F468404

General Info

Members Datasets Scaffolds Average Seq Length
604 317 1208 250

Family's Representative Sequence

Representative Sequence 3300044719|Ga0466971_0018873|Ga0466971_0018873_231_1103
Length 290
Sequence MVSAPADIPAAIILRTAPRRLAGAGAGSRDIERREKVAMARLQEKVALITGGESGIGLATARLFVSEGARVHLVGIDEAKLRTAVEELGEDDALASVADVTDEDAVARAVAAGVERYGRFDVVVSNAGISGEVAPIAEYPSEVFSRTLAVHVLGAFHVLKHTIPHITDGGSVIITSSVVGLIGPPGVSAYVAAKHAQVGLMRTAAKELAPRRIRVNTIHPGPTSTPFQDDIEMRATQLPRDEAAKAFDEMIPLGRHTTPEEIAHGMLYLAADESAMVTSHRLTLDGGMSG

Samples

Sample ID Description Type Environment
1 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
59 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
97 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
98 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
99 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
153 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
157 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
158 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
159 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
160 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
161 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
162 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
163 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
164 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
165 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
166 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
167 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
168 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
169 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
170 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
171 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
172 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
173 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
174 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
175 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
176 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
177 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
178 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
179 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
180 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
181 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
182 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
183 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
184 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
185 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
186 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
187 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
188 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
189 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
190 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
191 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
192 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
193 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
194 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
195 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
196 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
197 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
198 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
199 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
200 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
201 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
202 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
203 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
204 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
205 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
206 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
207 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
208 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
209 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
210 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
211 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
212 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
213 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
214 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
215 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
216 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
217 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
218 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
219 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
220 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
221 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
222 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
223 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
224 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
225 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
226 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
227 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
228 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
229 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
230 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
231 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
232 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
233 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
234 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
235 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
236 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
237 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
238 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
239 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
240 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
241 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
242 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
243 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
244 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
245 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
246 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
247 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
248 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
249 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
250 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
251 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
252 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
253 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
254 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
255 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
266 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
267 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
268 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
269 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
270 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
271 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
272 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
273 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
274 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
275 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
276 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
277 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
278 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
280 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
281 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
282 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
283 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
284 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
285 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
286 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
287 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
288 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
289 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
290 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
291 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
292 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
293 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
294 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
295 3300053113 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 endosphere Metagenome Endosphere
296 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
297 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
298 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
299 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
300 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
301 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
302 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
303 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
304 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
305 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
306 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
307 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
308 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
309 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
310 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
311 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
312 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
313 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
314 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
315 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
316 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
317 8054558443 Rhizobium alarense TRM95111 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.01
Metatranscriptomes 0.33
Isolates 1.66

