.9593 | 51 | 130 | 3.30.1390.10 |
| 4ykaD00 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L7/L12, C-terminal domain/Adaptor protein ClpS | 0.9533 | 48 | 130 | 3.30.1390.10 |
| 1r6oD00 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L7/L12, C-terminal domain/Adaptor protein ClpS | 0.9508 | 47 | 130 | 3.30.1390.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4R6YRX6-F1-model_v4 | ATP-dependent Clp protease adapter protein ClpS | 1 | 52 | 130 |
GO:0006508
GO:0008233 GO:0030163 |
| AF-A0A5D0MJJ2-F1-model_v4 | ATP-dependent Clp protease adapter protein ClpS | 0.9988 | 52 | 130 |
GO:0006508
GO:0008233 GO:0030163 |
| AF-A0A157REC3-F1-model_v4 | ATP-dependent Clp protease adapter protein ClpS | 0.9987 | 52 | 128 |
GO:0006508
GO:0008233 GO:0030163 |
| AF-A0A435SVZ8-F1-model_v4 | ATP-dependent Clp protease adapter ClpS | 0.9985 | 55 | 130 |
GO:0006508
GO:0008233 GO:0030163 |
| AF-A0A836TTE9-F1-model_v4 | ATP-dependent Clp protease adapter protein ClpS | 0.9981 | 52 | 130 |
GO:0006508
GO:0008233 GO:0030163 |