F468428

General Info

Members Datasets Scaffolds Average Seq Length
604 326 504 243

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2990088156|2990089695
Length 277
Sequence LPLFPLNSVLFPGLVLPLNIFEQRYRALMRDLLEIPEDSPRRFGVVAIRDGREVAQTSKGLPESAPPPGADPTAGFGPDPMASFYTVGCVADASTIRERASAAGGVPPGAAAPGSSSGTEPGTDDASVEEDEEAPGGSGYEVLATGTTRFRLLSVDASGPYLMGEIEELPEEEGDGAGALASGVLRAFRSYQKRLASARERTLAAGQELPDDPSVVSYLVAAATILDTPTKQRLLQAPDTATRLADELKLLRRETAVIGKLPSLPAAELTRDPTSPN

Samples

Sample ID Description Type Environment
1 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
2 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
3 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
4 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
5 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
6 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
7 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
8 2643221548 Streptomyces sp. Root55 Isolate Unclassified
9 2643221578 Streptomyces sp. Root63 Isolate Unclassified
10 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
11 2643221647 Streptomyces sp. Root369 Isolate Unclassified
12 2643221670 Streptomyces sp. Root431 Isolate Unclassified
13 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
14 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
15 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
16 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
17 2643221714 Streptomyces sp. Root264 Isolate Unclassified
18 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
19 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
20 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
21 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
22 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
23 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
24 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
25 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
26 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
27 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
28 2808606448 Streptomyces sp. 193411 Isolate Unclassified
29 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
30 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
31 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
32 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
33 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
34 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
35 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
36 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
37 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
38 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
39 2862574272 Streptomyces sp. AcE210 Isolate Nodule
40 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
41 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
42 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
43 2867369537 Streptomyces sp. Z26 Isolate Unclassified
44 2867428634 Streptomyces sp. RP5T Isolate Unclassified
45 2867475112 Streptomyces sp. TM32 Isolate Unclassified
46 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
47 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
48 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
49 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
50 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
51 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
52 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
53 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
54 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
55 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
56 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
57 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
58 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
59 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
60 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
61 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
62 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
63 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
64 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
65 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
66 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
67 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
68 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
69 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
70 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
71 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
72 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
73 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
74 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
75 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
76 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
77 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
78 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
79 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
80 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
81 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
82 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
83 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
84 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
85 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
86 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
87 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
88 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
89 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
90 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
91 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
92 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
93 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
94 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