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.81
Nodule 0.33
Rhizoplane 4.97
Rhizosphere 82.95
Stem 0
Stem Tuber 0
Unclassified 2.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466971_0018873 3300044719 Bacteria 3058
2 JGI24751J29686_10000456 3300002459 Bacteria 12297
3 Ga0065707_10095761 3300005295 Bacteria 3341
4 Ga0070683_100142499 3300005329 Bacteria 2271
5 Ga0070683_100875447 3300005329 Bacteria 861
6 Ga0070670_100000046 3300005331 Bacteria 138621
7 Ga0070670_100342905 3300005331 Bacteria 1312
8 Ga0068869_100066477 3300005334 Bacteria 2656
9 Ga0068869_100147579 3300005334 Bacteria 1821
10 Ga0070666_10126675 3300005335 Bacteria 1772
11 Ga0070666_10237772 3300005335 Bacteria 1287
12 Ga0070682_100082450 3300005337 Bacteria 2084
13 Ga0070682_100089991 3300005337 Bacteria 2006
14 Ga0070682_100172326 3300005337 Bacteria 1505
15 Ga0070682_100423207 3300005337 Bacteria 1013
16 Ga0068868_100010571 3300005338 Bacteria 6689
17 Ga0068868_100049838 3300005338 Bacteria 3287
18 Ga0068868_100162628 3300005338 Bacteria 1844
19 Ga0068868_100188705 3300005338 Bacteria 1714
20 Ga0068868_100309306 3300005338 Bacteria 1344
21 Ga0068868_100521826 3300005338 Bacteria 1043
22 Ga0070660_100273281 3300005339 Bacteria 1382
23 Ga0070689_100526854 3300005340 Bacteria 1015
24 Ga0070689_100737379 3300005340 Bacteria 863
25 Ga0070691_10093451 3300005341 Bacteria 1485
26 Ga0070687_100029154 3300005343 Bacteria 2685
27 Ga0070661_100186224 3300005344 Bacteria 1582
28 Ga0070661_100458987 3300005344 Bacteria 1015
29 Ga0070692_10054720 3300005345 Bacteria 2084
30 Ga0070692_10232141 3300005345 Bacteria 1096
31 Ga0070668_100000066 3300005347 Bacteria 65221
32 Ga0070674_100501552 3300005356 Bacteria 1011
33 Ga0070673_100491569 3300005364 Bacteria 1109
34 Ga0070688_100099402 3300005365 Bacteria 1915
35 Ga0070688_100311130 3300005365 Bacteria 1141
36 Ga0070659_100128822 3300005366 Bacteria 2054
37 Ga0070659_100184916 3300005366 Bacteria 1711
38 Ga0070659_100213820 3300005366 Bacteria 1589
39 Ga0070667_100099909 3300005367 Bacteria 2505
40 Ga0070709_10070334 3300005434 Bacteria 2255
41 Ga0070714_100400648 3300005435 Bacteria 1297
42 Ga0070714_100486928 3300005435 Bacteria 1175
43 Ga0070713_100027756 3300005436 Bacteria 4461
44 Ga0070713_100096141 3300005436 Bacteria 2557
45 Ga0070713_100100360 3300005436 Bacteria 2505
46 Ga0070713_100215104 3300005436 Bacteria 1741
47 Ga0070701_10220497 3300005438 Bacteria 1131
48 Ga0070705_100200495 3300005440 Bacteria 1367
49 Ga0070700_100259421 3300005441 Bacteria 1251
50 Ga0070700_100325137 3300005441 Bacteria 1131
51 Ga0070663_100085920 3300005455 Bacteria 2322
52 Ga0070663_100321396 3300005455 Bacteria 1244
53 Ga0070678_100042974 3300005456 Bacteria 3216
54 Ga0068867_100086592 3300005459 Bacteria 2371
55 Ga0068867_100495559 3300005459 Bacteria 1049
56 Ga0070685_10187863 3300005466 Bacteria 1335
57 Ga0070685_10350077 3300005466 Bacteria 1010
58 Ga0070707_100262684 3300005468 Bacteria 1679
59 Ga0070699_100045161 3300005518 Bacteria 3813
60 Ga0070679_100387866 3300005530 Bacteria 1343
61 Ga0070679_100509525 3300005530 Bacteria 1147
62 Ga0070684_100671155 3300005535 Bacteria 965
63 Ga0070697_100095632 3300005536 Bacteria 2463
64 Ga0070695_100288551 3300005545 Bacteria 1209
65 Ga0070665_100183443 3300005548 Bacteria 2093
66 Ga0070665_100206614 3300005548 Bacteria 1964
67 Ga0070665_100447706 3300005548 Bacteria 1301
68 Ga0070704_100416504 3300005549 Bacteria 1150
69 Ga0070704_100701258 3300005549 Bacteria 898
70 Ga0068855_100008330 3300005563 Bacteria 12532
71 Ga0068855_100677164 3300005563 Bacteria 1106
72 Ga0070664_100089830 3300005564 Bacteria 2658
73 Ga0070664_100109948 3300005564 Bacteria 2404
74 Ga0068857_100017631 3300005577 Bacteria 6260
75 Ga0068857_100253271 3300005577 Bacteria 1614
76 Ga0068857_100392676 3300005577 Bacteria 1290
77 Ga0068854_100151194 3300005578 Bacteria 1790
78 Ga0068856_100037191 3300005614 Bacteria 4775
79 Ga0068856_100213009 3300005614 Bacteria 1947
80 Ga0068856_100419864 3300005614 Bacteria 1358
81 Ga0070702_100027574 3300005615 Bacteria 3067
82 Ga0070702_100082444 3300005615 Bacteria 1929
83 Ga0070702_100256293 3300005615 Bacteria 1188
84 Ga0070702_100322916 3300005615 Bacteria 1076
85 Ga0068852_100134516 3300005616 Bacteria 2281
86 Ga0068852_100138396 3300005616 Bacteria 2250
87 Ga0068852_100192864 3300005616 Bacteria 1923
88 Ga0068852_100330282 3300005616 Bacteria 1483
89 Ga0068859_100001206 3300005617 Bacteria 26384
90 Ga0068859_100292339 3300005617 Bacteria 1722
91 Ga0068864_100000010 3300005618 Bacteria 358723
92 Ga0068864_100162716 3300005618 Bacteria 2029
93 Ga0068864_100197510 3300005618 Bacteria 1847
94 Ga0068864_100248159 3300005618 Bacteria 1652
95 Ga0068866_10064625 3300005718 Bacteria 1911
96 Ga0068866_10141188 3300005718 Bacteria 1383
97 Ga0068861_100009173 3300005719 Bacteria 6823
98 Ga0068861_100015219 3300005719 Bacteria 5416
99 Ga0068861_100177791 3300005719 Bacteria 1769
100 Ga0068870_10090768 3300005840 Bacteria 1707
101 Ga0068863_100008004 3300005841 Bacteria 10329
102 Ga0068863_100189269 3300005841 Bacteria 1977
103 Ga0068858_100068995 3300005842 Bacteria 3276
104 Ga0068858_100139016 3300005842 Bacteria 2280
105 Ga0068860_100058707 3300005843 Bacteria 3658
106 Ga0068862_100001740 3300005844 Bacteria 19679
107 Ga0068862_100072318 3300005844 Bacteria 2979
108 Ga0068862_100162306 3300005844 Bacteria 1995
109 Ga0081455_10000922 3300005937 Bacteria 37728
110 Ga0081455_10005818 3300005937 Bacteria 13422
111 Ga0081455_10059496 3300005937 Bacteria 3226
112 Ga0070717_10009834 3300006028 Bacteria 7202
113 Ga0070717_10019668 3300006028 Bacteria 5300
114 Ga0070717_10088715 3300006028 Bacteria 2607
115 Ga0070717_10353587 3300006028 Bacteria 1314
116 Ga0070717_10433007 3300006028 Bacteria 1184
117 Ga0075363_100324431 3300006048 Bacteria 896
118 Ga0075367_10308186 3300006178 Bacteria 997
119 Ga0068871_100156825 3300006358 Bacteria 1944
120 Ga0068871_100453962 3300006358 Bacteria 1149
121 Ga0075428_100093692 3300006844 Bacteria 3275
122 Ga0075430_100525000 3300006846 Bacteria 977
123 Ga0075433_10236201 3300006852 Bacteria 1623
124 Ga0075429_100299416 3300006880 Bacteria 1408
125 Ga0068865_100212924 3300006881 Bacteria 1507
126 Ga0097620_100001206 3300006931 Bacteria 26384
127 Ga0097620_100292331 3300006931 Bacteria 1722
128 Ga0105240_10002625 3300009093 Bacteria 28653
129 Ga0105240_10033613 3300009093 Bacteria 6622
130 Ga0105240_10769646 3300009093 Bacteria 1045
131 Ga0111539_10008000 3300009094 Bacteria 13487
132 Ga0111539_10222617 3300009094 Bacteria 2197
133 Ga0105245_10026782 3300009098 Bacteria 5076
134 Ga0105245_10038922 3300009098 Bacteria 4232
135 Ga0105245_10290503 3300009098 Bacteria 1601
136 Ga0105245_10313939 3300009098 Bacteria 1542
137 Ga0105245_11245678 3300009098 Bacteria 792
138 Ga0105247_10005864 3300009101 Bacteria 7676
139 Ga0105247_10044914 3300009101 Bacteria 2710
140 Ga0105247_10105080 3300009101 Bacteria 1810
141 Ga0105247_10298634 3300009101 Unclassified 1117
142 Ga0105247_10573053 3300009101 Unclassified 833
143 Ga0105243_10021513 3300009148 Bacteria 4897
144 Ga0105243_10025148 3300009148 Bacteria 4547
145 Ga0105243_10062087 3300009148 Bacteria 2991
