F468366

General Info

Members Datasets Scaffolds Average Seq Length
604 338 1208 131

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100287212|Ga0075428_1002872121
Length 124
Sequence MIRWPARLTPDPILAGASDLRPRAGTGPGNAVITRTKPQTKKPNLYRVLLLNDDYTPMEFVVHVLERFFNKDREAATRIMLHVHHHGIGECGVFTYEVAETKVTQVMDFARKHQHPLQCVMEKK

Samples

Sample ID Description Type Environment
1 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
6 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
47 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
48 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
49 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
53 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
63 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
64 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300012473 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 Metagenome Rhizosphere
77 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
78 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
79 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
80 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
96 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
98 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
99 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
100 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
150 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
152 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
153 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
154 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
155 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
156 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
157 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
158 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
159 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
160 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
161 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
162 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
163 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
164 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
165 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
166 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
167 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
168 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
170 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
171 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
172 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
173 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
174 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
175 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
176 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
177 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
178 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
179 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
180 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
181 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
182 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
183 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
184 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
185 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
186 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
187 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
188 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
189 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
190 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
191 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
192 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
193 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
194 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
195 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
196 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
197 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
198 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
199 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
200 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
201 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
202 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
203 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
204 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
205 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
206 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
207 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
208 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
209 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
210 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
211 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
212 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
213 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
214 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
215 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
216 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
217 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
218 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
219 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
220 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
221 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
222 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
223 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
224 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
225 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
226 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
227 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
228 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
229 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
230 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
231 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
232 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
233 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
234 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
235 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
236 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
237 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
238 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
239 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
240 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
241 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
242 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
243 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
244 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
245 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
246 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
247 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
248 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