95 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
96 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
102 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
103 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
104 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
105 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
106 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
107 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
113 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
114 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
115 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
116 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
117 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
118 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
119 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
120 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
121 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
122 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
123 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
124 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
125 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
126 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
127 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
128 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
129 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
130 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
131 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
132 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
133 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
134 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
135 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
136 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
137 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
138 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
139 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
140 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
141 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
142 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
143 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
144 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
145 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
146 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
147 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
148 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
149 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
150 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
151 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
152 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
153 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
154 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
155 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
156 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
157 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
158 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
159 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
160 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
161 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
162 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
163 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
164 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
165 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
166 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
167 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
168 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
169 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
170 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
171 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
172 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
173 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
174 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
175 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
176 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
177 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
178 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
179 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
180 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
181 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
182 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
183 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
184 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
185 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
186 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
187 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
188 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
189 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
190 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
191 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
192 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
193 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
194 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
195 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
196 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
197 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
198 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
199 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
200 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
201 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
202 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
203 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
204 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
205 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
206 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
207 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
208 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
209 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
210 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
211 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
212 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
213 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
214 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
215 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
216 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
217 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
218 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
219 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
220 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
221 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
222 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
223 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
224 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
225 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
226 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
227 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
228 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
229 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
230 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
231 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
232 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
233 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
234 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
235 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
236 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
237 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
238 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
239 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
240 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
241 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
242 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
243 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
244 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
245 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
246 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
247 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
248 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
249 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
250 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
251 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
267 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
268 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
269 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
270 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
271 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
272 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
273 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
274 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
275 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
276 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
279 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
280 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
281 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
282 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
283 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
284 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
285 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
286 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
287 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
288 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
289 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
290 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
291 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
292 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
293 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
294 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
295 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
296 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
297 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
298 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
299 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
300 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
301 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
302 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
303 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
304 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
305 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
306 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
307 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
308 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
309 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
310 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
311 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
312 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
313 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
314 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
315 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
316 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
317 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
318 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
319 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
320 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
321 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
322 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