146 Ga0105243_10167454 3300009148 Bacteria 1900
147 Ga0105243_10260928 3300009148 Bacteria 1551
148 Ga0105241_10003375 3300009174 Bacteria 11895
149 Ga0105241_10071791 3300009174 Bacteria 2689
150 Ga0105242_10064249 3300009176 Bacteria 3025
151 Ga0105248_10002330 3300009177 Bacteria 21066
152 Ga0105248_10351568 3300009177 Bacteria 1659
153 Ga0105237_10002173 3300009545 Bacteria 24616
154 Ga0105238_10077778 3300009551 Bacteria 3308
155 Ga0105238_10599636 3300009551 Bacteria 1109
156 Ga0105238_10652000 3300009551 Bacteria 1063
157 Ga0105249_10000097 3300009553 Bacteria 120886
158 Ga0105249_10053906 3300009553 Bacteria 3676
159 Ga0105249_10145101 3300009553 Bacteria 2279
160 Ga0105249_10259197 3300009553 Bacteria 1727
161 Ga0105249_11117835 3300009553 Bacteria 858
162 Ga0123342_1027943 3300009766 Bacteria 3099
163 Ga0105239_10012879 3300010375 Bacteria 9305
164 Ga0105239_10015995 3300010375 Bacteria 8303
165 Ga0105239_10027983 3300010375 Bacteria 6202
166 Ga0105239_10055802 3300010375 Bacteria 4333
167 Ga0105239_10156603 3300010375 Bacteria 2544
168 Ga0105246_10023478 3300011119 Bacteria 3991
169 Ga0105246_10468108 3300011119 Bacteria 1063
170 Ga0157342_1003977 3300012507 Bacteria 1293
171 Ga0157371_10138320 3300013102 Bacteria 1735
172 Ga0157370_10181320 3300013104 Bacteria 1957
173 Ga0157369_10366155 3300013105 Bacteria 1496
174 Ga0157378_10134561 3300013297 Bacteria 2291
175 Ga0163162_10072715 3300013306 Bacteria 3494
176 Ga0163162_10199075 3300013306 Bacteria 2132
177 Ga0163162_10607640 3300013306 Bacteria 1219
178 Ga0163162_10754661 3300013306 Bacteria 1092
179 Ga0157372_10247396 3300013307 Bacteria 2069
180 Ga0157375_10700047 3300013308 Bacteria 1167
181 Ga0163163_10024952 3300014325 Bacteria 5693
182 Ga0163163_10130716 3300014325 Bacteria 2551
183 Ga0157380_10047428 3300014326 Bacteria 3379
184 Ga0157380_10468757 3300014326 Bacteria 1214
185 Ga0182008_10171795 3300014497 Bacteria 1094
186 Ga0182008_10176950 3300014497 Bacteria 1078
187 Ga0157377_10291289 3300014745 Bacteria 1074
188 Ga0157379_10006348 3300014968 Bacteria 10182
189 Ga0157379_10143201 3300014968 Bacteria 2155
190 Ga0157379_10503782 3300014968 Bacteria 1122
191 Ga0157376_10168485 3300014969 Bacteria 1992
192 Ga0197907_11135321 3300020069 Bacteria 1063
193 Ga0213874_10014852 3300021377 Bacteria 2043
194 Ga0213874_10041757 3300021377 Unclassified 1375
195 Ga0213874_10057014 3300021377 Unclassified 1214
196 Ga0213876_10008054 3300021384 Bacteria 5713
197 Ga0213876_10016791 3300021384 Bacteria 3866
198 Ga0213876_10166278 3300021384 Unclassified 1173
199 Ga0213875_10000929 3300021388 Bacteria 21127
200 Ga0213875_10002664 3300021388 Bacteria 10538
201 Ga0213875_10007870 3300021388 Bacteria 5477
202 Ga0213875_10008655 3300021388 Bacteria 5197
203 Ga0213875_10037658 3300021388 Bacteria 2279
204 Ga0224712_10177327 3300022467 Bacteria 958
205 Ga0207697_10006485 3300025315 Bacteria 5289
206 Ga0207710_10003909 3300025900 Bacteria 6582
207 Ga0207710_10034309 3300025900 Bacteria 2229
208 Ga0207710_10037715 3300025900 Bacteria 2135
209 Ga0207688_10175522 3300025901 Bacteria 1276
210 Ga0207680_10183394 3300025903 Bacteria 1417
211 Ga0207647_10193303 3300025904 Bacteria 1179
212 Ga0207685_10115292 3300025905 Bacteria 1171
213 Ga0207699_10109588 3300025906 Bacteria 1767
214 Ga0207643_10011188 3300025908 Bacteria 4845
215 Ga0207643_10052164 3300025908 Bacteria 2322
216 Ga0207684_10064032 3300025910 Bacteria 3121
217 Ga0207707_10681749 3300025912 Bacteria 864
218 Ga0207695_10001247 3300025913 Bacteria 43478
219 Ga0207695_10446934 3300025913 Bacteria 1176
220 Ga0207671_10013846 3300025914 Bacteria 6405
221 Ga0207671_10124289 3300025914 Bacteria 1975
222 Ga0207663_10116382 3300025916 Bacteria 1822
223 Ga0207657_10031646 3300025919 Bacteria 4788
224 Ga0207657_10255099 3300025919 Bacteria 1397
225 Ga0207652_10303375 3300025921 Bacteria 1441
226 Ga0207646_10044699 3300025922 Bacteria 3975
227 Ga0207681_10286571 3300025923 Bacteria 1299
228 Ga0207694_10170801 3300025924 Bacteria 1760
229 Ga0207650_10000008 3300025925 Bacteria 498534
230 Ga0207650_10148066 3300025925 Bacteria 1851
231 Ga0207687_10017380 3300025927 Bacteria 4735
232 Ga0207687_10143735 3300025927 Bacteria 1813
233 Ga0207687_10270261 3300025927 Bacteria 1359
234 Ga0207687_10485178 3300025927 Bacteria 1030
235 Ga0207687_10618060 3300025927 Bacteria 914
236 Ga0207700_10020068 3300025928 Bacteria 4530
237 Ga0207700_10026144 3300025928 Bacteria 4066
238 Ga0207700_10082409 3300025928 Bacteria 2515
239 Ga0207664_10045032 3300025929 Bacteria 3458
240 Ga0207664_10344603 3300025929 Bacteria 1318
241 Ga0207644_10066137 3300025931 Bacteria 2631
242 Ga0207690_10036830 3300025932 Bacteria 3171
243 Ga0207690_10103139 3300025932 Bacteria 2041
244 Ga0207690_10146582 3300025932 Bacteria 1746
245 Ga0207690_10279618 3300025932 Bacteria 1299
246 Ga0207706_10159379 3300025933 Bacteria 1984
247 Ga0207709_10010833 3300025935 Bacteria 5022
248 Ga0207670_10011811 3300025936 Bacteria 5082
249 Ga0207704_10022658 3300025938 Bacteria 3370
250 Ga0207704_10197825 3300025938 Bacteria 1468
251 Ga0207665_10070195 3300025939 Bacteria 2390
252 Ga0207691_10043284 3300025940 Bacteria 4150
253 Ga0207711_10078370 3300025941 Bacteria 2882
254 Ga0207711_10374930 3300025941 Bacteria 1320
255 Ga0207689_10110458 3300025942 Bacteria 2259
256 Ga0207689_10415283 3300025942 Bacteria 1122
257 Ga0207661_10155325 3300025944 Bacteria 1981
258 Ga0207661_10162116 3300025944 Bacteria 1941
259 Ga0207679_10160481 3300025945 Bacteria 1840
260 Ga0207679_10251990 3300025945 Bacteria 1501
261 Ga0207679_10359906 3300025945 Bacteria 1270
262 Ga0207667_10551063 3300025949 Bacteria 1166
263 Ga0207651_10440355 3300025960 Bacteria 1116
264 Ga0207712_10000074 3300025961 Bacteria 120822
265 Ga0207712_10106434 3300025961 Bacteria 2095
266 Ga0207712_10824574 3300025961 Bacteria 816
267 Ga0207668_10000055 3300025972 Bacteria 94786
268 Ga0207640_10496355 3300025981 Bacteria 1016
269 Ga0207640_10599609 3300025981 Bacteria 932
270 Ga0207658_10136296 3300025986 Bacteria 1980
271 Ga0207677_10029815 3300026023 Bacteria 3473
272 Ga0207677_10258103 3300026023 Bacteria 1419
273 Ga0207677_10298102 3300026023 Bacteria 1331
274 Ga0207703_10000139 3300026035 Bacteria 86495
275 Ga0207703_10028046 3300026035 Bacteria 4435
276 Ga0207703_10031278 3300026035 Bacteria 4207
277 Ga0207703_10562690 3300026035 Bacteria 1076
278 Ga0207678_10209179 3300026067 Bacteria 1669
279 Ga0207678_10277087 3300026067 Bacteria 1439
280 Ga0207708_10195342 3300026075 Bacteria 1612
281 Ga0207702_10033040 3300026078 Bacteria 4319
282 Ga0207702_10173300 3300026078 Bacteria 1980
283 Ga0207702_10387812 3300026078 Bacteria 1344
284 Ga0207641_10003566 3300026088 Bacteria 13753
285 Ga0207648_10068710 3300026089 Bacteria 3088
286 Ga0207648_10869336 3300026089 Bacteria 841
287 Ga0207676_10018023 3300026095 Bacteria 5126
288 Ga0207676_10089971 3300026095 Bacteria 2517
289 Ga0207674_10033281 3300026116 Bacteria 5397
290 Ga0207674_10035568 3300026116 Bacteria 5198
291 Ga0207674_10479708 3300026116 Bacteria 1202
292 Ga0207675_100008152 3300026118 Bacteria 9874
293 Ga0207675_100018645 3300026118 Bacteria 6477