249 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
250 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
251 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
252 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
253 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
254 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
255 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
256 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
257 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
258 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
259 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
260 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
261 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
262 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
263 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
264 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
265 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
266 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
267 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
268 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
269 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
270 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
271 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
272 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
273 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
274 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
275 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
276 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
277 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
278 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
288 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
292 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
293 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
294 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
295 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
296 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
297 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
298 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
299 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
300 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
301 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
302 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
303 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
304 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
305 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
306 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
307 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
309 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
310 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
311 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
312 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
313 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
314 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
315 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
316 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
317 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
318 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
319 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
320 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
321 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
322 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
323 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
324 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
325 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
326 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
327 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
328 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
329 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
330 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
331 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
332 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
333 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
334 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
335 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
336 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
337 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
338 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.68
Metatranscriptomes 1.32
Isolates 0.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.98
Nodule 0.66
Rhizoplane 2.81
Rhizosphere 92.05
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075428_100287212 3300006844 Bacteria 1770
2 SwRhRL2b_contig_1956784 2162886007 Bacteria 3196
3 2214600504 2209111006 Bacteria 5331
4 JGI24737J22298_10004342 3300001990 Bacteria 4950
5 JGI25405J52794_10002301 3300003911 Bacteria 3276
6 Ga0065717_1002032 3300005276 Bacteria 3361
7 Ga0070690_100050101 3300005330 Bacteria 2664
8 Ga0068869_100256389 3300005334 Bacteria 1399
9 Ga0070666_10029769 3300005335 Bacteria 3592
10 Ga0070682_100061409 3300005337 Bacteria 2379
11 Ga0070682_101295315 3300005337 Bacteria 619
12 Ga0068868_100055976 3300005338 Bacteria 3113
13 Ga0070689_100043543 3300005340 Bacteria 3451
14 Ga0070687_100023438 3300005343 Bacteria 2934
15 Ga0070661_100251619 3300005344 Bacteria 1363
16 Ga0070671_100210429 3300005355 Bacteria 1649
17 Ga0070674_100462947 3300005356 Bacteria 1049
18 Ga0070673_100368550 3300005364 Bacteria 1278
19 Ga0070688_100179728 3300005365 Bacteria 1466
20 Ga0070659_100013896 3300005366 Bacteria 6007
21 Ga0070667_100499009 3300005367 Bacteria 1115
22 Ga0070709_10204684 3300005434 Bacteria 1399
23 Ga0070709_10651171 3300005434 Bacteria 816
24 Ga0070714_100486378 3300005435 Bacteria 1176
25 Ga0070714_100733081 3300005435 Bacteria 955
26 Ga0070710_10041620 3300005437 Bacteria 2537
27 Ga0070710_10043662 3300005437 Bacteria 2484
28 Ga0070701_10117835 3300005438 Bacteria 1492
29 Ga0070711_100072347 3300005439 Bacteria 2432
30 Ga0070711_100203823 3300005439 Bacteria 1528
31 Ga0070663_100195199 3300005455 Bacteria 1577
32 Ga0070678_100005474 3300005456 Bacteria 7346
33 Ga0070662_100149638 3300005457 Bacteria 1816
34 Ga0070662_100315066 3300005457 Bacteria 1274
35 Ga0068867_100598996 3300005459 Bacteria 961
36 Ga0070679_100120056 3300005530 Bacteria 2614
37 Ga0070684_100304954 3300005535 Bacteria 1461
38 Ga0068853_100744102 3300005539 Bacteria 937
39 Ga0070672_100175698 3300005543 Bacteria 1783
40 Ga0070696_100286868 3300005546 Bacteria 1256
41 Ga0070696_101401134 3300005546 Bacteria 596
42 Ga0070693_100423190 3300005547 Bacteria 928
43 Ga0070665_100072696 3300005548 Bacteria 3446
44 Ga0070664_100150916 3300005564 Bacteria 2051
45 Ga0070664_100759301 3300005564 Bacteria 905
46 Ga0068852_100171401 3300005616 Bacteria 2035
47 Ga0068859_100137060 3300005617 Bacteria 2521
48 Ga0068864_100060264 3300005618 Bacteria 3286
49 Ga0068864_100172175 3300005618 Bacteria 1974
50 Ga0068863_100151043 3300005841 Bacteria 2222