323 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
324 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
325 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
326 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.95
Metatranscriptomes 0.33
Isolates 16.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.96
Nodule 0.5
Rhizoplane 0.5
Rhizosphere 78.81
Stem 0
Stem Tuber 0
Unclassified 14.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10023216 3300001989 Bacteria 2194
2 JGI24738J21930_10012233 3300002075 Bacteria 1875
3 rootH1_10023073 3300003316 Bacteria 4325
4 rootH2_10024721 3300003320 Bacteria 7153
5 rootL2_10005501 3300003322 Bacteria 5641
6 rootH1_10050211 3300003323 Bacteria 5088
7 rootH1_10087437 3300003316 Bacteria 1186
8 rootH1_10087437 3300003323 Bacteria 8663
9 rootH1_10087443 3300003323 Bacteria 4552
10 Ga0006562J51391_1106064 3300003578 Bacteria 7770
11 Ga0006562J51391_1106066 3300003578 Bacteria 6580
12 Ga0068853_100770361 3300005539 Bacteria 920
13 Ga0068856_100154205 3300005614 Bacteria 2307
14 Ga0075365_10041788 3300006038 Bacteria 2996
15 Ga0075368_10011784 3300006042 Bacteria 3188
16 Ga0075363_100030535 3300006048 Bacteria 2790
17 Ga0075367_10055283 3300006178 Bacteria 2356
18 Ga0105251_10058360 3300009011 Bacteria 1822
19 Ga0105243_10172259 3300009148 Bacteria 1876
20 Ga0105243_10522817 3300009148 Bacteria 1129
21 Ga0105246_10024504 3300011119 Bacteria 3921
22 Ga0157369_10372629 3300013105 Bacteria 1482
23 Ga0157372_10270517 3300013307 Bacteria 1974
24 Ga0182008_10002930 3300014497 Bacteria 10528
25 Ga0182007_10001340 3300015262 Bacteria 13295
26 Ga0182005_1008312 3300015265 Bacteria 3064
27 Ga0183367_1007 3300015688 Bacteria 498079
28 Ga0209758_1001801 3300025297 Bacteria 23664
29 Ga0207426_1001321 3300025302 Bacteria 21134
30 Ga0207426_1004573 3300025302 Bacteria 6680
31 Ga0207426_1006641 3300025302 Bacteria 4979
32 Ga0207713_1062262 3300025735 Bacteria 1415
33 Ga0207647_10103995 3300025904 Bacteria 1683
34 Ga0207640_10118276 3300025981 Bacteria 1893
35 Ga0207639_10593419 3300026041 Bacteria 1021
36 Ga0268266_10474382 3300028379 Bacteria 1192
37 Ga0307517_10010039 3300028786 Bacteria 13314
38 Ga0307517_10068717 3300028786 Bacteria 3222
39 Ga0307515_10001023 3300028794 Bacteria 63806
40 Ga0307515_10157830 3300028794 Bacteria 2331
41 Ga0307515_10240513 3300028794 Bacteria 1582
42 Ga0307511_10002015 3300030521 Bacteria 21310
43 Ga0307511_10058889 3300030521 Bacteria 2962
44 Ga0307512_10001219 3300030522 Bacteria 37239
45 Ga0307512_10012811 3300030522 Bacteria 7891
46 Ga0307512_10158624 3300030522 Bacteria 1332
47 Ga0316180_1119922 3300030736 Bacteria 1346
48 Ga0307513_10023919 3300031456 Bacteria 7121
49 Ga0307513_10093527 3300031456 Bacteria 3055
50 Ga0307513_10108458 3300031456 Bacteria 2777
51 Ga0307509_10010380 3300031507 Bacteria 11427
52 Ga0307509_10107841 3300031507 Bacteria 2799
53 Ga0307509_10122112 3300031507 Bacteria 2580
54 Ga0307509_10156812 3300031507 Bacteria 2181
55 Ga0307508_10002617 3300031616 Bacteria 18905
56 Ga0307508_10003933 3300031616 Bacteria 14744
57 Ga0307508_10007385 3300031616 Bacteria 10241
58 Ga0307514_10000866 3300031649 Bacteria 48042
59 Ga0307514_10066796 3300031649 Bacteria 2717
60 Ga0307516_10000836 3300031730 Bacteria 42164
61 Ga0307516_10035913 3300031730 Bacteria 4966
62 Ga0307516_10146654 3300031730 Bacteria 2125
63 Ga0307413_10341378 3300031824 Bacteria 1152
64 Ga0307518_10246664 3300031838 Bacteria 1139
65 Ga0307410_10200475 3300031852 Bacteria 1523
66 Ga0307409_100290845 3300031995 Bacteria 1515
67 Ga0307416_100367978 3300032002 Bacteria 1462
68 Ga0307411_10140372 3300032005 Bacteria 1781
69 Ga0307507_10014046 3300033179 Bacteria 9614
70 Ga0307507_10073536 3300033179 Bacteria 3072
71 Ga0307507_10345660 3300033179 Bacteria 878
72 Ga0307510_10008937 3300033180 Bacteria 11932
73 Ga0307510_10011375 3300033180 Bacteria 10571
74 Ga0307510_10015509 3300033180 Bacteria 9013
75 Ga0395899_0172602 3300037312 Bacteria 1522
76 Ga0395900_0026421 3300037418 Bacteria 5945
77 Ga0395900_0639617 3300037418 Bacteria 1001
78 Ga0395898_0003389 3300037466 Bacteria 17855
79 Ga0395898_0012758 3300037466 Bacteria 8679
80 Ga0395898_0398544 3300037466 Bacteria 1312
81 Ga0395905_0113848 3300037471 Bacteria 2542
82 Ga0436364_0634101 3300037853 Bacteria 4142
83 Ga0439436_0000366 3300041404 Bacteria 11225
84 Ga0439436_0002119 3300041404 Bacteria 5921
85 Ga0439439_0008281 3300041406 Bacteria 2451
86 Ga0451837_1335871 3300041494 Bacteria 1684
87 Ga0451853_0263207 3300041512 Bacteria 6626
88 Ga0451853_0543791 3300041512 Bacteria 2287
89 Ga0439433_0000247 3300041999 Bacteria 9061
90 Ga0439433_0020186 3300041999 Bacteria 1488
91 Ga0439442_007519 3300042002 Bacteria 2192
92 Ga0439448_0007003 3300042005 Bacteria 3254
93 Ga0439449_0000374 3300042007 Bacteria 16455
94 Ga0439455_0001016 3300042012 Bacteria 4416
95 Ga0439457_000022 3300042014 Bacteria 30879
96 Ga0439457_000358 3300042014 Bacteria 12732
97 Ga0439462_0030424 3300042015 Bacteria 1428
98 Ga0450920_015340 3300042122 Bacteria 1457
99 Ga0450894_000108 3300042131 Bacteria 14142
100 Ga0450894_011415 3300042131 Bacteria 1157
101 Ga0450895_002420 3300042132 Bacteria 1389
102 Ga0450896_001946 3300042133 Bacteria 2625
103 Ga0450898_000274 3300042134 Bacteria 5760
104 Ga0450899_000105 3300042135 Bacteria 7451
105 Ga0450903_001441 3300042138 Bacteria 4439
106 Ga0450903_029165 3300042138 Bacteria 836
107 Ga0450906_012776 3300042145 Bacteria 1554
108 Ga0439458_0000302 3300042157 Bacteria 12271
109 Ga0439458_0020558 3300042157 Bacteria 1524
110 Ga0466969_0010145 3300044656 Bacteria 4995
111 Ga0466969_0044712 3300044656 Bacteria 2201
112 Ga0466969_0177995 3300044656 Bacteria 974
113 Ga0466969_0301288 3300044656 Bacteria 725
114 Ga0466972_0006803 3300044658 Bacteria 5738
115 Ga0466972_0007999 3300044658 Bacteria 5301