294 Ga0207675_100037719 3300026118 Bacteria 4508
295 Ga0207675_100486536 3300026118 Bacteria 1227
296 Ga0207675_100845284 3300026118 Bacteria 930
297 Ga0207675_101102829 3300026118 Bacteria 813
298 Ga0207683_10017204 3300026121 Bacteria 6157
299 Ga0207683_10017947 3300026121 Bacteria 6034
300 Ga0207698_10024955 3300026142 Bacteria 4202
301 Ga0207698_10064645 3300026142 Bacteria 2868
302 Ga0207698_10176264 3300026142 Bacteria 1888
303 Ga0207698_10212562 3300026142 Bacteria 1741
304 Ga0207698_10267676 3300026142 Bacteria 1573
305 Ga0207428_10266648 3300027907 Bacteria 1274
306 Ga0268266_10054044 3300028379 Bacteria 3451
307 Ga0268266_10625029 3300028379 Bacteria 1035
308 Ga0268265_10001448 3300028380 Bacteria 20006
309 Ga0268264_10003282 3300028381 Bacteria 13991
310 Ga0307517_10003217 3300028786 Bacteria 25626
311 Ga0307515_10002279 3300028794 Bacteria 42018
312 Ga0265338_10001906 3300028800 Bacteria 32587
313 Ga0265320_10115377 3300031240 Bacteria 1228
314 Ga0265325_10072774 3300031241 Bacteria 1722
315 Ga0265339_10059455 3300031249 Bacteria 2061
316 Ga0307513_10035311 3300031456 Bacteria 5594
317 Ga0307509_10072618 3300031507 Bacteria 3584
318 Ga0265313_10013977 3300031595 Bacteria 4779
319 Ga0265313_10015322 3300031595 Bacteria 4472
320 Ga0307514_10033196 3300031649 Bacteria 4120
321 Ga0265314_10041618 3300031711 Bacteria 3286
322 Ga0307516_10106547 3300031730 Bacteria 2613
323 Ga0307405_10623686 3300031731 Bacteria 883
324 Ga0307413_10461748 3300031824 Bacteria 1010
325 Ga0307406_10157668 3300031901 Bacteria 1628
326 Ga0307409_100070185 3300031995 Bacteria 2780
327 Ga0307409_100788045 3300031995 Bacteria 957
328 Ga0307416_101024429 3300032002 Unclassified 929
329 Ga0307411_10244166 3300032005 Bacteria 1408
330 Ga0373930_0012043 3300034816 Bacteria 1572
331 Ga0373923_0052763 3300035111 Bacteria 1709
332 Ga0373955_0261059 3300035172 Bacteria 1040
333 Ga0373935_0112021 3300035692 Bacteria 1812
334 Ga0373927_0099960 3300035695 Bacteria 1886
335 Ga0373933_0070513 3300035724 Bacteria 2126
336 Ga0373937_0022197 3300036401 Bacteria 5703
337 Ga0373937_0034193 3300036401 Bacteria 4623
338 Ga0316582_0132159 3300036647 Bacteria 1677
339 Ga0316584_0088421 3300036712 Bacteria 2320
340 Ga0373925_0017543 3300037068 Bacteria 5190
341 Ga0373925_0226547 3300037068 Bacteria 1493
342 Ga0395905_0007731 3300037471 Bacteria 10666
343 Ga0395905_0092922 3300037471 Bacteria 2829
344 Ga0436364_0466655 3300037853 Bacteria 48058
345 Ga0436364_0656454 3300037853 Bacteria 2510
346 Ga0436364_0737248 3300037853 Bacteria 154680
347 Ga0436364_0835680 3300037853 Bacteria 25994
348 Ga0436364_0860593 3300037853 Bacteria 4300
349 Ga0436364_1123780 3300037853 Bacteria 10040
350 Ga0436364_1159200 3300037853 Bacteria 7903
351 Ga0436364_1295803 3300037853 Bacteria 6551
352 Ga0436364_1466095 3300037853 Bacteria 4505
353 Ga0436365_0305799 3300039437 Bacteria 969
354 Ga0436365_1071674 3300039437 Bacteria 6177
355 Ga0436365_1150447 3300039437 Bacteria 5826
356 Ga0436365_1158902 3300039437 Bacteria 18203
357 Ga0436365_1162874 3300039437 Bacteria 2389
358 Ga0436365_1182509 3300039437 Bacteria 5942
359 Ga0436365_1305765 3300039437 Bacteria 4353
360 Ga0436360_0277378 3300039438 Bacteria 1356
361 Ga0436363_0082628 3300039450 Bacteria 13021
362 Ga0436363_0531382 3300039450 Unclassified 2431
363 Ga0436363_0914064 3300039450 Bacteria 927
364 Ga0436363_1297426 3300039450 Bacteria 1154
365 Ga0436362_0251874 3300039453 Unclassified 1000
366 Ga0436362_0399807 3300039453 Unclassified 1387
367 Ga0436362_1269108 3300039453 Bacteria 1702
368 Ga0466966_0132140 3300044684 Bacteria 1528
369 Ga0466966_0257900 3300044684 Bacteria 1050
370 Ga0466963_0016111 3300044694 Unclassified 4643
371 Ga0466963_0031811 3300044694 Bacteria 3412
372 Ga0466963_0066931 3300044694 Bacteria 2410
373 Ga0466963_0148929 3300044694 Bacteria 1625
374 Ga0466963_0167539 3300044694 Bacteria 1530
375 Ga0466963_0209607 3300044694 Bacteria 1363
376 Ga0466957_0066308 3300044842 Unclassified 2225
377 Ga0466959_0074323 3300045049 Bacteria 2458
378 Ga0466959_0131683 3300045049 Unclassified 1772
379 Ga0466958_0038227 3300045836 Unclassified 2879
380 Ga0466958_0056484 3300045836 Bacteria 2385
381 Ga0466958_0089245 3300045836 Bacteria 1906
382 Ga0466967_0002066 3300045976 Bacteria 12275
383 Ga0466967_0003480 3300045976 Bacteria 10281
384 Ga0466967_0134366 3300045976 Bacteria 2299
385 Ga0466967_0188586 3300045976 Bacteria 1948
386 Ga0466967_0333489 3300045976 Bacteria 1465
387 Ga0466967_0374661 3300045976 Bacteria 1381
388 Ga0495592_0007364 3300046454 Bacteria 8234
389 Ga0495592_0016107 3300046454 Bacteria 5671
390 Ga0495590_0071165 3300046457 Bacteria 1220
391 Ga0495629_0381116 3300046459 Bacteria 960
392 Ga0495638_0019751 3300046460 Bacteria 4454
393 Ga0495638_0165780 3300046460 Bacteria 1271
394 Ga0495641_0007888 3300046461 Bacteria 6576
395 Ga0495651_0007008 3300046462 Bacteria 8622
396 Ga0495651_0012245 3300046462 Bacteria 6609
397 Ga0495653_0003413 3300046463 Bacteria 12774
398 Ga0495653_0026119 3300046463 Bacteria 4686
399 Ga0495653_0123592 3300046463 Bacteria 1841
400 Ga0495582_0006504 3300046473 Bacteria 6484
401 Ga0495639_0163529 3300046475 Bacteria 1078
402 Ga0495594_0019685 3300046499 Bacteria 3590
403 Ga0495594_0114579 3300046499 Bacteria 1521
404 Ga0495596_0135690 3300046500 Bacteria 955
405 Ga0495620_0000679 3300046515 Bacteria 21035
406 Ga0495628_0004276 3300046516 Bacteria 12699
407 Ga0495628_0018994 3300046516 Bacteria 5687
408 Ga0495632_0081163 3300046519 Bacteria 1546
409 Ga0495643_0002605 3300046522 Bacteria 14057
410 Ga0495652_0012299 3300046529 Bacteria 7726
411 Ga0495652_0029971 3300046529 Bacteria 4774
412 Ga0495665_0231143 3300046531 Bacteria 955
413 Ga0495640_0019077 3300046533 Bacteria 5070
414 Ga0495587_0000968 3300046536 Bacteria 18810
415 Ga0495587_0021720 3300046536 Bacteria 3960
416 Ga0495645_0002466 3300046543 Bacteria 12556
417 Ga0495633_0049006 3300046558 Bacteria 1994
418 Ga0495667_0003992 3300046559 Bacteria 9908
419 Ga0495668_0040760 3300046616 Bacteria 2589
420 Ga0495634_0015067 3300046642 Bacteria 5558
421 Ga0495611_0098517 3300046648 Bacteria 1356
422 Ga0495657_0008804 3300046675 Bacteria 7689
423 Ga0495657_0026646 3300046675 Bacteria 4091
424 Ga0495599_0004304 3300046678 Bacteria 8422
425 Ga0495599_0010574 3300046678 Bacteria 5647
426 Ga0495599_0112756 3300046678 Bacteria 1693
427 Ga0495623_0212079 3300046679 Bacteria 1108
428 Ga0495646_0004198 3300046680 Bacteria 9053
429 Ga0495624_0034201 3300046690 Bacteria 3289
430 Ga0495624_0068617 3300046690 Bacteria 2210
431 Ga0495670_0000827 3300046691 Bacteria 14947
432 Ga0495649_0007059 3300046694 Bacteria 6911
433 Ga0495649_0088399 3300046694 Bacteria 1653
434 Ga0495600_0004034 3300046809 Bacteria 8729
435 Ga0495660_0089276 3300046810 Bacteria 1605
436 Ga0495674_0016430 3300047319 Bacteria 6903
437 Ga0495674_0019032 3300047319 Bacteria 6383
438 Ga0495674_0075688 3300047319 Bacteria 2896
439 Ga0495674_0168922 3300047319 Bacteria 1826
440 Ga0495680_0004904 3300047322 Bacteria 12674
441 Ga0495680_0016616 3300047322 Bacteria 6314
442 Ga0495683_0085000 3300047323 Bacteria 1539
443 Ga0495687_008991 3300047443 Bacteria 5646