51 Ga0068858_100316680 3300005842 Bacteria 1490
52 Ga0068860_100040727 3300005843 Bacteria 4439
53 Ga0081538_10016340 3300005981 Bacteria 5696
54 Ga0070717_10013240 3300006028 Bacteria 6313
55 Ga0075368_10202577 3300006042 Bacteria 840
56 Ga0075363_100007985 3300006048 Bacteria 4904
57 Ga0075364_10034557 3300006051 Bacteria 3262
58 Ga0075432_10003971 3300006058 Bacteria 5042
59 Ga0070716_100359254 3300006173 Bacteria 1034
60 Ga0070716_100945485 3300006173 Bacteria 678
61 Ga0070712_100162565 3300006175 Bacteria 1725
62 Ga0070712_100760423 3300006175 Bacteria 830
63 Ga0070712_101906145 3300006175 Bacteria 520
64 Ga0075362_10103554 3300006177 Bacteria 1333
65 Ga0075369_10362965 3300006186 Bacteria 680
66 Ga0075366_10016254 3300006195 Bacteria 4275
67 Ga0075370_10275059 3300006353 Bacteria 1000
68 Ga0068871_100343385 3300006358 Bacteria 1319
69 Ga0075428_101750303 3300006844 Bacteria 648
70 Ga0075431_101815196 3300006847 Bacteria 566
71 Ga0075434_100073097 3300006871 Bacteria 3421
72 Ga0068865_100335418 3300006881 Bacteria 1220
73 Ga0097620_100137065 3300006931 Bacteria 2521
74 Ga0075435_100041956 3300007076 Bacteria 3658
75 Ga0075435_100130620 3300007076 Bacteria 2102
76 Ga0099795_10011001 3300007788 Bacteria 2686
77 Ga0105251_10079612 3300009011 Bacteria 1516
78 Ga0105250_10227992 3300009092 Bacteria 792
79 Ga0111539_10013373 3300009094 Bacteria 10258
80 Ga0111539_10415342 3300009094 Bacteria 1567
81 Ga0111539_12700370 3300009094 Bacteria 575
82 Ga0105245_10374706 3300009098 Bacteria 1416
83 Ga0105245_11019497 3300009098 Bacteria 872
84 Ga0105247_10082243 3300009101 Bacteria 2032
85 Ga0105243_10055458 3300009148 Bacteria 3149
86 Ga0105243_10097325 3300009148 Bacteria 2436
87 Ga0105243_10347903 3300009148 Bacteria 1360
88 Ga0105242_10131485 3300009176 Bacteria 2161
89 Ga0105248_10035800 3300009177 Bacteria 5553
90 Ga0105237_10169025 3300009545 Bacteria 2186
91 Ga0105237_10327399 3300009545 Bacteria 1536
92 Ga0105238_10065409 3300009551 Bacteria 3637
93 Ga0105249_10065371 3300009553 Bacteria 3346
94 Ga0105239_10169392 3300010375 Bacteria 2442
95 Ga0105239_10399570 3300010375 Bacteria 1555
96 Ga0105239_10627516 3300010375 Bacteria 1227
97 Ga0105239_10890821 3300010375 Bacteria 1021
98 Ga0105239_12165075 3300010375 Bacteria 646
99 Ga0105246_10013325 3300011119 Bacteria 5152
100 Ga0105246_10185241 3300011119 Bacteria 1606
101 Ga0157340_1002148 3300012473 Bacteria 983
102 Ga0157318_1003458 3300012482 Bacteria 917
103 Ga0157321_1012648 3300012487 Bacteria 677
104 Ga0157322_1005823 3300012490 Bacteria 861
105 Ga0157345_1002420 3300012498 Bacteria 1320
106 Ga0157373_10170400 3300013100 Bacteria 1532
107 Ga0157371_10814365 3300013102 Bacteria 704
108 Ga0157370_10032359 3300013104 Bacteria 5107
109 Ga0157370_10074907 3300013104 Bacteria 3192
110 Ga0157370_10270398 3300013104 Bacteria 1570
111 Ga0157369_11460518 3300013105 Bacteria 696
112 Ga0157374_10664069 3300013296 Bacteria 1055
113 Ga0163162_10014117 3300013306 Bacteria 7806
114 Ga0157372_10271385 3300013307 Bacteria 1971
115 Ga0157372_10777076 3300013307 Bacteria 1113
116 Ga0157375_11204811 3300013308 Bacteria 888
117 Ga0163163_10263811 3300014325 Bacteria 1773
118 Ga0157380_12149594 3300014326 Bacteria 621
119 Ga0157376_10205597 3300014969 Bacteria 1814
120 Ga0206356_10184827 3300020070 Bacteria 644
121 Ga0206350_10997059 3300020080 Bacteria 2076
122 Ga0206354_10093528 3300020081 Bacteria 692
123 Ga0213875_10000089 3300021388 Bacteria 105772
124 Ga0213875_10201638 3300021388 Bacteria 936
125 Ga0224712_10136000 3300022467 Bacteria 1077
126 Ga0224572_1022012 3300024225 Bacteria 1225
127 Ga0228598_1035715 3300024227 Bacteria 980
128 Ga0207673_1000584 3300025290 Bacteria 3874
129 Ga0207713_1141502 3300025735 Bacteria 785
130 Ga0207692_10013517 3300025898 Bacteria 3543
131 Ga0207692_10048951 3300025898 Bacteria 2130
132 Ga0207692_10255360 3300025898 Bacteria 1052
133 Ga0207642_10206036 3300025899 Bacteria 1090
134 Ga0207710_10008457 3300025900 Bacteria 4341
135 Ga0207688_10028171 3300025901 Bacteria 3091
136 Ga0207680_10056822 3300025903 Bacteria 2365
137 Ga0207685_10103634 3300025905 Bacteria 1221
138 Ga0207699_10429873 3300025906 Bacteria 944
139 Ga0207699_10472296 3300025906 Bacteria 902
140 Ga0207645_10374105 3300025907 Bacteria 955
141 Ga0207654_10482044 3300025911 Bacteria 874
142 Ga0207707_10796429 3300025912 Bacteria 788
143 Ga0207707_11492061 3300025912 Bacteria 536
144 Ga0207671_10044679 3300025914 Bacteria 3276
145 Ga0207693_10608041 3300025915 Bacteria 851
146 Ga0207693_10791329 3300025915 Bacteria 731
147 Ga0207693_10927892 3300025915 Bacteria 667
148 Ga0207663_10077549 3300025916 Bacteria 2163
149 Ga0207663_10103623 3300025916 Bacteria 1917
150 Ga0207660_10094284 3300025917 Bacteria 2225
151 Ga0207649_10108617 3300025920 Bacteria 1849
152 Ga0207694_10036460 3300025924 Bacteria 3775
153 Ga0207700_10127987 3300025928 Bacteria 2069
154 Ga0207664_10105111 3300025929 Bacteria 2339
155 Ga0207664_10498153 3300025929 Bacteria 1091
156 Ga0207664_10874422 3300025929 Bacteria 807
157 Ga0207644_10186112 3300025931 Bacteria 1630
158 Ga0207686_10019786 3300025934 Bacteria 3836
159 Ga0207709_10161574 3300025935 Bacteria 1563
160 Ga0207670_10192613 3300025936 Bacteria 1543
161 Ga0207704_10088606 3300025938 Bacteria 2025
162 Ga0207665_10005721 3300025939 Bacteria 8278
163 Ga0207665_10305291 3300025939 Bacteria 1191
164 Ga0207665_10584750 3300025939 Bacteria 870
165 Ga0207711_10009494 3300025941 Bacteria 8117
166 Ga0207711_10896309 3300025941 Bacteria 825
167 Ga0207689_10286904 3300025942 Bacteria 1363
168 Ga0207661_10075715 3300025944 Bacteria 2762
169 Ga0207661_10995422 3300025944 Bacteria 772
170 Ga0207679_10232199 3300025945 Bacteria 1558
171 Ga0207651_11103522 3300025960 Bacteria 711
172 Ga0207640_10474981 3300025981 Bacteria 1036
173 Ga0207677_10317622 3300026023 Bacteria 1293
174 Ga0207703_10034322 3300026035 Bacteria 4025
175 Ga0207639_10221594 3300026041 Bacteria 1634
176 Ga0207678_10024395 3300026067 Bacteria 5280
177 Ga0207648_10058988 3300026089 Bacteria 3347
178 Ga0207676_10055628 3300026095 Bacteria 3107
179 Ga0207674_11244275 3300026116 Bacteria 714
180 Ga0207675_100565239 3300026118 Bacteria 1138
181 Ga0207683_10052783 3300026121 Bacteria 3563
182 Ga0207698_10147809 3300026142 Bacteria 2035
183 Ga0207698_11419808 3300026142 Bacteria 709
184 Ga0209982_1003242 3300027552 Bacteria 2304
185 Ga0210002_1001886 3300027617 Bacteria 3003
186 Ga0209966_1032267 3300027695 Bacteria 1066
187 Ga0209974_10245761 3300027876 Bacteria 672
188 Ga0207428_10301480 3300027907 Bacteria 1186
189 Ga0268266_10070500 3300028379 Bacteria 3028
190 Ga0268265_10049667 3300028380 Bacteria 3156
191 Ga0268264_10093517 3300028381 Bacteria 2597
192 Ga0265318_10035965 3300028577 Bacteria 1902
193 Ga0265773_1014771 3300031018 Bacteria 711
194 Ga0265330_10053048 3300031235 Bacteria 1775
195 Ga0265328_10046163 3300031239 Bacteria 1601
196 Ga0265320_10229065 3300031240 Bacteria 826
197 Ga0265325_10000048 3300031241 Bacteria 82899