116 Ga0466972_0087441 3300044658 Bacteria 1480
117 Ga0466965_0008430 3300044683 Bacteria 4770
118 Ga0466965_0158076 3300044683 Bacteria 1187
119 Ga0466966_0001836 3300044684 Bacteria 13765
120 Ga0466966_0005247 3300044684 Bacteria 8517
121 Ga0466966_0014450 3300044684 Bacteria 5227
122 Ga0466966_0186603 3300044684 Bacteria 1257
123 Ga0466961_0005229 3300044693 Bacteria 8170
124 Ga0466961_0006907 3300044693 Bacteria 7219
125 Ga0466961_0120887 3300044693 Bacteria 1644
126 Ga0466961_0235576 3300044693 Bacteria 1126
127 Ga0466963_0000206 3300044694 Bacteria 25098
128 Ga0466963_0000614 3300044694 Bacteria 17088
129 Ga0466964_0002142 3300044706 Bacteria 6965
130 Ga0466964_0061045 3300044706 Bacteria 1569
131 Ga0466971_0003295 3300044719 Bacteria 6893
132 Ga0466971_0058340 3300044719 Bacteria 1742
133 Ga0466970_0045837 3300044765 Bacteria 2329
134 Ga0466957_0000450 3300044842 Bacteria 20326
135 Ga0466957_0129811 3300044842 Bacteria 1614
136 Ga0466957_0355354 3300044842 Bacteria 995
137 Ga0466960_0007225 3300044901 Bacteria 4498
138 Ga0466960_0051368 3300044901 Bacteria 1991
139 Ga0466959_0003180 3300045049 Bacteria 10663
140 Ga0466959_0021760 3300045049 Bacteria 4733
141 Ga0466958_0026392 3300045836 Bacteria 3432
142 Ga0466967_0000259 3300045976 Bacteria 23242
143 Ga0466967_0008081 3300045976 Bacteria 7672
144 Ga0466967_0040967 3300045976 Bacteria 3990
145 Ga0466967_0135100 3300045976 Bacteria 2293
146 Ga0495617_027576 3300046452 Bacteria 1910
147 Ga0495617_082039 3300046452 Bacteria 1056
148 Ga0495592_0006524 3300046454 Bacteria 8693
149 Ga0495592_0036821 3300046454 Bacteria 3683
150 Ga0495592_0045585 3300046454 Bacteria 3271
151 Ga0495603_0000118 3300046455 Bacteria 38501
152 Ga0495603_0001925 3300046455 Bacteria 12235
153 Ga0495603_0004752 3300046455 Bacteria 8107
154 Ga0495603_0006077 3300046455 Bacteria 7220
155 Ga0495603_0022015 3300046455 Bacteria 3859
156 Ga0495603_0034869 3300046455 Bacteria 3024
157 Ga0495603_0047958 3300046455 Bacteria 2543
158 Ga0495603_0262735 3300046455 Bacteria 993
159 Ga0495629_0003945 3300046459 Bacteria 11160
160 Ga0495629_0010114 3300046459 Bacteria 6882
161 Ga0495629_0014292 3300046459 Bacteria 5713
162 Ga0495629_0041454 3300046459 Bacteria 3239
163 Ga0495629_0063297 3300046459 Bacteria 2583
164 Ga0495629_0071439 3300046459 Bacteria 2422
165 Ga0495629_0120933 3300046459 Bacteria 1824
166 Ga0495629_0121638 3300046459 Bacteria 1818
167 Ga0495629_0239512 3300046459 Bacteria 1249
168 Ga0495638_0047464 3300046460 Bacteria 2692
169 Ga0495638_0088642 3300046460 Bacteria 1868
170 Ga0495638_0099678 3300046460 Bacteria 1738
171 Ga0495651_0001024 3300046462 Bacteria 21638
172 Ga0495651_0003371 3300046462 Bacteria 12264
173 Ga0495651_0111207 3300046462 Bacteria 2025
174 Ga0495653_0007920 3300046463 Bacteria 8696
175 Ga0495653_0336106 3300046463 Bacteria 975
176 Ga0495580_0088380 3300046472 Bacteria 2158
177 Ga0495580_0113236 3300046472 Bacteria 1884
178 Ga0495582_0032257 3300046473 Bacteria 2882
179 Ga0495582_0361555 3300046473 Bacteria 836
180 Ga0495605_0016422 3300046474 Bacteria 4007
181 Ga0495605_0061207 3300046474 Bacteria 1802
182 Ga0495639_0004088 3300046475 Bacteria 6256
183 Ga0495662_0001508 3300046476 Bacteria 11554
184 Ga0495662_0002106 3300046476 Bacteria 9980
185 Ga0495662_0007559 3300046476 Bacteria 5363
186 Ga0495662_0010516 3300046476 Bacteria 4527
187 Ga0495664_0014389 3300046477 Bacteria 4484
188 Ga0495664_0039464 3300046477 Bacteria 2790
189 Ga0495664_0353497 3300046477 Bacteria 885
190 Ga0495585_0010261 3300046492 Bacteria 5587
191 Ga0495585_0010501 3300046492 Bacteria 5507
192 Ga0495585_0049655 3300046492 Bacteria 2329
193 Ga0495585_0055448 3300046492 Bacteria 2190
194 Ga0495594_0001176 3300046499 Bacteria 13693
195 Ga0495594_0009930 3300046499 Bacteria 4929
196 Ga0495594_0030143 3300046499 Bacteria 2933
197 Ga0495594_0034759 3300046499 Bacteria 2743
198 Ga0495594_0051543 3300046499 Bacteria 2264
199 Ga0495594_0144151 3300046499 Bacteria 1351
200 Ga0495607_0020472 3300046501 Bacteria 4183
201 Ga0495607_0052749 3300046501 Bacteria 2353
202 Ga0495583_0045601 3300046506 Bacteria 2026
203 Ga0495583_0054882 3300046506 Bacteria 1802
204 Ga0495606_0270725 3300046507 Bacteria 933
205 Ga0495608_0055759 3300046511 Bacteria 2611
206 Ga0495610_0122134 3300046512 Bacteria 1140
207 Ga0495616_0026098 3300046513 Bacteria 3114
208 Ga0495620_0029923 3300046515 Bacteria 2513
209 Ga0495620_0077425 3300046515 Bacteria 1350
210 Ga0495628_0004209 3300046516 Bacteria 12791
211 Ga0495628_0015589 3300046516 Bacteria 6345
212 Ga0495630_0018837 3300046517 Bacteria 5073
213 Ga0495630_0206540 3300046517 Bacteria 1499
214 Ga0495631_0058212 3300046518 Bacteria 1681
215 Ga0495632_0023292 3300046519 Bacteria 3309
216 Ga0495632_0072680 3300046519 Bacteria 1650
217 Ga0495643_0009939 3300046522 Bacteria 5879
218 Ga0495643_0096993 3300046522 Bacteria 1515
219 Ga0495648_0030033 3300046524 Bacteria 3600
220 Ga0495648_0077934 3300046524 Bacteria 1897
221 Ga0495666_0000276 3300046526 Bacteria 22293
222 Ga0495666_0013360 3300046526 Bacteria 4094
223 Ga0495666_0085569 3300046526 Bacteria 1489
224 Ga0495642_0100832 3300046528 Bacteria 1228
225 Ga0495652_0010317 3300046529 Bacteria 8464
226 Ga0495652_0019806 3300046529 Bacteria 5987
227 Ga0495654_0040072 3300046530 Bacteria 2336
228 Ga0495665_0001489 3300046531 Bacteria 12545
229 Ga0495640_0001318 3300046533 Bacteria 19524
230 Ga0495640_0011041 3300046533 Bacteria 6956
231 Ga0495640_0014849 3300046533 Bacteria 5876
232 Ga0495586_0013133 3300046535 Bacteria 4390
233 Ga0495586_0036445 3300046535 Bacteria 2640
234 Ga0495587_0120851 3300046536 Bacteria 1500
235 Ga0495609_0030567 3300046538 Bacteria 2451
236 Ga0495597_0034116 3300046542 Bacteria 2300
237 Ga0495645_0023913 3300046543 Bacteria 4429
238 Ga0495645_0075463 3300046543 Bacteria 2426
239 Ga0495645_0128136 3300046543 Bacteria 1781
240 Ga0495622_0017124 3300046557 Bacteria 3374