444 Ga0495675_0017471 3300047444 Bacteria 4547
445 Ga0495685_000119 3300047447 Bacteria 27159
446 Ga0495681_0016318 3300047470 Bacteria 4167
447 Ga0495684_0003292 3300047471 Bacteria 12687
448 Ga0495684_0013195 3300047471 Bacteria 6377
449 Ga0495684_0097606 3300047471 Bacteria 2223
450 Ga0495686_0093950 3300047472 Bacteria 1818
451 Ga0495614_0153809 3300048089 Bacteria 1027
452 Ga0496102_0060997 3300048905 Bacteria 3451
453 Ga0496102_0252133 3300048905 Bacteria 1664
454 Ga0496102_0259731 3300048905 Bacteria 1637
455 Ga0496103_0019077 3300048906 Bacteria 4118
456 Ga0496103_0190464 3300048906 Bacteria 1319
457 Ga0496104_0072987 3300048907 Bacteria 3264
458 Ga0496105_0072673 3300048908 Bacteria 2842
459 Ga0496106_0137941 3300048909 Bacteria 1917
460 Ga0496106_0469780 3300048909 Bacteria 1010
461 Ga0496108_0073726 3300048911 Bacteria 2882
462 Ga0496108_0107567 3300048911 Bacteria 2381
463 Ga0496108_0406309 3300048911 Bacteria 1189
464 Ga0496109_0332392 3300048912 Bacteria 1435
465 Ga0496109_0435588 3300048912 Bacteria 1238
466 Ga0496110_0135465 3300048913 Bacteria 2225
467 Ga0496110_0295908 3300048913 Bacteria 1474
468 Ga0496110_0320094 3300048913 Bacteria 1413
469 Ga0496110_0788352 3300048913 Bacteria 854
470 Ga0496111_0065650 3300048914 Bacteria 2634
471 Ga0496111_0488747 3300048914 Bacteria 906
472 Ga0496112_0016642 3300048915 Bacteria 6895
473 Ga0496112_0075007 3300048915 Bacteria 3345
474 Ga0496112_0127287 3300048915 Bacteria 2517
475 Ga0496112_0180723 3300048915 Bacteria 2073
476 Ga0496112_0499685 3300048915 Bacteria 1152
477 Ga0496113_0233047 3300048916 Bacteria 1468
478 Ga0496114_0166007 3300048917 Bacteria 1922
479 Ga0496114_0655336 3300048917 Bacteria 923
480 Ga0496115_0047200 3300048918 Bacteria 3443
481 Ga0496115_0166474 3300048918 Bacteria 1823
482 Ga0496121_0020057 3300048924 Bacteria 6643
483 Ga0496126_0143523 3300048929 Bacteria 2053
484 Ga0496126_0163960 3300048929 Bacteria 1898
485 Ga0496126_0313476 3300048929 Bacteria 1291
486 Ga0501031_0240593 3300049568 Bacteria 1177
487 Ga0501032_0004076 3300049569 Bacteria 11069
488 Ga0501032_0121969 3300049569 Bacteria 1723
489 Ga0501033_0000660 3300049570 Bacteria 31872
490 Ga0501033_0014723 3300049570 Bacteria 5937
491 Ga0501033_0232873 3300049570 Bacteria 1308
492 Ga0501034_0000648 3300049571 Bacteria 53584
493 Ga0501034_0129103 3300049571 Bacteria 2511
494 Ga0501034_0166931 3300049571 Bacteria 2170
495 Ga0501036_0029126 3300049572 Bacteria 4667
496 Ga0501037_0000105 3300049573 Bacteria 79431
497 Ga0501037_0022350 3300049573 Bacteria 4679
498 Ga0501037_0192772 3300049573 Bacteria 1442
499 Ga0501038_0085548 3300049574 Bacteria 2651
500 Ga0501038_0095371 3300049574 Bacteria 2485
501 Ga0501039_0128702 3300049575 Bacteria 1987
502 Ga0501043_0000055 3300049579 Bacteria 105522
503 Ga0501043_0262298 3300049579 Bacteria 1328
504 Ga0501043_0280559 3300049579 Bacteria 1277
505 Ga0501043_0388811 3300049579 Bacteria 1055
506 Ga0501043_0453348 3300049579 Unclassified 963
507 Ga0501047_0056331 3300049581 Bacteria 3801
508 Ga0501047_0119420 3300049581 Bacteria 2518
509 Ga0501047_0184509 3300049581 Bacteria 1952
510 Ga0501047_0318738 3300049581 Bacteria 1395
511 Ga0501047_0629463 3300049581 Bacteria 893
512 Ga0501067_0005180 3300049583 Bacteria 7247
513 Ga0501067_0013591 3300049583 Bacteria 4508
514 Ga0501067_0056952 3300049583 Bacteria 2165
515 Ga0501067_0225657 3300049583 Bacteria 1043
516 Ga0501068_0326686 3300049584 Bacteria 984
517 Ga0501069_0000106 3300049585 Bacteria 38605
518 Ga0501069_0010485 3300049585 Bacteria 4907
519 Ga0501070_0000428 3300049586 Bacteria 38253
520 Ga0501070_0002932 3300049586 Bacteria 14846
521 Ga0501070_0003824 3300049586 Bacteria 12997
522 Ga0501070_0033789 3300049586 Bacteria 4280
523 Ga0501070_0047043 3300049586 Bacteria 3587
524 Ga0501070_0159705 3300049586 Bacteria 1858
525 Ga0501071_0007352 3300049587 Bacteria 7223
526 Ga0501072_0288601 3300049588 Bacteria 1305
527 Ga0501073_0008181 3300049589 Bacteria 7758
528 Ga0501073_0018800 3300049589 Bacteria 4994
529 Ga0501073_0030773 3300049589 Bacteria 3832
530 Ga0501073_0089934 3300049589 Bacteria 2134
531 Ga0501074_0000072 3300049590 Bacteria 48714
532 Ga0501074_0052110 3300049590 Bacteria 2954
533 Ga0501076_0017857 3300049592 Bacteria 5395
534 Ga0501076_0181762 3300049592 Bacteria 1715
535 Ga0501077_0211183 3300049593 Bacteria 1233
536 Ga0501079_0217152 3300049741 Bacteria 1494
537 Ga0501080_0000878 3300049742 Bacteria 24606
538 Ga0501080_0036193 3300049742 Bacteria 4608
539 Ga0501080_0066172 3300049742 Bacteria 3361
540 Ga0501080_0123335 3300049742 Bacteria 2400
541 Ga0501080_0180693 3300049742 Bacteria 1941
542 Ga0501080_0290362 3300049742 Bacteria 1485
543 Ga0501083_0000484 3300049744 Bacteria 25530
544 Ga0501083_0004711 3300049744 Bacteria 9636
545 Ga0501083_0035750 3300049744 Bacteria 3392
546 Ga0501083_0046228 3300049744 Bacteria 2944
547 Ga0501083_0248686 3300049744 Bacteria 1157
548 Ga0501035_0000183 3300049822 Bacteria 76563
549 Ga0501035_0004994 3300049822 Bacteria 12567
550 Ga0501035_0010308 3300049822 Bacteria 8669
551 Ga0501035_0017799 3300049822 Bacteria 6554
552 Ga0501035_0083829 3300049822 Bacteria 2812
553 Ga0501035_0161810 3300049822 Bacteria 1937
554 Ga0501035_0183924 3300049822 Bacteria 1799
555 Ga0501035_0218487 3300049822 Bacteria 1628
556 Ga0501044_0000009 3300049823 Bacteria 270072
557 Ga0501044_0004165 3300049823 Bacteria 16251
558 Ga0501044_0018284 3300049823 Bacteria 7512
559 Ga0501044_0045506 3300049823 Bacteria 4546
560 Ga0501044_0131085 3300049823 Bacteria 2501
561 Ga0501044_0192014 3300049823 Bacteria 2004
562 Ga0501044_0204128 3300049823 Bacteria 1934
563 Ga0501044_0211709 3300049823 Bacteria 1892
564 nmdc:mga03683_85580_c1 3300050489 Bacteria 1367
565 nmdc:mga0yw44_213897_c1 3300050492 Bacteria 1276
566 nmdc:mga09592_57573_c1 3300050508 Bacteria 3285
567 nmdc:mga0a205_406918_c1 3300050515 Bacteria 1224
568 nmdc:mga0sz30_107879_c1 3300050516 Bacteria 1219
569 Ga0495601_0237213 3300053077 Bacteria 1191
570 Ga0495655_0022710 3300053083 Bacteria 1437
571 Ga0500578_0082211 3300053086 Bacteria 2047
572 Ga0500583_0017935 3300053092 Bacteria 2866
573 Ga0500650_0092340 3300053098 Bacteria 1417
574 Ga0500654_032904 3300053099 Bacteria 3085
575 Ga0500660_049984 3300053100 Bacteria 2075
576 Ga0500553_124775 3300053101 Bacteria 1052
577 Ga0500560_005757 3300053107 Bacteria 2772
578 Ga0500569_103688 3300053109 Bacteria 934
579 Ga0500580_074389 3300053113 Bacteria 1391
580 Ga0500621_112971 3300053126 Bacteria 1059
581 Ga0500652_004323 3300053131 Bacteria 4390
582 Ga0500658_0005313 3300053134 Bacteria 4788
583 Ga0500561_0006287 3300053137 Bacteria 2258
584 Ga0500573_0018167 3300053140 Bacteria 4008
585 Ga0500600_0045865 3300053149 Bacteria 2499
586 Ga0500616_0009653 3300053153 Bacteria 5846
587 Ga0500633_0115685 3300053160 Bacteria 995
588 Ga0500649_045518 3300053722 Bacteria 1849
589 Ga0501084_0003737 3300054114 Bacteria 12361
590 Ga0501084_0241088 3300054114 Bacteria 1526
591 Ga0501082_0003970 3300060353 Bacteria 12919
592 Ga0501082_0182342 3300060353 Bacteria 1826
593 Ga0501082_0486255 3300060353 Bacteria 1079
594 Ga0466962_0156825 3300061719 Bacteria 1106
595 2585200924 2582581294 Bacteria 6626667