198 Ga0265325_10061491 3300031241 Bacteria 1904
199 Ga0265325_10066451 3300031241 Bacteria 1818
200 Ga0265329_10017411 3300031242 Bacteria 2473
201 Ga0265329_10112693 3300031242 Bacteria 870
202 Ga0265340_10124099 3300031247 Bacteria 1187
203 Ga0265340_10181392 3300031247 Bacteria 951
204 Ga0265339_10015418 3300031249 Bacteria 4580
205 Ga0265339_10104822 3300031249 Bacteria 1468
206 Ga0265331_10014416 3300031250 Bacteria 4210
207 Ga0265331_10025667 3300031250 Bacteria 2971
208 Ga0265327_10033019 3300031251 Bacteria 2890
209 Ga0265316_10055076 3300031344 Bacteria 3112
210 Ga0265316_10074661 3300031344 Bacteria 2609
211 Ga0265316_10278415 3300031344 Bacteria 1223
212 Ga0307408_100143674 3300031548 Bacteria 1876
213 Ga0265313_10014452 3300031595 Bacteria 4662
214 Ga0265313_10063547 3300031595 Bacteria 1720
215 Ga0265314_10005957 3300031711 Bacteria 10889
216 Ga0265314_10068193 3300031711 Bacteria 2392
217 Ga0265342_10023758 3300031712 Bacteria 3875
218 Ga0265342_10181243 3300031712 Bacteria 1153
219 Ga0307410_10261154 3300031852 Bacteria 1351
220 Ga0307409_101715911 3300031995 Bacteria 657
221 Ga0307416_102585243 3300032002 Bacteria 605
222 Ga0316593_10142484 3300032168 Bacteria 869
223 Ga0373948_0000177 3300034817 Bacteria 7265
224 Ga0373958_0009481 3300034819 Bacteria 1603
225 Ga0373938_0013522 3300034957 Bacteria 1550
226 Ga0373928_0000089 3300035084 Bacteria 15937
227 Ga0373929_0022097 3300035085 Bacteria 1296
228 Ga0373929_0099106 3300035085 Bacteria 732
229 Ga0373934_0042477 3300035086 Bacteria 1796
230 Ga0373940_0000034 3300035088 Bacteria 14984
231 Ga0373944_0002861 3300035089 Bacteria 4417
232 Ga0373949_0001494 3300035090 Bacteria 6649
233 Ga0373949_0034390 3300035090 Bacteria 1221
234 Ga0373952_0063562 3300035092 Bacteria 908
235 Ga0373923_0001890 3300035111 Bacteria 6246
236 Ga0373923_0042639 3300035111 Bacteria 1875
237 Ga0373936_0027608 3300035113 Bacteria 2227
238 Ga0373936_0222998 3300035113 Bacteria 837
239 Ga0373939_0030987 3300035114 Bacteria 1543
240 Ga0373945_0016960 3300035116 Bacteria 2463
241 Ga0373945_0045946 3300035116 Bacteria 1592
242 Ga0373953_0008309 3300035117 Bacteria 3520
243 Ga0373953_0023055 3300035117 Bacteria 2354
244 Ga0373954_0004193 3300035118 Bacteria 6181
245 Ga0373956_0012952 3300035119 Bacteria 3465
246 Ga0373957_0012987 3300035120 Bacteria 2817
247 Ga0373957_0078751 3300035120 Bacteria 1298
248 Ga0373957_0101288 3300035120 Bacteria 1153
249 Ga0373943_0013226 3300035170 Bacteria 3724
250 Ga0373943_0057338 3300035170 Bacteria 1935
251 Ga0373943_0156087 3300035170 Bacteria 1239
252 Ga0373946_0001530 3300035171 Bacteria 8040
253 Ga0373955_0001031 3300035172 Bacteria 11831
254 Ga0373961_0034912 3300035241 Bacteria 1424
255 Ga0373961_0438314 3300035241 Bacteria 507
256 Ga0373924_0002051 3300035410 Bacteria 6722
257 Ga0373924_0035080 3300035410 Bacteria 2034
258 Ga0373931_0190314 3300035691 Bacteria 1220
259 Ga0373935_0003239 3300035692 Bacteria 9407
260 Ga0373935_0079213 3300035692 Bacteria 2132
261 Ga0373935_0094243 3300035692 Bacteria 1964
262 Ga0373935_0160818 3300035692 Bacteria 1531
263 Ga0373927_0007173 3300035695 Bacteria 7562
264 Ga0373927_0032020 3300035695 Bacteria 3425
265 Ga0373927_0194687 3300035695 Bacteria 1330
266 Ga0373933_0002994 3300035724 Bacteria 9418
267 Ga0373933_0004041 3300035724 Bacteria 8084
268 Ga0373933_0031324 3300035724 Bacteria 3085
269 Ga0373947_0009661 3300035725 Bacteria 5536
270 Ga0373947_0016373 3300035725 Bacteria 4261
271 Ga0373947_0142327 3300035725 Bacteria 1539
272 Ga0373937_0003621 3300036401 Bacteria 13032
273 Ga0373937_0017492 3300036401 Bacteria 6388
274 Ga0373937_0032927 3300036401 Bacteria 4703
275 Ga0373937_0547743 3300036401 Bacteria 1099
276 Ga0373925_0002135 3300037068 Bacteria 16159
277 Ga0436364_0038355 3300037853 Bacteria 1903
278 Ga0436364_0065556 3300037853 Bacteria 1541
279 Ga0436364_1470117 3300037853 Bacteria 17732
280 Ga0436365_1123258 3300039437 Bacteria 931
281 Ga0436365_1170985 3300039437 Bacteria 1903
282 Ga0436361_0286937 3300039447 Bacteria 566
283 Ga0436361_0456752 3300039447 Bacteria 724
284 Ga0436362_0097262 3300039453 Bacteria 1510
285 Ga0436362_1128732 3300039453 Bacteria 567
286 Ga0451791_1042633 3300041451 Bacteria 525
287 Ga0439450_176805 3300042008 Bacteria 566
288 Ga0439460_0134653 3300042461 Bacteria 816
289 Ga0439440_0128811 3300042993 Bacteria 710
290 Ga0466965_0280592 3300044683 Bacteria 900
291 Ga0466966_0203186 3300044684 Bacteria 1198
292 Ga0466961_0430117 3300044693 Bacteria 800
293 Ga0466963_0129921 3300044694 Bacteria 1739
294 Ga0466971_0048304 3300044719 Bacteria 1913
295 Ga0466971_0161164 3300044719 Bacteria 1050
296 Ga0466971_0351673 3300044719 Bacteria 713
297 Ga0466957_0015423 3300044842 Bacteria 4464
298 Ga0466957_0224118 3300044842 Bacteria 1242
299 Ga0466957_0659829 3300044842 Bacteria 736
300 Ga0466959_0259910 3300045049 Bacteria 1195
301 Ga0451576_0035029 3300045051 Bacteria 5328
302 Ga0466958_0022944 3300045836 Bacteria 3659
303 Ga0466967_1460695 3300045976 Bacteria 681
304 Ga0495592_0022088 3300046454 Bacteria 4840
305 Ga0495592_0060406 3300046454 Bacteria 2788
306 Ga0495592_0083372 3300046454 Bacteria 2308
307 Ga0495592_0107953 3300046454 Bacteria 1973
308 Ga0495603_0070311 3300046455 Bacteria 2057
309 Ga0495629_0000409 3300046459 Bacteria 35959
310 Ga0495629_0695607 3300046459 Bacteria 675
311 Ga0495641_0003224 3300046461 Bacteria 12382
312 Ga0495641_0108933 3300046461 Bacteria 1236
313 Ga0495651_0001051 3300046462 Bacteria 21350
314 Ga0495651_0015585 3300046462 Bacteria 5881
315 Ga0495651_0242477 3300046462 Bacteria 1235
316 Ga0495651_0625704 3300046462 Bacteria 677
317 Ga0495653_0001436 3300046463 Bacteria 18599
318 Ga0495653_0012022 3300046463 Bacteria 7066
319 Ga0495653_0038544 3300046463 Bacteria 3751
320 Ga0495653_0106969 3300046463 Bacteria 2016
321 Ga0495580_0008552 3300046472 Bacteria 8125
322 Ga0495580_0295808 3300046472 Bacteria 1103
323 Ga0495582_0017536 3300046473 Bacteria 3917
324 Ga0495582_0147182 3300046473 Bacteria 1336
325 Ga0495639_0017004 3300046475 Bacteria 3158
326 Ga0495639_0527252 3300046475 Bacteria 604
327 Ga0495662_0072456 3300046476 Bacteria 1670
328 Ga0495664_0004802 3300046477 Bacteria 7392
329 Ga0495664_0007982 3300046477 Bacteria 5893
330 Ga0495664_0365228 3300046477 Bacteria 868
331 Ga0495664_0390267 3300046477 Bacteria 836
332 Ga0495594_0014136 3300046499 Bacteria 4179
333 Ga0495608_0001582 3300046511 Bacteria 16261
334 Ga0495608_0042109 3300046511 Bacteria 3054
335 Ga0495608_0126807 3300046511 Bacteria 1634
336 Ga0495618_0012253 3300046514 Bacteria 5205
337 Ga0495618_0013450 3300046514 Bacteria 4976
338 Ga0495618_0129924 3300046514 Bacteria 1612
339 Ga0495618_0211329 3300046514 Bacteria 1226
340 Ga0495628_0014768 3300046516 Bacteria 6536
341 Ga0495628_0033756 3300046516 Bacteria 4121
342 Ga0495628_0214617 3300046516 Bacteria 1446
343 Ga0495630_0024797 3300046517 Bacteria 4433
344 Ga0495630_0105033 3300046517 Bacteria 2138
345 Ga0495630_0137890 3300046517 Bacteria 1854
346 Ga0495637_0050069 3300046520 Bacteria 1753