241 Ga0495622_0020177 3300046557 Bacteria 3104
242 Ga0495633_0007313 3300046558 Bacteria 6372
243 Ga0495633_0027927 3300046558 Bacteria 2752
244 Ga0495667_0006037 3300046559 Bacteria 8197
245 Ga0495668_0021470 3300046616 Bacteria 3701
246 Ga0495668_0049069 3300046616 Bacteria 2341
247 Ga0495634_0085341 3300046642 Bacteria 2057
248 Ga0495634_0108960 3300046642 Bacteria 1782
249 Ga0495634_0137030 3300046642 Bacteria 1556
250 Ga0495625_0002244 3300046660 Bacteria 21327
251 Ga0495625_0098008 3300046660 Bacteria 2017
252 Ga0495625_0314059 3300046660 Bacteria 999
253 Ga0495635_0001097 3300046663 Bacteria 17971
254 Ga0495635_0007492 3300046663 Bacteria 7615
255 Ga0495635_0028351 3300046663 Bacteria 3891
256 Ga0495661_0050132 3300046665 Bacteria 2529
257 Ga0495661_0097235 3300046665 Bacteria 1663
258 Ga0495588_0000445 3300046674 Bacteria 20860
259 Ga0495588_0010380 3300046674 Bacteria 4331
260 Ga0495588_0021761 3300046674 Bacteria 3163
261 Ga0495657_0007303 3300046675 Bacteria 8550
262 Ga0495657_0020324 3300046675 Bacteria 4774
263 Ga0495657_0052588 3300046675 Bacteria 2729
264 Ga0495657_0061049 3300046675 Bacteria 2494
265 Ga0495657_0134276 3300046675 Bacteria 1547
266 Ga0495599_0016882 3300046678 Bacteria 4534
267 Ga0495599_0114860 3300046678 Bacteria 1675
268 Ga0495623_0018511 3300046679 Bacteria 4498
269 Ga0495623_0125399 3300046679 Bacteria 1542
270 Ga0495646_0001636 3300046680 Bacteria 13353
271 Ga0495646_0004100 3300046680 Bacteria 9142
272 Ga0495658_0157644 3300046683 Bacteria 1398
273 Ga0495613_0004176 3300046689 Bacteria 10813
274 Ga0495613_0007570 3300046689 Bacteria 8079
275 Ga0495613_0008415 3300046689 Bacteria 7658
276 Ga0495613_0016699 3300046689 Bacteria 5465
277 Ga0495613_0030282 3300046689 Bacteria 4020
278 Ga0495613_0078439 3300046689 Bacteria 2402
279 Ga0495613_0147517 3300046689 Bacteria 1678
280 Ga0495624_0045478 3300046690 Bacteria 2794
281 Ga0495624_0091080 3300046690 Bacteria 1881
282 Ga0495624_0103190 3300046690 Bacteria 1755
283 Ga0495624_0103283 3300046690 Bacteria 1754
284 Ga0495670_0003457 3300046691 Bacteria 7762
285 Ga0495670_0059457 3300046691 Bacteria 1919
286 Ga0495670_0066056 3300046691 Bacteria 1824
287 Ga0495671_0010283 3300046692 Bacteria 5195
288 Ga0495649_0040194 3300046694 Bacteria 2562
289 Ga0495649_0058789 3300046694 Bacteria 2071
290 Ga0495589_0005381 3300046794 Bacteria 6757
291 Ga0495589_0015151 3300046794 Bacteria 3969
292 Ga0495589_0016573 3300046794 Bacteria 3786
293 Ga0495589_0035373 3300046794 Bacteria 2504
294 Ga0495589_0043392 3300046794 Bacteria 2238
295 Ga0495600_0005577 3300046809 Bacteria 7599
296 Ga0495600_0057616 3300046809 Bacteria 2537
297 Ga0495660_0044575 3300046810 Bacteria 2439
298 Ga0495581_0033869 3300047315 Bacteria 2956
299 Ga0495581_0081350 3300047315 Bacteria 1875
300 Ga0495581_0415436 3300047315 Bacteria 784
301 Ga0495604_0001163 3300047317 Bacteria 21743
302 Ga0495604_0001211 3300047317 Bacteria 21264
303 Ga0495604_0021665 3300047317 Bacteria 5131
304 Ga0495604_0030368 3300047317 Bacteria 4291
305 Ga0495636_0006783 3300047318 Bacteria 4501
306 Ga0495636_0019021 3300047318 Bacteria 2758
307 Ga0495636_0053021 3300047318 Bacteria 1702
308 Ga0495674_0156396 3300047319 Bacteria 1909
309 Ga0495676_0006095 3300047321 Bacteria 11087
310 Ga0495676_0006378 3300047321 Bacteria 10868
311 Ga0495676_0006752 3300047321 Bacteria 10552
312 Ga0495676_0100105 3300047321 Bacteria 2146
313 Ga0495676_0117948 3300047321 Bacteria 1935
314 Ga0495676_0144812 3300047321 Bacteria 1699
315 Ga0495676_0155507 3300047321 Bacteria 1623
316 Ga0495680_0032145 3300047322 Bacteria 4263
317 Ga0495680_0126684 3300047322 Bacteria 1880
318 Ga0495687_001939 3300047443 Bacteria 17732
319 Ga0495687_015487 3300047443 Bacteria 3876
320 Ga0495687_031460 3300047443 Bacteria 2434
321 Ga0495687_053637 3300047443 Bacteria 1696
322 Ga0495675_0006059 3300047444 Bacteria 7402
323 Ga0495675_0011179 3300047444 Bacteria 5629
324 Ga0495675_0014969 3300047444 Bacteria 4904
325 Ga0495675_0062901 3300047444 Bacteria 2349
326 Ga0495675_0302788 3300047444 Bacteria 949
327 Ga0495677_0032423 3300047445 Bacteria 1903
328 Ga0495677_0052230 3300047445 Bacteria 1506
329 Ga0495679_023539 3300047446 Bacteria 2088
330 Ga0495685_000366 3300047447 Bacteria 14391
331 Ga0495685_007458 3300047447 Bacteria 3612
332 Ga0495685_013110 3300047447 Bacteria 2811
333 Ga0495685_023578 3300047447 Bacteria 2118
334 Ga0495685_028440 3300047447 Bacteria 1922
335 Ga0495685_047415 3300047447 Bacteria 1461
336 Ga0495681_0000244 3300047470 Bacteria 45285
337 Ga0495681_0001646 3300047470 Bacteria 16583
338 Ga0495684_0044932 3300047471 Bacteria 3381
339 Ga0495686_0071796 3300047472 Bacteria 2130
340 Ga0495686_0074653 3300047472 Bacteria 2080
341 Ga0495686_0088048 3300047472 Bacteria 1888
342 Ga0495593_0006201 3300047673 Bacteria 7031
343 Ga0495593_0017142 3300047673 Bacteria 4076
344 Ga0495593_0077706 3300047673 Bacteria 1719
345 Ga0495602_0590308 3300048088 Bacteria 765
346 Ga0495614_0001487 3300048089 Bacteria 10147
347 Ga0495614_0006637 3300048089 Bacteria 5181
348 Ga0495614_0044557 3300048089 Bacteria 1903
349 Ga0495614_0113887 3300048089 Bacteria 1188
350 Ga0495614_0196479 3300048089 Bacteria 911
351 Ga0495614_0238693 3300048089 Bacteria 830
352 Ga0495626_0030009 3300048091 Bacteria 2624
353 Ga0496106_0076835 3300048909 Bacteria 2560
354 Ga0496113_0508843 3300048916 Bacteria 967
355 Ga0495678_015428 3300049459 Bacteria 3515
356 Ga0501031_0018732 3300049568 Bacteria 4507
357 Ga0501031_0023828 3300049568 Bacteria 3990
358 Ga0501031_0050839 3300049568 Bacteria 2699
359 Ga0501032_0002783 3300049569 Bacteria 13607
360 Ga0501032_0015658 3300049569 Bacteria 5346
361 Ga0501032_0021149 3300049569 Bacteria 4525
362 Ga0501032_0046952 3300049569 Bacteria 2917
363 Ga0501032_0071008 3300049569 Bacteria 2321
364 Ga0501033_0000386 3300049570 Bacteria 42419