596 2671694386 2671180139 Bacteria 4196045
597 2738947403 2738541317 Bacteria 5340176
598 2837679221 2837678835 Bacteria 5252418
599 2854899833 2854896431 Bacteria 5869725
600 2913312308 2913308742 Bacteria 5350706
601 2937843696 2937843397 Bacteria 5256375
602 2989351848 2989349275 Bacteria 6349068
603 2996314202 2996310559 Bacteria 6357320
604 8054559576 8054558443 Bacteria 5204801
605 Ga0466971_0018873
606 JGI24751J29686_10000456
607 Ga0065707_10095761
608 Ga0070683_100142499
609 Ga0070683_100875447
610 Ga0070670_100000046
611 Ga0070670_100342905
612 Ga0068869_100066477
613 Ga0068869_100147579
614 Ga0070666_10126675
615 Ga0070666_10237772
616 Ga0070682_100082450
617 Ga0070682_100089991
618 Ga0070682_100172326
619 Ga0070682_100423207
620 Ga0068868_100010571
621 Ga0068868_100049838
622 Ga0068868_100162628
623 Ga0068868_100188705
624 Ga0068868_100309306
625 Ga0068868_100521826
626 Ga0070660_100273281
627 Ga0070689_100526854
628 Ga0070689_100737379
629 Ga0070691_10093451
630 Ga0070687_100029154
631 Ga0070661_100186224
632 Ga0070661_100458987
633 Ga0070692_10054720
634 Ga0070692_10232141
635 Ga0070668_100000066
636 Ga0070674_100501552
637 Ga0070673_100491569
638 Ga0070688_100099402
639 Ga0070688_100311130
640 Ga0070659_100128822
641 Ga0070659_100184916
642 Ga0070659_100213820
643 Ga0070667_100099909
644 Ga0070709_10070334
645 Ga0070714_100400648
646 Ga0070714_100486928
647 Ga0070713_100027756
648 Ga0070713_100096141
649 Ga0070713_100100360
650 Ga0070713_100215104
651 Ga0070701_10220497
652 Ga0070705_100200495
653 Ga0070700_100259421
654 Ga0070700_100325137
655 Ga0070663_100085920
656 Ga0070663_100321396
657 Ga0070678_100042974
658 Ga0068867_100086592
659 Ga0068867_100495559
660 Ga0070685_10187863
661 Ga0070685_10350077
662 Ga0070707_100262684
663 Ga0070699_100045161
664 Ga0070679_100387866
665 Ga0070679_100509525
666 Ga0070684_100671155
667 Ga0070697_100095632
668 Ga0070695_100288551
669 Ga0070665_100183443
670 Ga0070665_100206614
671 Ga0070665_100447706
672 Ga0070704_100416504
673 Ga0070704_100701258
674 Ga0068855_100008330
675 Ga0068855_100677164
676 Ga0070664_100089830
677 Ga0070664_100109948
678 Ga0068857_100017631
679 Ga0068857_100253271
680 Ga0068857_100392676
681 Ga0068854_100151194
682 Ga0068856_100037191
683 Ga0068856_100213009
684 Ga0068856_100419864
685 Ga0070702_100027574
686 Ga0070702_100082444
687 Ga0070702_100256293
688 Ga0070702_100322916
689 Ga0068852_100134516
690 Ga0068852_100138396
691 Ga0068852_100192864
692 Ga0068852_100330282
693 Ga0068859_100001206
694 Ga0068859_100292339
695 Ga0068864_100000010
696 Ga0068864_100162716
697 Ga0068864_100197510
698 Ga0068864_100248159
699 Ga0068866_10064625
700 Ga0068866_10141188
701 Ga0068861_100009173
702 Ga0068861_100015219
703 Ga0068861_100177791
704 Ga0068870_10090768
705 Ga0068863_100008004
706 Ga0068863_100189269
707 Ga0068858_100068995
708 Ga0068858_100139016
709 Ga0068860_100058707
710 Ga0068862_100001740
711 Ga0068862_100072318
712 Ga0068862_100162306
713 Ga0081455_10000922
714 Ga0081455_10005818
715 Ga0081455_10059496
716 Ga0070717_10009834
717 Ga0070717_10019668
718 Ga0070717_10088715
719 Ga0070717_10353587
720 Ga0070717_10433007
721 Ga0075363_100324431
722 Ga0075367_10308186
723 Ga0068871_100156825
724 Ga0068871_100453962
725 Ga0075428_100093692
726 Ga0075430_100525000
727 Ga0075433_10236201
728 Ga0075429_100299416
729 Ga0068865_100212924
730 Ga0097620_100001206
731 Ga0097620_100292331
732 Ga0105240_10002625
733 Ga0105240_10033613
734 Ga0105240_10769646
735 Ga0111539_10008000
736 Ga0111539_10222617
737 Ga0105245_10026782
738 Ga0105245_10038922
739 Ga0105245_10290503
740 Ga0105245_10313939
741 Ga0105245_11245678
742 Ga0105247_10005864
743 Ga0105247_10044914
744 Ga0105247_10105080
745 Ga0105247_10298634
746 Ga0105247_10573053
747 Ga0105243_10021513
748 Ga0105243_10025148
749 Ga0105243_10062087
750 Ga0105243_10167454
751 Ga0105243_10260928
752 Ga0105241_10003375
753 Ga0105241_10071791
754 Ga0105242_10064249
755 Ga0105248_10002330
756 Ga0105248_10351568
757 Ga0105237_10002173
758 Ga0105238_10077778
759 Ga0105238_10599636
760 Ga0105238_10652000
761 Ga0105249_10000097
762 Ga0105249_10053906
763 Ga0105249_10145101
764 Ga0105249_10259197
765 Ga0105249_11117835
766 Ga0123342_1027943
767 Ga0105239_10012879
768 Ga0105239_10015995
769 Ga0105239_10027983
770 Ga0105239_10055802
771 Ga0105239_10156603
772 Ga0105246_10023478
773 Ga0105246_10468108
774 Ga0157342_1003977
775 Ga0157371_10138320
776 Ga0157370_10181320
777 Ga0157369_10366155
778 Ga0157378_10134561
779 Ga0163162_10072715
780 Ga0163162_10199075
781 Ga0163162_10607640
782 Ga0163162_10754661
783 Ga0157372_10247396
784 Ga0157375_10700047
785 Ga0163163_10024952
786 Ga0163163_10130716
787 Ga0157380_10047428
788 Ga0157380_10468757
789 Ga0182008_10171795
790 Ga0182008_10176950
791 Ga0157377_10291289
792 Ga0157379_10006348
793 Ga0157379_10143201
794 Ga0157379_10503782
795 Ga0157376_10168485
796 Ga0197907_11135321
797 Ga0213874_10014852
798 Ga0213874_10041757
799 Ga0213874_10057014
800 Ga0213876_10008054
801 Ga0213876_10016791
802 Ga0213876_10166278
803 Ga0213875_10000929
804 Ga0213875_10002664
805 Ga0213875_10007870
806 Ga0213875_10008655
807 Ga0213875_10037658
808 Ga0224712_10177327
809 Ga0207697_10006485
810 Ga0207710_10003909
811 Ga0207710_10034309
812 Ga0207710_10037715
813 Ga0207688_10175522
814 Ga0207680_10183394
815 Ga0207647_10193303
816 Ga0207685_10115292
817 Ga0207699_10109588
818 Ga0207643_10011188
819 Ga0207643_10052164
820 Ga0207684_10064032
821 Ga0207707_10681749
822 Ga0207695_10001247
823 Ga0207695_10446934
824 Ga0207671_10013846
825 Ga0207671_10124289
826 Ga0207663_10116382
827 Ga0207657_10031646
828 Ga0207657_10255099
829 Ga0207652_10303375
830 Ga0207646_10044699
831 Ga0207681_10286571
832 Ga0207694_10170801
833 Ga0207650_10000008
834 Ga0207650_10148066
835 Ga0207687_10017380
836 Ga0207687_10143735
837 Ga0207687_10270261
838 Ga0207687_10485178
839 Ga0207687_10618060
840 Ga0207700_10020068
841 Ga0207700_10026144
842 Ga0207700_10082409
843 Ga0207664_10045032
844 Ga0207664_10344603
845 Ga0207644_10066137
846 Ga0207690_10036830
847 Ga0207690_10103139
848 Ga0207690_10146582
849 Ga0207690_10279618
850 Ga0207706_10159379
851 Ga0207709_10010833
852 Ga0207670_10011811
853 Ga0207704_10022658
854 Ga0207704_10197825
855 Ga0207665_10070195
856 Ga0207691_10043284
857 Ga0207711_10078370
858 Ga0207711_10374930
859 Ga0207689_10110458
860 Ga0207689_10415283
861 Ga0207661_10155325
862 Ga0207661_10162116
863 Ga0207679_10160481
864 Ga0207679_10251990
865 Ga0207679_10359906
866 Ga0207667_10551063
867 Ga0207651_10440355
868 Ga0207712_10000074
869 Ga0207712_10106434
870 Ga0207712_10824574
871 Ga0207668_10000055
872 Ga0207640_10496355
873 Ga0207640_10599609
874 Ga0207658_10136296
875 Ga0207677_10029815
876 Ga0207677_10258103
877 Ga0207677_10298102
878 Ga0207703_10000139
879 Ga0207703_10028046
880 Ga0207703_10031278
881 Ga0207703_10562690
882 Ga0207678_10209179
883 Ga0207678_10277087
884 Ga0207708_10195342
885 Ga0207702_10033040
886 Ga0207702_10173300
887 Ga0207702_10387812
888 Ga0207641_10003566
889 Ga0207648_10068710
890 Ga0207648_10869336
891 Ga0207676_10018023
892 Ga0207676_10089971
893 Ga0207674_10033281