347 Ga0495644_0048673 3300046523 Bacteria 1592
348 Ga0495666_0001411 3300046526 Bacteria 11639
349 Ga0495652_0006651 3300046529 Bacteria 10734
350 Ga0495652_0018617 3300046529 Bacteria 6188
351 Ga0495652_0274002 3300046529 Bacteria 1239
352 Ga0495652_0428137 3300046529 Bacteria 931
353 Ga0495640_0006074 3300046533 Bacteria 9578
354 Ga0495640_0007693 3300046533 Bacteria 8475
355 Ga0495640_0246789 3300046533 Bacteria 1119
356 Ga0495640_0285599 3300046533 Bacteria 1027
357 Ga0495586_0006303 3300046535 Bacteria 6337
358 Ga0495586_0007833 3300046535 Bacteria 5698
359 Ga0495587_0009411 3300046536 Bacteria 6262
360 Ga0495587_0169449 3300046536 Bacteria 1241
361 Ga0495587_0284847 3300046536 Bacteria 926
362 Ga0495645_0063830 3300046543 Bacteria 2665
363 Ga0495645_0151962 3300046543 Bacteria 1607
364 Ga0495645_0165073 3300046543 Bacteria 1528
365 Ga0495645_0279359 3300046543 Bacteria 1099
366 Ga0495622_0094505 3300046557 Bacteria 1372
367 Ga0495633_0049088 3300046558 Bacteria 1992
368 Ga0495667_0000449 3300046559 Bacteria 26331
369 Ga0495667_0006887 3300046559 Bacteria 7719
370 Ga0495667_0008187 3300046559 Bacteria 7094
371 Ga0495667_0043178 3300046559 Bacteria 2988
372 Ga0495667_0067493 3300046559 Bacteria 2337
373 Ga0495634_0014785 3300046642 Bacteria 5616
374 Ga0495634_0050415 3300046642 Bacteria 2795
375 Ga0495634_0065529 3300046642 Bacteria 2407
376 Ga0495634_0172108 3300046642 Bacteria 1360
377 Ga0495634_0562229 3300046642 Bacteria 664
378 Ga0495635_0002604 3300046663 Bacteria 12352
379 Ga0495635_0007432 3300046663 Bacteria 7646
380 Ga0495635_0013256 3300046663 Bacteria 5769
381 Ga0495635_0054278 3300046663 Bacteria 2760
382 Ga0495659_0001817 3300046664 Bacteria 7080
383 Ga0495588_0002846 3300046674 Bacteria 7447
384 Ga0495657_0005844 3300046675 Bacteria 9683
385 Ga0495657_0038356 3300046675 Bacteria 3298
386 Ga0495657_0254609 3300046675 Bacteria 1056
387 Ga0495599_0036016 3300046678 Bacteria 3106
388 Ga0495599_0041553 3300046678 Bacteria 2886
389 Ga0495623_0005873 3300046679 Bacteria 7999
390 Ga0495623_0007576 3300046679 Bacteria 7047
391 Ga0495646_0017821 3300046680 Bacteria 4500
392 Ga0495646_0085016 3300046680 Bacteria 1836
393 Ga0495646_0213286 3300046680 Bacteria 1047
394 Ga0495647_0001804 3300046681 Bacteria 6621
395 Ga0495647_0028719 3300046681 Bacteria 2053
396 Ga0495658_0006028 3300046683 Bacteria 5951
397 Ga0495658_0046183 3300046683 Bacteria 2448
398 Ga0495613_0201922 3300046689 Bacteria 1401
399 Ga0495624_0024351 3300046690 Bacteria 3984
400 Ga0495624_0388994 3300046690 Bacteria 837
401 Ga0495624_0669110 3300046690 Bacteria 617
402 Ga0495600_0005932 3300046809 Bacteria 7392
403 Ga0495600_0008802 3300046809 Bacteria 6216
404 Ga0495600_0052717 3300046809 Bacteria 2656
405 Ga0495600_0400754 3300046809 Bacteria 854
406 Ga0495581_0009356 3300047315 Bacteria 5669
407 Ga0495581_0023682 3300047315 Bacteria 3557
408 Ga0495581_0090982 3300047315 Bacteria 1770
409 Ga0495604_0001090 3300047317 Bacteria 22540
410 Ga0495604_0004234 3300047317 Bacteria 11355
411 Ga0495604_0021957 3300047317 Bacteria 5094
412 Ga0495604_0061899 3300047317 Bacteria 2861
413 Ga0495674_0001004 3300047319 Bacteria 27097
414 Ga0495674_0012552 3300047319 Bacteria 7980
415 Ga0495674_0034532 3300047319 Bacteria 4573
416 Ga0495674_0099490 3300047319 Bacteria 2475
417 Ga0495674_0394896 3300047319 Bacteria 1117
418 Ga0495676_0008886 3300047321 Bacteria 9176
419 Ga0495676_0329467 3300047321 Bacteria 1024
420 Ga0495680_0000795 3300047322 Bacteria 35314
421 Ga0495680_0033335 3300047322 Bacteria 4171
422 Ga0495680_0080399 3300047322 Bacteria 2463
423 Ga0495680_0208510 3300047322 Bacteria 1399
424 Ga0495680_0367235 3300047322 Bacteria 999
425 Ga0495675_0002919 3300047444 Bacteria 10270
426 Ga0495675_0148338 3300047444 Bacteria 1450
427 Ga0495684_0004924 3300047471 Bacteria 10427
428 Ga0495684_0042209 3300047471 Bacteria 3494
429 Ga0495684_0060914 3300047471 Bacteria 2872
430 Ga0495602_0000618 3300048088 Bacteria 33441
431 Ga0495602_0018296 3300048088 Bacteria 7002
432 Ga0495602_0231646 3300048088 Bacteria 1387
433 Ga0495602_0243472 3300048088 Bacteria 1344
434 Ga0495614_0042300 3300048089 Bacteria 1953
435 Ga0496100_0332039 3300048903 Bacteria 1144
436 Ga0496100_0978206 3300048903 Bacteria 666
437 Ga0496101_0115746 3300048904 Bacteria 2022
438 Ga0496102_0039450 3300048905 Bacteria 4267
439 Ga0496102_0444421 3300048905 Bacteria 1216
440 Ga0496103_0003651 3300048906 Bacteria 9370
441 Ga0496105_0004873 3300048908 Bacteria 10137
442 Ga0496105_0368616 3300048908 Bacteria 1144
443 Ga0496106_0052077 3300048909 Bacteria 3087
444 Ga0496106_0070937 3300048909 Bacteria 2661
445 Ga0496107_0103713 3300048910 Bacteria 2086
446 Ga0496108_0072721 3300048911 Bacteria 2902
447 Ga0496110_0041662 3300048913 Bacteria 4007
448 Ga0496111_0091448 3300048914 Bacteria 2229
449 Ga0496112_0066014 3300048915 Bacteria 3570
450 Ga0496114_0037981 3300048917 Bacteria 3983
451 Ga0501031_0019344 3300049568 Bacteria 4436
452 Ga0501031_0120786 3300049568 Bacteria 1712
453 Ga0501032_0072459 3300049569 Bacteria 2296
454 Ga0501032_0465134 3300049569 Bacteria 809
455 Ga0501033_0024048 3300049570 Bacteria 4596
456 Ga0501033_0107866 3300049570 Bacteria 2028
457 Ga0501034_0001763 3300049571 Bacteria 27682
458 Ga0501034_0042585 3300049571 Bacteria 4596
459 Ga0501034_0043376 3300049571 Bacteria 4552
460 Ga0501034_0097438 3300049571 Bacteria 2936
461 Ga0501034_0178983 3300049571 Bacteria 2086
462 Ga0501034_0221859 3300049571 Bacteria 1842
463 Ga0501036_0006271 3300049572 Bacteria 9646
464 Ga0501036_0058285 3300049572 Bacteria 3271
465 Ga0501036_0168683 3300049572 Bacteria 1844
466 Ga0501036_0235050 3300049572 Bacteria 1537
467 Ga0501037_0077948 3300049573 Bacteria 2404
468 Ga0501037_0091540 3300049573 Bacteria 2199
469 Ga0501037_0452548 3300049573 Bacteria 875
470 Ga0501038_0007470 3300049574 Bacteria 10084
471 Ga0501038_0110175 3300049574 Bacteria 2281
472 Ga0501038_0651786 3300049574 Bacteria 792
473 Ga0501038_1002121 3300049574 Bacteria 613
474 Ga0501039_0031311 3300049575 Bacteria 4100
475 Ga0501039_0114885 3300049575 Bacteria 2106
476 Ga0501039_0522723 3300049575 Bacteria 932
477 Ga0501040_0225716 3300049576 Bacteria 1333
478 Ga0501042_0030021 3300049578 Bacteria 3838
479 Ga0501043_0011054 3300049579 Bacteria 7070
480 Ga0501043_0125529 3300049579 Bacteria 2012
481 Ga0501043_0203090 3300049579 Bacteria 1537
482 Ga0501046_0024636 3300049580 Bacteria 4933
483 Ga0501046_0088381 3300049580 Bacteria 2386
484 Ga0501047_0009728 3300049581 Bacteria 9092
485 Ga0501047_0051742 3300049581 Bacteria 3969
486 Ga0501047_0225261 3300049581 Bacteria 1730
487 Ga0501047_0410134 3300049581 Bacteria 1187
488 Ga0501047_1048752 3300049581 Bacteria 628
489 Ga0501048_0028348 3300049582 Bacteria 4063
490 Ga0501067_0010797 3300049583 Bacteria 5052
491 Ga0501067_0034380 3300049583 Bacteria 2813
492 Ga0501067_0806361 3300049583 Bacteria 529
493 Ga0501068_0041178 3300049584 Bacteria 2775
494 Ga0501068_0059446 3300049584 Bacteria 2320
495 Ga0501068_0468336 3300049584 Bacteria 816