365 Ga0501033_0004222 3300049570 Bacteria 11562
366 Ga0501033_0025945 3300049570 Bacteria 4412
367 Ga0501033_0038220 3300049570 Bacteria 3590
368 Ga0501033_0046503 3300049570 Bacteria 3227
369 Ga0501033_0083487 3300049570 Bacteria 2341
370 Ga0501033_0100035 3300049570 Bacteria 2116
371 Ga0501034_0008282 3300049571 Bacteria 11004
372 Ga0501034_0010345 3300049571 Bacteria 9723
373 Ga0501034_0014787 3300049571 Bacteria 8031
374 Ga0501034_0015788 3300049571 Bacteria 7756
375 Ga0501034_0049017 3300049571 Bacteria 4262
376 Ga0501034_0105345 3300049571 Bacteria 2813
377 Ga0501034_0182285 3300049571 Bacteria 2064
378 Ga0501034_0356848 3300049571 Bacteria 1389
379 Ga0501036_0001683 3300049572 Bacteria 17159
380 Ga0501036_0001699 3300049572 Bacteria 17087
381 Ga0501036_0004838 3300049572 Bacteria 10879
382 Ga0501036_0020134 3300049572 Bacteria 5602
383 Ga0501036_0212459 3300049572 Bacteria 1625
384 Ga0501036_0783859 3300049572 Unclassified 785
385 Ga0501037_0004902 3300049573 Bacteria 9738
386 Ga0501037_0005556 3300049573 Bacteria 9197
387 Ga0501037_0018664 3300049573 Bacteria 5112
388 Ga0501037_0033367 3300049573 Bacteria 3802
389 Ga0501037_0195075 3300049573 Bacteria 1433
390 Ga0501038_0000642 3300049574 Bacteria 31067
391 Ga0501038_0021038 3300049574 Bacteria 5861
392 Ga0501038_0022993 3300049574 Bacteria 5580
393 Ga0501038_0030950 3300049574 Bacteria 4731
394 Ga0501038_0052616 3300049574 Bacteria 3510
395 Ga0501038_0097624 3300049574 Bacteria 2451
396 Ga0501038_0353896 3300049574 Bacteria 1143
397 Ga0501038_0469565 3300049574 Bacteria 965
398 Ga0501039_0035966 3300049575 Bacteria 3820
399 Ga0501039_0054427 3300049575 Bacteria 3097
400 Ga0501039_0093263 3300049575 Bacteria 2346
401 Ga0501039_0358092 3300049575 Bacteria 1146
402 Ga0501039_0401595 3300049575 Bacteria 1076
403 Ga0501040_0252282 3300049576 Bacteria 1258
404 Ga0501041_0005939 3300049577 Bacteria 7142
405 Ga0501042_0060219 3300049578 Bacteria 2712
406 Ga0501042_0095330 3300049578 Bacteria 2137
407 Ga0501042_0221221 3300049578 Bacteria 1365
408 Ga0501043_0003942 3300049579 Bacteria 12173
409 Ga0501043_0028894 3300049579 Bacteria 4351
410 Ga0501043_0060160 3300049579 Bacteria 2981
411 Ga0501043_0064446 3300049579 Bacteria 2877
412 Ga0501043_0086732 3300049579 Bacteria 2459
413 Ga0501046_0031520 3300049580 Bacteria 4296
414 Ga0501046_0031885 3300049580 Bacteria 4269
415 Ga0501046_0036855 3300049580 Bacteria 3933
416 Ga0501046_0044321 3300049580 Bacteria 3538
417 Ga0501046_0305511 3300049580 Bacteria 1161
418 Ga0501047_0000242 3300049581 Bacteria 64647
419 Ga0501047_0002545 3300049581 Bacteria 17375
420 Ga0501047_0004059 3300049581 Bacteria 13764
421 Ga0501047_0014162 3300049581 Bacteria 7578
422 Ga0501047_0016316 3300049581 Bacteria 7086
423 Ga0501047_0048055 3300049581 Bacteria 4122
424 Ga0501047_0053202 3300049581 Bacteria 3914
425 Ga0501047_0064929 3300049581 Bacteria 3520
426 Ga0501047_0128187 3300049581 Bacteria 2417
427 Ga0501047_0327856 3300049581 Bacteria 1370
428 Ga0501047_0392349 3300049581 Bacteria 1221
429 Ga0501048_0016256 3300049582 Bacteria 5485
430 Ga0501048_0150271 3300049582 Bacteria 1647
431 Ga0501048_0160396 3300049582 Bacteria 1591
432 Ga0501067_0002580 3300049583 Bacteria 10011
433 Ga0501068_0000577 3300049584 Bacteria 18628
434 Ga0501070_0004631 3300049586 Bacteria 11797
435 Ga0501070_0016294 3300049586 Bacteria 6244
436 Ga0501070_0030214 3300049586 Bacteria 4540
437 Ga0501070_0148488 3300049586 Bacteria 1935
438 Ga0501070_0180176 3300049586 Bacteria 1739
439 Ga0501070_0237511 3300049586 Bacteria 1492
440 Ga0501070_0612310 3300049586 Bacteria 867
441 Ga0501071_0025809 3300049587 Bacteria 4118
442 Ga0501072_0011329 3300049588 Bacteria 6813
443 Ga0501073_0005145 3300049589 Bacteria 9815
444 Ga0501074_0003992 3300049590 Bacteria 10518
445 Ga0501076_0869848 3300049592 Bacteria 743
446 Ga0501077_0060424 3300049593 Bacteria 2405
447 Ga0501083_0026593 3300049744 Bacteria 3998
448 Ga0501035_0002175 3300049822 Bacteria 19440
449 Ga0501035_0005959 3300049822 Bacteria 11473
450 Ga0501035_0007611 3300049822 Bacteria 10118
451 Ga0501035_0026863 3300049822 Bacteria 5264
452 Ga0501035_0029531 3300049822 Bacteria 5000
453 Ga0501035_0042566 3300049822 Bacteria 4095
454 Ga0501035_0060220 3300049822 Bacteria 3380
455 Ga0501035_0110452 3300049822 Bacteria 2409
456 Ga0501035_0170234 3300049822 Bacteria 1882
457 Ga0501035_0210247 3300049822 Bacteria 1664
458 Ga0501035_0316374 3300049822 Bacteria 1312
459 Ga0501035_0409138 3300049822 Bacteria 1127
460 Ga0501044_0001763 3300049823 Bacteria 25278
461 Ga0501044_0005221 3300049823 Bacteria 14453
462 Ga0501044_0012432 3300049823 Bacteria 9217
463 Ga0501044_0035840 3300049823 Bacteria 5193
464 Ga0501044_0041638 3300049823 Bacteria 4782
465 Ga0501044_0041736 3300049823 Bacteria 4776
466 Ga0501044_0071335 3300049823 Bacteria 3532
467 Ga0501044_0076761 3300049823 Bacteria 3389
468 Ga0501044_0086247 3300049823 Bacteria 3171
469 Ga0501045_0019570 3300049824 Bacteria 4828
470 Ga0501045_0132106 3300049824 Bacteria 1856
471 nmdc:mga03n38_7094_c1 3300050490 Bacteria 3941
472 nmdc:mga06z11_36288_c1 3300050494 Bacteria 2433
473 nmdc:mga04h51_185569_c1 3300050495 Bacteria 811
474 nmdc:mga04h51_3553_c1 3300050495 Bacteria 3798
475 Ga0500610_0162205 3300053079 Bacteria 1111
476 Ga0495655_0036072 3300053083 Bacteria 1234
477 Ga0500578_0020137 3300053086 Bacteria 4286
478 Ga0500566_0062344 3300053094 Bacteria 2108
479 Ga0500640_061452 3300053095 Bacteria 1628
480 Ga0500641_0104460 3300053096 Bacteria 1217
481 Ga0500650_0146509 3300053098 Bacteria 1093
482 Ga0500654_007417 3300053099 Bacteria 7613
483 Ga0500553_129117 3300053101 Bacteria 1023
484 Ga0500556_0199442 3300053104 Bacteria 791
485 Ga0500560_009773 3300053107 Bacteria 2372
486 Ga0500560_046737 3300053107 Bacteria 1377
487 Ga0500569_000605 3300053109 Bacteria 6077