894 Ga0207674_10035568
895 Ga0207674_10479708
896 Ga0207675_100008152
897 Ga0207675_100018645
898 Ga0207675_100037719
899 Ga0207675_100486536
900 Ga0207675_100845284
901 Ga0207675_101102829
902 Ga0207683_10017204
903 Ga0207683_10017947
904 Ga0207698_10024955
905 Ga0207698_10064645
906 Ga0207698_10176264
907 Ga0207698_10212562
908 Ga0207698_10267676
909 Ga0207428_10266648
910 Ga0268266_10054044
911 Ga0268266_10625029
912 Ga0268265_10001448
913 Ga0268264_10003282
914 Ga0307517_10003217
915 Ga0307515_10002279
916 Ga0265338_10001906
917 Ga0265320_10115377
918 Ga0265325_10072774
919 Ga0265339_10059455
920 Ga0307513_10035311
921 Ga0307509_10072618
922 Ga0265313_10013977
923 Ga0265313_10015322
924 Ga0307514_10033196
925 Ga0265314_10041618
926 Ga0307516_10106547
927 Ga0307405_10623686
928 Ga0307413_10461748
929 Ga0307406_10157668
930 Ga0307409_100070185
931 Ga0307409_100788045
932 Ga0307416_101024429
933 Ga0307411_10244166
934 Ga0373930_0012043
935 Ga0373923_0052763
936 Ga0373955_0261059
937 Ga0373935_0112021
938 Ga0373927_0099960
939 Ga0373933_0070513
940 Ga0373937_0022197
941 Ga0373937_0034193
942 Ga0316582_0132159
943 Ga0316584_0088421
944 Ga0373925_0017543
945 Ga0373925_0226547
946 Ga0395905_0007731
947 Ga0395905_0092922
948 Ga0436364_0466655
949 Ga0436364_0656454
950 Ga0436364_0737248
951 Ga0436364_0835680
952 Ga0436364_0860593
953 Ga0436364_1123780
954 Ga0436364_1159200
955 Ga0436364_1295803
956 Ga0436364_1466095
957 Ga0436365_0305799
958 Ga0436365_1071674
959 Ga0436365_1150447
960 Ga0436365_1158902
961 Ga0436365_1162874
962 Ga0436365_1182509
963 Ga0436365_1305765
964 Ga0436360_0277378
965 Ga0436363_0082628
966 Ga0436363_0531382
967 Ga0436363_0914064
968 Ga0436363_1297426
969 Ga0436362_0251874
970 Ga0436362_0399807
971 Ga0436362_1269108
972 Ga0466966_0132140
973 Ga0466966_0257900
974 Ga0466963_0016111
975 Ga0466963_0031811
976 Ga0466963_0066931
977 Ga0466963_0148929
978 Ga0466963_0167539
979 Ga0466963_0209607
980 Ga0466957_0066308
981 Ga0466959_0074323
982 Ga0466959_0131683
983 Ga0466958_0038227
984 Ga0466958_0056484
985 Ga0466958_0089245
986 Ga0466967_0002066
987 Ga0466967_0003480
988 Ga0466967_0134366
989 Ga0466967_0188586
990 Ga0466967_0333489
991 Ga0466967_0374661
992 Ga0495592_0007364
993 Ga0495592_0016107
994 Ga0495590_0071165
995 Ga0495629_0381116
996 Ga0495638_0019751
997 Ga0495638_0165780
998 Ga0495641_0007888
999 Ga0495651_0007008
1000 Ga0495651_0012245
1001 Ga0495653_0003413
1002 Ga0495653_0026119
1003 Ga0495653_0123592
1004 Ga0495582_0006504
1005 Ga0495639_0163529
1006 Ga0495594_0019685
1007 Ga0495594_0114579
1008 Ga0495596_0135690
1009 Ga0495620_0000679
1010 Ga0495628_0004276
1011 Ga0495628_0018994
1012 Ga0495632_0081163
1013 Ga0495643_0002605
1014 Ga0495652_0012299
1015 Ga0495652_0029971
1016 Ga0495665_0231143
1017 Ga0495640_0019077
1018 Ga0495587_0000968
1019 Ga0495587_0021720
1020 Ga0495645_0002466
1021 Ga0495633_0049006
1022 Ga0495667_0003992
1023 Ga0495668_0040760
1024 Ga0495634_0015067
1025 Ga0495611_0098517
1026 Ga0495657_0008804
1027 Ga0495657_0026646
1028 Ga0495599_0004304
1029 Ga0495599_0010574
1030 Ga0495599_0112756
1031 Ga0495623_0212079
1032 Ga0495646_0004198
1033 Ga0495624_0034201
1034 Ga0495624_0068617
1035 Ga0495670_0000827
1036 Ga0495649_0007059
1037 Ga0495649_0088399
1038 Ga0495600_0004034
1039 Ga0495660_0089276
1040 Ga0495674_0016430
1041 Ga0495674_0019032
1042 Ga0495674_0075688
1043 Ga0495674_0168922
1044 Ga0495680_0004904
1045 Ga0495680_0016616
1046 Ga0495683_0085000
1047 Ga0495687_008991
1048 Ga0495675_0017471
1049 Ga0495685_000119
1050 Ga0495681_0016318
1051 Ga0495684_0003292
1052 Ga0495684_0013195
1053 Ga0495684_0097606
1054 Ga0495686_0093950
1055 Ga0495614_0153809
1056 Ga0496102_0060997
1057 Ga0496102_0252133
1058 Ga0496102_0259731
1059 Ga0496103_0019077
1060 Ga0496103_0190464
1061 Ga0496104_0072987
1062 Ga0496105_0072673
1063 Ga0496106_0137941
1064 Ga0496106_0469780
1065 Ga0496108_0073726
1066 Ga0496108_0107567
1067 Ga0496108_0406309
1068 Ga0496109_0332392
1069 Ga0496109_0435588
1070 Ga0496110_0135465
1071 Ga0496110_0295908
1072 Ga0496110_0320094
1073 Ga0496110_0788352
1074 Ga0496111_0065650
1075 Ga0496111_0488747
1076 Ga0496112_0016642
1077 Ga0496112_0075007
1078 Ga0496112_0127287
1079 Ga0496112_0180723
1080 Ga0496112_0499685
1081 Ga0496113_0233047
1082 Ga0496114_0166007
1083 Ga0496114_0655336
1084 Ga0496115_0047200
1085 Ga0496115_0166474
1086 Ga0496121_0020057
1087 Ga0496126_0143523
1088 Ga0496126_0163960
1089 Ga0496126_0313476
1090 Ga0501031_0240593
1091 Ga0501032_0004076
1092 Ga0501032_0121969
1093 Ga0501033_0000660
1094 Ga0501033_0014723
1095 Ga0501033_0232873
1096 Ga0501034_0000648
1097 Ga0501034_0129103
1098 Ga0501034_0166931
1099 Ga0501036_0029126
1100 Ga0501037_0000105
1101 Ga0501037_0022350
1102 Ga0501037_0192772
1103 Ga0501038_0085548
1104 Ga0501038_0095371
1105 Ga0501039_0128702
1106 Ga0501043_0000055
1107 Ga0501043_0262298
1108 Ga0501043_0280559
1109 Ga0501043_0388811
1110 Ga0501043_0453348
1111 Ga0501047_0056331
1112 Ga0501047_0119420
1113 Ga0501047_0184509
1114 Ga0501047_0318738
1115 Ga0501047_0629463
1116 Ga0501067_0005180
1117 Ga0501067_0013591
1118 Ga0501067_0056952
1119 Ga0501067_0225657
1120 Ga0501068_0326686
1121 Ga0501069_0000106
1122 Ga0501069_0010485
1123 Ga0501070_0000428
1124 Ga0501070_0002932
1125 Ga0501070_0003824
1126 Ga0501070_0033789
1127 Ga0501070_0047043
1128 Ga0501070_0159705
1129 Ga0501071_0007352
1130 Ga0501072_0288601
1131 Ga0501073_0008181
1132 Ga0501073_0018800
1133 Ga0501073_0030773
1134 Ga0501073_0089934
1135 Ga0501074_0000072
1136 Ga0501074_0052110
1137 Ga0501076_0017857
1138 Ga0501076_0181762
1139 Ga0501077_0211183
1140 Ga0501079_0217152
1141 Ga0501080_0000878
1142 Ga0501080_0036193
1143 Ga0501080_0066172
1144 Ga0501080_0123335
1145 Ga0501080_0180693
1146 Ga0501080_0290362
1147 Ga0501083_0000484
1148 Ga0501083_0004711
1149 Ga0501083_0035750
1150 Ga0501083_0046228
1151 Ga0501083_0248686
1152 Ga0501035_0000183
1153 Ga0501035_0004994
1154 Ga0501035_0010308
1155 Ga0501035_0017799
1156 Ga0501035_0083829
1157 Ga0501035_0161810
1158 Ga0501035_0183924
1159 Ga0501035_0218487
1160 Ga0501044_0000009
1161 Ga0501044_0004165
1162 Ga0501044_0018284
1163 Ga0501044_0045506
1164 Ga0501044_0131085
1165 Ga0501044_0192014
1166 Ga0501044_0204128
1167 Ga0501044_0211709
1168 nmdc:mga03683_85580_c1
1169 nmdc:mga0yw44_213897_c1
1170 nmdc:mga09592_57573_c1
1171 nmdc:mga0a205_406918_c1
1172 nmdc:mga0sz30_107879_c1
1173 Ga0495601_0237213
1174 Ga0495655_0022710
1175 Ga0500578_0082211
1176 Ga0500583_0017935
1177 Ga0500650_0092340
1178 Ga0500654_032904
1179 Ga0500660_049984
1180 Ga0500553_124775
1181 Ga0500560_005757
1182 Ga0500569_103688
1183 Ga0500580_074389
1184 Ga0500621_112971
1185 Ga0500652_004323
1186 Ga0500658_0005313
1187 Ga0500561_0006287
1188 Ga0500573_0018167
1189 Ga0500600_0045865
1190 Ga0500616_0009653
1191 Ga0500633_0115685
1192 Ga0500649_045518
1193 Ga0501084_0003737
1194 Ga0501084_0241088
1195 Ga0501082_0003970
1196 Ga0501082_0182342
1197 Ga0501082_0486255
1198 Ga0466962_0156825
1199 2585200924
1200 2671694386
1201 2738947403
1202 2837679221
1203 2854899833
1204 2913312308
1205 2937843696
1206 2989351848
1207 2996314202
1208 8054559576