496 Ga0501069_0014794 3300049585 Bacteria 4175
497 Ga0501069_0071355 3300049585 Bacteria 1946
498 Ga0501069_0116897 3300049585 Bacteria 1521
499 Ga0501069_0212718 3300049585 Bacteria 1122
500 Ga0501069_0400214 3300049585 Bacteria 812
501 Ga0501070_0009706 3300049586 Bacteria 8139
502 Ga0501070_0018786 3300049586 Bacteria 5799
503 Ga0501070_0036810 3300049586 Bacteria 4086
504 Ga0501070_0066455 3300049586 Bacteria 2986
505 Ga0501070_0085453 3300049586 Bacteria 2612
506 Ga0501070_0242594 3300049586 Bacteria 1475
507 Ga0501070_0478577 3300049586 Bacteria 1002
508 Ga0501070_0640553 3300049586 Bacteria 844
509 Ga0501071_0229114 3300049587 Bacteria 1399
510 Ga0501071_0245753 3300049587 Bacteria 1350
511 Ga0501071_0349639 3300049587 Bacteria 1125
512 Ga0501072_0015813 3300049588 Bacteria 5785
513 Ga0501072_0295108 3300049588 Bacteria 1288
514 Ga0501072_0399338 3300049588 Bacteria 1090
515 Ga0501073_0005996 3300049589 Bacteria 9068
516 Ga0501073_0347163 3300049589 Bacteria 1024
517 Ga0501073_0505514 3300049589 Bacteria 835
518 Ga0501073_1283283 3300049589 Bacteria 502
519 Ga0501074_0022206 3300049590 Bacteria 4610
520 Ga0501074_0186194 3300049590 Bacteria 1480
521 Ga0501074_0187820 3300049590 Bacteria 1473
522 Ga0501074_0729730 3300049590 Bacteria 699
523 Ga0501075_0740481 3300049591 Bacteria 748
524 Ga0501077_0071632 3300049593 Bacteria 2197
525 Ga0501077_0991480 3300049593 Bacteria 541
526 Ga0501079_0191430 3300049741 Bacteria 1596
527 Ga0501079_0283249 3300049741 Bacteria 1296
528 Ga0501079_0348143 3300049741 Bacteria 1161
529 Ga0501080_0037448 3300049742 Bacteria 4531
530 Ga0501080_0108754 3300049742 Bacteria 2569
531 Ga0501080_0144878 3300049742 Bacteria 2196
532 Ga0501080_1353396 3300049742 Bacteria 608
533 Ga0501081_0408254 3300049743 Bacteria 1006
534 Ga0501083_0034206 3300049744 Bacteria 3475
535 Ga0501083_0123891 3300049744 Bacteria 1694
536 Ga0501083_0198702 3300049744 Bacteria 1308
537 Ga0501083_0886928 3300049744 Bacteria 580
538 Ga0501035_0033476 3300049822 Bacteria 4674
539 Ga0501035_0084598 3300049822 Bacteria 2797
540 Ga0501035_0485581 3300049822 Bacteria 1018
541 Ga0501035_0584106 3300049822 Bacteria 912
542 Ga0501035_0830046 3300049822 Bacteria 736
543 Ga0501044_0025458 3300049823 Bacteria 6271
544 Ga0501044_0047267 3300049823 Bacteria 4451
545 Ga0501044_0077969 3300049823 Bacteria 3359
546 Ga0501044_0423985 3300049823 Bacteria 1240
547 Ga0501044_0625568 3300049823 Bacteria 967
548 Ga0501045_0227967 3300049824 Bacteria 1387
549 nmdc:mga03683_53914_c1 3300050489 Bacteria 1685
550 nmdc:mga03n38_146606_c1 3300050490 Bacteria 1184
551 nmdc:mga00v17_22204_c1 3300050491 Bacteria 3659
552 nmdc:mga0k408_12843_c1 3300050493 Bacteria 4585
553 nmdc:mga06r32_1295917_c1 3300050510 Bacteria 672
554 nmdc:mga08y16_48293_c1 3300050511 Bacteria 4454
555 nmdc:mga08y16_704984_c1 3300050511 Bacteria 1009
556 nmdc:mga0n895_1066454_c1 3300050512 Bacteria 787
557 nmdc:mga0rr50_176088_c1 3300050513 Bacteria 1746
558 nmdc:mga08x19_23_c1 3300050514 Bacteria 288286
559 nmdc:mga08x19_333374_c1 3300050514 Bacteria 1057
560 Ga0495601_0000507 3300053077 Bacteria 20511
561 Ga0495601_0010162 3300053077 Bacteria 5593
562 Ga0495601_0012444 3300053077 Bacteria 5104
563 Ga0495601_0027402 3300053077 Bacteria 3522
564 Ga0495601_0036135 3300053077 Bacteria 3084
565 Ga0495612_0000967 3300053078 Bacteria 11812
566 Ga0495612_0008438 3300053078 Bacteria 4179
567 Ga0495612_0010242 3300053078 Bacteria 3793
568 Ga0495612_0012393 3300053078 Bacteria 3436
569 Ga0495612_0131619 3300053078 Bacteria 1081
570 Ga0495595_0000513 3300053084 Bacteria 14746
571 Ga0495595_0003895 3300053084 Bacteria 5954
572 Ga0495595_0004855 3300053084 Bacteria 5418
573 Ga0495595_0008078 3300053084 Bacteria 4313
574 Ga0495595_0021187 3300053084 Bacteria 2837
575 Ga0495619_0000043 3300053085 Bacteria 109865
576 Ga0495619_0001190 3300053085 Bacteria 17140
577 Ga0495619_0045572 3300053085 Bacteria 2881
578 Ga0495619_0073422 3300053085 Bacteria 2292
579 Ga0495619_0078568 3300053085 Bacteria 2218
580 Ga0500644_0000854 3300053088 Bacteria 10057
581 Ga0500566_0216642 3300053094 Bacteria 955
582 Ga0500597_236184 3300053120 Bacteria 754
583 Ga0500652_002948 3300053131 Bacteria 5128
584 Ga0500616_0000002 3300053153 Bacteria 1611257
585 Ga0500639_140675 3300053163 Bacteria 1129
586 Ga0500645_000568 3300053730 Bacteria 24115
587 Ga0501084_0047466 3300054114 Bacteria 3596
588 Ga0501084_0095066 3300054114 Bacteria 2502
589 Ga0501084_0301809 3300054114 Bacteria 1353
590 Ga0501084_0359262 3300054114 Bacteria 1231
591 Ga0501084_1053420 3300054114 Bacteria 683
592 Ga0501084_1430148 3300054114 Bacteria 579
593 Ga0501084_1757168 3300054114 Bacteria 518
594 Ga0587078_066662 3300059646 Bacteria 555
595 Ga0587071_157778 3300060344 Bacteria 568
596 Ga0501082_0000390 3300060353 Bacteria 38912
597 Ga0501082_1482166 3300060353 Bacteria 592
598 Ga0501082_1510951 3300060353 Bacteria 586
599 2509078819 2508501114 Bacteria 7082538
600 2776260085 2775506901 Bacteria 9631051
601 2835317313 2835312727 Bacteria 7413381
602 2894234040 2894232714 Bacteria 8834183
603 643598130 643348564 Bacteria 8839022
604 8054567899 8054563764 Bacteria 5592885
605 Ga0075428_100287212
606 SwRhRL2b_contig_1956784
607 2214600504
608 JGI24737J22298_10004342
609 JGI25405J52794_10002301
610 Ga0065717_1002032
611 Ga0070690_100050101
612 Ga0068869_100256389
613 Ga0070666_10029769
614 Ga0070682_100061409
615 Ga0070682_101295315
616 Ga0068868_100055976
617 Ga0070689_100043543
618 Ga0070687_100023438
619 Ga0070661_100251619
620 Ga0070671_100210429
621 Ga0070674_100462947
622 Ga0070673_100368550
623 Ga0070688_100179728
624 Ga0070659_100013896
625 Ga0070667_100499009
626 Ga0070709_10204684
627 Ga0070709_10651171
628 Ga0070714_100486378
629 Ga0070714_100733081
630 Ga0070710_10041620
631 Ga0070710_10043662
632 Ga0070701_10117835
633 Ga0070711_100072347
634 Ga0070711_100203823
635 Ga0070663_100195199
636 Ga0070678_100005474
637 Ga0070662_100149638
638 Ga0070662_100315066
639 Ga0068867_100598996
640 Ga0070679_100120056
641 Ga0070684_100304954
642 Ga0068853_100744102
643 Ga0070672_100175698
644 Ga0070696_100286868
645 Ga0070696_101401134
646 Ga0070693_100423190
647 Ga0070665_100072696
648 Ga0070664_100150916
649 Ga0070664_100759301
650 Ga0068852_100171401
651 Ga0068859_100137060
652 Ga0068864_100060264
653 Ga0068864_100172175
654 Ga0068863_100151043
655 Ga0068858_100316680
656 Ga0068860_100040727
657 Ga0081538_10016340
658 Ga0070717_10013240
659 Ga0075368_10202577
660 Ga0075363_100007985
661 Ga0075364_10034557
662 Ga0075432_10003971
663 Ga0070716_100359254
664 Ga0070716_100945485
665 Ga0070712_100162565
666 Ga0070712_100760423
667 Ga0070712_101906145
668 Ga0075362_10103554
669 Ga0075369_10362965
670 Ga0075366_10016254
671 Ga0075370_10275059
672 Ga0068871_100343385
673 Ga0075428_101750303
674 Ga0075431_101815196
675 Ga0075434_100073097
676 Ga0068865_100335418
677 Ga0097620_100137065
678 Ga0075435_100041956
679 Ga0075435_100130620
680 Ga0099795_10011001
681 Ga0105251_10079612
682 Ga0105250_10227992
683 Ga0111539_10013373
684 Ga0111539_10415342
685 Ga0111539_12700370
686 Ga0105245_10374706
687 Ga0105245_11019497
688 Ga0105247_10082243
689 Ga0105243_10055458
690 Ga0105243_10097325
691 Ga0105243_10347903
692 Ga0105242_10131485
693 Ga0105248_10035800
694 Ga0105237_10169025
695 Ga0105237_10327399
696 Ga0105238_10065409
697 Ga0105249_10065371
698 Ga0105239_10169392
699 Ga0105239_10399570
700 Ga0105239_10627516
701 Ga0105239_10890821
702 Ga0105239_12165075
703 Ga0105246_10013325
704 Ga0105246_10185241
705 Ga0157340_1002148
706 Ga0157318_1003458
707 Ga0157321_1012648
708 Ga0157322_1005823
709 Ga0157345_1002420
710 Ga0157373_10170400
711 Ga0157371_10814365
712 Ga0157370_10032359
713 Ga0157370_10074907
714 Ga0157370_10270398
715 Ga0157369_11460518
716 Ga0157374_10664069
717 Ga0163162_10014117
718 Ga0157372_10271385
719 Ga0157372_10777076
720 Ga0157375_11204811
721 Ga0163163_10263811
722 Ga0157380_12149594
723 Ga0157376_10205597
724 Ga0206356_10184827
725 Ga0206350_10997059
726 Ga0206354_10093528
727 Ga0213875_10000089
728 Ga0213875_10201638
729 Ga0224712_10136000
730 Ga0224572_1022012
731 Ga0228598_1035715
732 Ga0207673_1000584
733 Ga0207713_1141502
734 Ga0207692_10013517
735 Ga0207692_10048951
736 Ga0207692_10255360
737 Ga0207642_10206036
738 Ga0207710_10008457
739 Ga0207688_10028171
740 Ga0207680_10056822
741 Ga0207685_10103634
742 Ga0207699_10429873
743 Ga0207699_10472296
744 Ga0207645_10374105
745 Ga0207654_10482044
746 Ga0207707_10796429
747 Ga0207707_11492061
748 Ga0207671_10044679
749 Ga0207693_10608041
750 Ga0207693_10791329
751 Ga0207693_10927892
752 Ga0207663_10077549
753 Ga0207663_10103623
754 Ga0207660_10094284
755 Ga0207649_10108617
756 Ga0207694_10036460
757 Ga0207700_10127987
758 Ga0207664_10105111
759 Ga0207664_10498153
760 Ga0207664_10874422
761 Ga0207644_10186112
762 Ga0207686_10019786
763 Ga0207709_10161574
764 Ga0207670_10192613
765 Ga0207704_10088606
766 Ga0207665_10005721
767 Ga0207665_10305291
768 Ga0207665_10584750
769 Ga0207711_10009494
770 Ga0207711_10896309
771 Ga0207689_10286904
772 Ga0207661_10075715
773 Ga0207661_10995422
774 Ga0207679_10232199
775 Ga0207651_11103522
776 Ga0207640_10474981
777 Ga0207677_10317622
778 Ga0207703_10034322
779 Ga0207639_10221594
780 Ga0207678_10024395
781 Ga0207648_10058988
782 Ga0207676_10055628
783 Ga0207674_11244275
784 Ga0207675_100565239
785 Ga0207683_10052783
786 Ga0207698_10147809
787 Ga0207698_11419808
788 Ga0209982_1003242
789 Ga0210002_1001886
790 Ga0209966_1032267
791 Ga0209974_10245761
792 Ga0207428_10301480
793 Ga0268266_10070500
794 Ga0268265_10049667
795 Ga0268264_10093517
796 Ga0265318_10035965
797 Ga0265773_1014771
798 Ga0265330_10053048
799 Ga0265328_10046163
800 Ga0265320_10229065
801 Ga0265325_10000048
802 Ga0265325_10061491
803 Ga0265325_10066451
804 Ga0265329_10017411
805 Ga0265329_10112693
806 Ga0265340_10124099
807 Ga0265340_10181392
808 Ga0265339_10015418
809 Ga0265339_10104822
810 Ga0265331_10014416
811 Ga0265331_10025667
812 Ga0265327_10033019
813 Ga0265316_10055076
814 Ga0265316_10074661
815 Ga0265316_10278415
816 Ga0307408_100143674
817 Ga0265313_10014452
818 Ga0265313_10063547
819 Ga0265314_10005957
820 Ga0265314_10068193
821 Ga0265342_10023758
822 Ga0265342_10181243
823 Ga0307410_10261154
824 Ga0307409_101715911
825 Ga0307416_102585243
826 Ga0316593_10142484
827 Ga0373948_0000177
828 Ga0373958_0009481
829 Ga0373938_0013522
830 Ga0373928_0000089
831 Ga0373929_0022097
832 Ga0373929_0099106
833 Ga0373934_0042477
834 Ga0373940_0000034
835 Ga0373944_0002861
836 Ga0373949_0001494
837 Ga0373949_0034390
838 Ga0373952_0063562
839 Ga0373923_0001890
840 Ga0373923_0042639
841 Ga0373936_0027608
842 Ga0373936_0222998
843 Ga0373939_0030987
844 Ga0373945_0016960
845 Ga0373945_0045946
846 Ga0373953_0008309
847 Ga0373953_0023055
848 Ga0373954_0004193
849 Ga0373956_0012952
850 Ga0373957_0012987
851 Ga0373957_0078751
852 Ga0373957_0101288
853 Ga0373943_0013226
854 Ga0373943_0057338
855 Ga0373943_0156087
856 Ga0373946_0001530
857 Ga0373955_0001031
858 Ga0373961_0034912
859 Ga0373961_0438314
860 Ga0373924_0002051
861 Ga0373924_0035080
862 Ga0373931_0190314
863 Ga0373935_0003239
864 Ga0373935_0079213
865 Ga0373935_0094243
866 Ga0373935_0160818
867 Ga0373927_0007173
868 Ga0373927_0032020
869 Ga0373927_0194687
870 Ga0373933_0002994
871 Ga0373933_0004041
872 Ga0373933_0031324
873 Ga0373947_0009661
874 Ga0373947_0016373
875 Ga0373947_0142327
876 Ga0373937_0003621
877 Ga0373937_0017492
878 Ga0373937_0032927
879 Ga0373937_0547743
880 Ga0373925_0002135
881 Ga0436364_0038355
882 Ga0436364_0065556
883 Ga0436364_1470117
884 Ga0436365_1123258
885 Ga0436365_1170985
886 Ga0436361_0286937
887 Ga0436361_0456752
888 Ga0436362_0097262
889 Ga0436362_1128732
890 Ga0451791_1042633
891 Ga0439450_176805
892 Ga0439460_0134653
893 Ga0439440_0128811
894 Ga0466965_0280592
895 Ga0466966_0203186
896 Ga0466961_0430117
897 Ga0466963_0129921
898 Ga0466971_0048304
899 Ga0466971_0161164
900 Ga0466971_0351673
901 Ga0466957_0015423
902 Ga0466957_0224118
903 Ga0466957_0659829
904 Ga0466959_0259910
905 Ga0451576_0035029
906 Ga0466958_0022944
907 Ga0466967_1460695
908 Ga0495592_0022088
909 Ga0495592_0060406
910 Ga0495592_0083372
911 Ga0495592_0107953
912 Ga0495603_0070311
913 Ga0495629_0000409
914 Ga0495629_0695607
915 Ga0495641_0003224
916 Ga0495641_0108933
917 Ga0495651_0001051
918 Ga0495651_0015585
919 Ga0495651_0242477
920 Ga0495651_0625704
921 Ga0495653_0001436
922 Ga0495653_0012022
923 Ga0495653_0038544
924 Ga0495653_0106969
925 Ga0495580_0008552
926 Ga0495580_0295808
927 Ga0495582_0017536
928 Ga0495582_0147182
929 Ga0495639_0017004
930 Ga0495639_0527252
931 Ga0495662_0072456
932 Ga0495664_0004802
933 Ga0495664_0007982
934 Ga0495664_0365228
935 Ga0495664_0390267
936 Ga0495594_0014136
937 Ga0495608_0001582
938 Ga0495608_0042109
939 Ga0495608_0126807
940 Ga0495618_0012253
941 Ga0495618_0013450
942 Ga0495618_0129924
943 Ga0495618_0211329
944 Ga0495628_0014768
945 Ga0495628_0033756
946 Ga0495628_0214617
947 Ga0495630_0024797
948 Ga0495630_0105033
949 Ga0495630_0137890
950 Ga0495637_0050069
951 Ga0495644_0048673
952 Ga0495666_0001411
953 Ga0495652_0006651
954 Ga0495652_0018617
955 Ga0495652_0274002
956 Ga0495652_0428137
957 Ga0495640_0006074
958 Ga0495640_0007693
959 Ga0495640_0246789
960 Ga0495640_0285599
961 Ga0495586_0006303
962 Ga0495586_0007833
963 Ga0495587_0009411
964 Ga0495587_0169449
965 Ga0495587_0284847
966 Ga0495645_0063830
967 Ga0495645_0151962
968 Ga0495645_0165073
969 Ga0495645_0279359
970 Ga0495622_0094505
971 Ga0495633_0049088
972 Ga0495667_0000449
973 Ga0495667_0006887
974 Ga0495667_0008187
975 Ga0495667_0043178
976 Ga0495667_0067493
977 Ga0495634_0014785
978 Ga0495634_0050415
979 Ga0495634_0065529
980 Ga0495634_0172108
981 Ga0495634_0562229
982 Ga0495635_0002604
983 Ga0495635_0007432
984 Ga0495635_0013256
985 Ga0495635_0054278
986 Ga0495659_0001817
987 Ga0495588_0002846
988 Ga0495657_0005844
989 Ga0495657_0038356
990 Ga0495657_0254609
991 Ga0495599_0036016
992 Ga0495599_0041553
993 Ga0495623_0005873
994 Ga0495623_0007576
995 Ga0495646_0017821