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

45

235

0.97

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

51

289

0.95

PF08659

KR

KR domain

46

215

0.85

PF23441

38

289

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
4cql-assembly2.cif.gz_B crystal structure of heterotetrameric human ketoacyl reductase complexed with nad 0.9714 7 245
5cdy-assembly1.cif.gz_B the crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) from yersinia pestis at 2.85a resolution 0.9699 5 243
4cqm-assembly2.cif.gz_B crystal structure of heterotetrameric human ketoacyl reductase complexed with nad and nadp 0.9692 7 245
1nff-assembly1.cif.gz_A crystal structure of rv2002 gene product from mycobacterium tuberculosis 0.9686 1 246
5cdy-assembly1.cif.gz_C the crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) from yersinia pestis at 2.85a resolution 0.9663 4 243
ID Description Score Start End Superfamily
af_Q6PKH6_18_219_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9716 4 180 3.40.50.720
af_A0A0P0X9U1_21_128_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9703 3 89 3.40.50.720
af_A0A1D6ED38_49_231_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9679 4 178 3.40.50.720
af_F4J128_251_373_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9675 87 185 3.40.50.720
af_A0A1D6EBW2_14_281_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9613 4 245 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A6I2YIX5-F1-model_v4 Glucose 1-dehydrogenase (EC 1.1.1.47) 0.9786 3 246 GO:0047936
AF-A0A4V3FIN2-F1-model_v4 deleted 0.9784 4 246
AF-A0A1X1ZQX5-F1-model_v4 Short-chain dehydrogenase 0.9744 3 245 GO:0016616
AF-A0A7W5ZY43-F1-model_v4 3alpha(Or 20beta)-hydroxysteroid dehydrogenase (EC 1.1.1.53) 0.974 1 246 GO:0047044
AF-A0A4D4KKE7-F1-model_v4 3-alpha-(Or 20-beta)-hydroxysteroid dehydrogenase 0.974 3 245 GO:0016616

Map