996 Ga0495646_0085016
997 Ga0495646_0213286
998 Ga0495647_0001804
999 Ga0495647_0028719
1000 Ga0495658_0006028
1001 Ga0495658_0046183
1002 Ga0495613_0201922
1003 Ga0495624_0024351
1004 Ga0495624_0388994
1005 Ga0495624_0669110
1006 Ga0495600_0005932
1007 Ga0495600_0008802
1008 Ga0495600_0052717
1009 Ga0495600_0400754
1010 Ga0495581_0009356
1011 Ga0495581_0023682
1012 Ga0495581_0090982
1013 Ga0495604_0001090
1014 Ga0495604_0004234
1015 Ga0495604_0021957
1016 Ga0495604_0061899
1017 Ga0495674_0001004
1018 Ga0495674_0012552
1019 Ga0495674_0034532
1020 Ga0495674_0099490
1021 Ga0495674_0394896
1022 Ga0495676_0008886
1023 Ga0495676_0329467
1024 Ga0495680_0000795
1025 Ga0495680_0033335
1026 Ga0495680_0080399
1027 Ga0495680_0208510
1028 Ga0495680_0367235
1029 Ga0495675_0002919
1030 Ga0495675_0148338
1031 Ga0495684_0004924
1032 Ga0495684_0042209
1033 Ga0495684_0060914
1034 Ga0495602_0000618
1035 Ga0495602_0018296
1036 Ga0495602_0231646
1037 Ga0495602_0243472
1038 Ga0495614_0042300
1039 Ga0496100_0332039
1040 Ga0496100_0978206
1041 Ga0496101_0115746
1042 Ga0496102_0039450
1043 Ga0496102_0444421
1044 Ga0496103_0003651
1045 Ga0496105_0004873
1046 Ga0496105_0368616
1047 Ga0496106_0052077
1048 Ga0496106_0070937
1049 Ga0496107_0103713
1050 Ga0496108_0072721
1051 Ga0496110_0041662
1052 Ga0496111_0091448
1053 Ga0496112_0066014
1054 Ga0496114_0037981
1055 Ga0501031_0019344
1056 Ga0501031_0120786
1057 Ga0501032_0072459
1058 Ga0501032_0465134
1059 Ga0501033_0024048
1060 Ga0501033_0107866
1061 Ga0501034_0001763
1062 Ga0501034_0042585
1063 Ga0501034_0043376
1064 Ga0501034_0097438
1065 Ga0501034_0178983
1066 Ga0501034_0221859
1067 Ga0501036_0006271
1068 Ga0501036_0058285
1069 Ga0501036_0168683
1070 Ga0501036_0235050
1071 Ga0501037_0077948
1072 Ga0501037_0091540
1073 Ga0501037_0452548
1074 Ga0501038_0007470
1075 Ga0501038_0110175
1076 Ga0501038_0651786
1077 Ga0501038_1002121
1078 Ga0501039_0031311
1079 Ga0501039_0114885
1080 Ga0501039_0522723
1081 Ga0501040_0225716
1082 Ga0501042_0030021
1083 Ga0501043_0011054
1084 Ga0501043_0125529
1085 Ga0501043_0203090
1086 Ga0501046_0024636
1087 Ga0501046_0088381
1088 Ga0501047_0009728
1089 Ga0501047_0051742
1090 Ga0501047_0225261
1091 Ga0501047_0410134
1092 Ga0501047_1048752
1093 Ga0501048_0028348
1094 Ga0501067_0010797
1095 Ga0501067_0034380
1096 Ga0501067_0806361
1097 Ga0501068_0041178
1098 Ga0501068_0059446
1099 Ga0501068_0468336
1100 Ga0501069_0014794
1101 Ga0501069_0071355
1102 Ga0501069_0116897
1103 Ga0501069_0212718
1104 Ga0501069_0400214
1105 Ga0501070_0009706
1106 Ga0501070_0018786
1107 Ga0501070_0036810
1108 Ga0501070_0066455
1109 Ga0501070_0085453
1110 Ga0501070_0242594
1111 Ga0501070_0478577
1112 Ga0501070_0640553
1113 Ga0501071_0229114
1114 Ga0501071_0245753
1115 Ga0501071_0349639
1116 Ga0501072_0015813
1117 Ga0501072_0295108
1118 Ga0501072_0399338
1119 Ga0501073_0005996
1120 Ga0501073_0347163
1121 Ga0501073_0505514
1122 Ga0501073_1283283
1123 Ga0501074_0022206
1124 Ga0501074_0186194
1125 Ga0501074_0187820
1126 Ga0501074_0729730
1127 Ga0501075_0740481
1128 Ga0501077_0071632
1129 Ga0501077_0991480
1130 Ga0501079_0191430
1131 Ga0501079_0283249
1132 Ga0501079_0348143
1133 Ga0501080_0037448
1134 Ga0501080_0108754
1135 Ga0501080_0144878
1136 Ga0501080_1353396
1137 Ga0501081_0408254
1138 Ga0501083_0034206
1139 Ga0501083_0123891
1140 Ga0501083_0198702
1141 Ga0501083_0886928
1142 Ga0501035_0033476
1143 Ga0501035_0084598
1144 Ga0501035_0485581
1145 Ga0501035_0584106
1146 Ga0501035_0830046
1147 Ga0501044_0025458
1148 Ga0501044_0047267
1149 Ga0501044_0077969
1150 Ga0501044_0423985
1151 Ga0501044_0625568
1152 Ga0501045_0227967
1153 nmdc:mga03683_53914_c1
1154 nmdc:mga03n38_146606_c1
1155 nmdc:mga00v17_22204_c1
1156 nmdc:mga0k408_12843_c1
1157 nmdc:mga06r32_1295917_c1
1158 nmdc:mga08y16_48293_c1
1159 nmdc:mga08y16_704984_c1
1160 nmdc:mga0n895_1066454_c1
1161 nmdc:mga0rr50_176088_c1
1162 nmdc:mga08x19_23_c1
1163 nmdc:mga08x19_333374_c1
1164 Ga0495601_0000507
1165 Ga0495601_0010162
1166 Ga0495601_0012444
1167 Ga0495601_0027402
1168 Ga0495601_0036135
1169 Ga0495612_0000967
1170 Ga0495612_0008438
1171 Ga0495612_0010242
1172 Ga0495612_0012393
1173 Ga0495612_0131619
1174 Ga0495595_0000513
1175 Ga0495595_0003895
1176 Ga0495595_0004855
1177 Ga0495595_0008078
1178 Ga0495595_0021187
1179 Ga0495619_0000043
1180 Ga0495619_0001190
1181 Ga0495619_0045572
1182 Ga0495619_0073422
1183 Ga0495619_0078568
1184 Ga0500644_0000854
1185 Ga0500566_0216642
1186 Ga0500597_236184
1187 Ga0500652_002948
1188 Ga0500616_0000002
1189 Ga0500639_140675
1190 Ga0500645_000568
1191 Ga0501084_0047466
1192 Ga0501084_0095066
1193 Ga0501084_0301809
1194 Ga0501084_0359262
1195 Ga0501084_1053420
1196 Ga0501084_1430148
1197 Ga0501084_1757168
1198 Ga0587078_066662
1199 Ga0587071_157778
1200 Ga0501082_0000390
1201 Ga0501082_1482166
1202 Ga0501082_1510951
1203 2509078819
1204 2776260085
1205 2835317313
1206 2894234040
1207 643598130
1208 8054567899

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02617

ClpS

ATP-dependent Clp protease adaptor protein ClpS

41

120

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3g3p-assembly1.cif.gz_B error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9946 49 130
3dnj-assembly2.cif.gz_A the structure of the caulobacter crescentus clps protease adaptor protein in complex with a n-end rule peptide 0.9927 52 130
3gq1-assembly2.cif.gz_B the structure of the caulobacter crescentus clps protease adaptor protein in complex with a wlfvqrdske decapeptide 0.988 46 130
3o1f-assembly2.cif.gz_B p1 crystal form of e. coli clps at 1.4 a resolution 0.9859 51 130
3o1f-assembly1.cif.gz_A p1 crystal form of e. coli clps at 1.4 a resolution 0.9832 51 130
ID Description Score Start End Superfamily
3o1fA00 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L7/L12, C-terminal domain/Adaptor protein ClpS 0.9832 51 130 3.30.1390.10
4ykaD00 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L7/L12, C-terminal domain/Adaptor protein ClpS 0.9644 48 130 3.30.1390.10
3o1fA00 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L7/L12, C-terminal domain/Adaptor protein ClpS 0.9593 51 130 3.30.1390.10
4ykaD00 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L7/L12, C-terminal domain/Adaptor protein ClpS 0.9533 48 130 3.30.1390.10
1r6oD00 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L7/L12, C-terminal domain/Adaptor protein ClpS 0.9508 47 130 3.30.1390.10
ID Description Score Start End GO Terms
AF-A0A4R6YRX6-F1-model_v4 ATP-dependent Clp protease adapter protein ClpS 1 52 130 GO:0006508
GO:0008233
GO:0030163
AF-A0A5D0MJJ2-F1-model_v4 ATP-dependent Clp protease adapter protein ClpS 0.9988 52 130 GO:0006508
GO:0008233
GO:0030163
AF-A0A157REC3-F1-model_v4 ATP-dependent Clp protease adapter protein ClpS 0.9987 52 128 GO:0006508
GO:0008233
GO:0030163
AF-A0A435SVZ8-F1-model_v4 ATP-dependent Clp protease adapter ClpS 0.9985 55 130 GO:0006508
GO:0008233
GO:0030163
AF-A0A836TTE9-F1-model_v4 ATP-dependent Clp protease adapter protein ClpS 0.9981 52 130 GO:0006508
GO:0008233
GO:0030163

Map