488 Ga0500628_003600 3300053129 Bacteria 2559
489 Ga0500652_002080 3300053131 Bacteria 6015
490 Ga0500658_0014485 3300053134 Bacteria 2919
491 Ga0500573_0003286 3300053140 Bacteria 8336
492 Ga0500579_068132 3300053143 Bacteria 2070
493 Ga0500600_0037520 3300053149 Bacteria 2808
494 Ga0500600_0129328 3300053149 Bacteria 1288
495 Ga0500616_0011506 3300053153 Bacteria 5217
496 Ga0500633_0014358 3300053160 Bacteria 2246
497 Ga0500634_0032214 3300053161 Bacteria 2859
498 Ga0500656_000368 3300053732 Bacteria 3240
499 Ga0500587_004347 3300053739 Bacteria 1948
500 Ga0501084_0031798 3300054114 Bacteria 4412
501 Ga0501082_0017080 3300060353 Bacteria 6252
502 Ga0466962_0000264 3300061719 Bacteria 22152
503 Ga0466962_0136932 3300061719 Bacteria 1185
504 Ga0466962_0145675 3300061719 Bacteria 1148

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049572 Ga0501036_0783859 Ga0501036_0783859_165_767 192
2 3300049571 Ga0501034_0015788 Ga0501034_0015788_6989_7681 198
3 3300049572 Ga0501036_0020134 Ga0501036_0020134_34_726 198
4 3300049579 Ga0501043_0064446 Ga0501043_0064446_528_1220 198
5 3300049581 Ga0501047_0016316 Ga0501047_0016316_5804_6496 198
6 3300046472 Ga0495580_0088380 Ga0495580_0088380_1510_2136 203
7 3300046691 Ga0495670_0059457 Ga0495670_0059457_487_1125 206
8 3300003323 rootH1_10050211 rootH1_100502112 209
9 iso_pu_bacteria 2728369276 2729906133 211
10 3300046473 Ga0495582_0361555 Ga0495582_0361555_182_826 214
11 3300046660 Ga0495625_0314059 Ga0495625_0314059_40_726 214
12 3300053096 Ga0500641_0104460 Ga0500641_0104460_17_673 214
13 3300049569 Ga0501032_0046952 Ga0501032_0046952_83_826 215
14 3300049570 Ga0501033_0083487 Ga0501033_0083487_131_874 215
15 3300049574 Ga0501038_0021038 Ga0501038_0021038_317_1060 215
16 3300049575 Ga0501039_0093263 Ga0501039_0093263_1495_2238 215
17 3300049586 Ga0501070_0016294 Ga0501070_0016294_138_881 215
18 3300049822 Ga0501035_0210247 Ga0501035_0210247_785_1528 215
19 3300053101 Ga0500553_129117 Ga0500553_129117_19_681 216
20 3300049592 Ga0501076_0869848 Ga0501076_0869848_36_701 219
21 3300044656 Ga0466969_0301288 Ga0466969_0301288_18_692 221
22 3300046543 Ga0495645_0075463 Ga0495645_0075463_925_1599 221
23 3300047444 Ga0495675_0302788 Ga0495675_0302788_73_747 221
24 3300046454 Ga0495592_0006524 Ga0495592_0006524_7530_8216 223
25 3300046462 Ga0495651_0001024 Ga0495651_0001024_5856_6542 223
26 3300046463 Ga0495653_0007920 Ga0495653_0007920_2197_2883 223
27 3300046476 Ga0495662_0001508 Ga0495662_0001508_254_940 223
28 3300046477 Ga0495664_0014389 Ga0495664_0014389_3068_3754 223
29 3300046511 Ga0495608_0055759 Ga0495608_0055759_1610_2296 223
30 3300046516 Ga0495628_0004209 Ga0495628_0004209_1611_2297 223
31 3300046517 Ga0495630_0018837 Ga0495630_0018837_3333_4019 223
32 3300046526 Ga0495666_0000276 Ga0495666_0000276_15524_16210 223
33 3300046529 Ga0495652_0010317 Ga0495652_0010317_1055_1741 223
34 3300046531 Ga0495665_0001489 Ga0495665_0001489_3248_3934 223
35 3300046533 Ga0495640_0014849 Ga0495640_0014849_436_1122 223
36 3300046535 Ga0495586_0013133 Ga0495586_0013133_1391_2077 223
37 3300046536 Ga0495587_0120851 Ga0495587_0120851_337_1023 223
38 3300046543 Ga0495645_0128136 Ga0495645_0128136_478_1164 223
39 3300046559 Ga0495667_0006037 Ga0495667_0006037_2758_3444 223
40 3300046642 Ga0495634_0085341 Ga0495634_0085341_1055_1741 223
41 3300046663 Ga0495635_0007492 Ga0495635_0007492_1611_2297 223
42 3300046675 Ga0495657_0007303 Ga0495657_0007303_436_1122 223
43 3300046678 Ga0495599_0016882 Ga0495599_0016882_2794_3480 223
44 3300046679 Ga0495623_0018511 Ga0495623_0018511_2758_3444 223
45 3300046680 Ga0495646_0004100 Ga0495646_0004100_1055_1741 223
46 3300046689 Ga0495613_0016699 Ga0495613_0016699_2758_3444 223
47 3300046809 Ga0495600_0005577 Ga0495600_0005577_3745_4431 223
48 3300047315 Ga0495581_0081350 Ga0495581_0081350_1112_1798 223
49 3300047317 Ga0495604_0001211 Ga0495604_0001211_6597_7283 223
50 3300047319 Ga0495674_0156396 Ga0495674_0156396_478_1164 223
51 3300047444 Ga0495675_0011179 Ga0495675_0011179_3333_4019 223
52 3300047673 Ga0495593_0017142 Ga0495593_0017142_1992_2678 223
53 3300030521 Ga0307511_10058889 Ga0307511_100588894 225
54 3300046454 Ga0495592_0045585 Ga0495592_0045585_1770_2453 227
55 3300046455 Ga0495603_0262735 Ga0495603_0262735_117_800 227
56 3300046463 Ga0495653_0336106 Ga0495653_0336106_149_832 227
57 3300046472 Ga0495580_0113236 Ga0495580_0113236_290_973 227
58 3300046477 Ga0495664_0353497 Ga0495664_0353497_127_810 227
59 3300046642 Ga0495634_0137030 Ga0495634_0137030_622_1305 227
60 3300046663 Ga0495635_0028351 Ga0495635_0028351_538_1221 227
61 3300046675 Ga0495657_0061049 Ga0495657_0061049_244_927 227
62 3300046678 Ga0495599_0114860 Ga0495599_0114860_890_1573 227
63 3300046690 Ga0495624_0091080 Ga0495624_0091080_38_721 227
64 3300047315 Ga0495581_0415436 Ga0495581_0415436_88_774 227
65 3300047322 Ga0495680_0032145 Ga0495680_0032145_803_1486 227
66 3300047444 Ga0495675_0062901 Ga0495675_0062901_772_1455 227
67 3300047471 Ga0495684_0044932 Ga0495684_0044932_1961_2644 227
68 3300049578 Ga0501042_0095330 Ga0501042_0095330_11_694 227
69 iso_pu_bacteria 2995463766 2995464594 229
70 3300049568 Ga0501031_0050839 Ga0501031_0050839_977_1693 230
71 3300025297 Ga0209758_1001801 Ga0209758_100180113 231
72 3300013105 Ga0157369_10372629 Ga0157369_103726292 233
73 3300042002 Ga0439442_007519 Ga0439442_007519_781_1482 233
74 3300044656 Ga0466969_0010145 Ga0466969_0010145_1941_2651 233
75 3300044684 Ga0466966_0014450 Ga0466966_0014450_3799_4509 233
76 3300044693 Ga0466961_0120887 Ga0466961_0120887_719_1429 233
77 3300044901 Ga0466960_0051368 Ga0466960_0051368_741_1442 233
78 3300045049 Ga0466959_0021760 Ga0466959_0021760_2989_3699 233
79 3300046557 Ga0495622_0020177 Ga0495622_0020177_2361_3062 233
80 3300048089 Ga0495614_0196479 Ga0495614_0196479_193_894 233
81 3300049580 Ga0501046_0305511 Ga0501046_0305511_423_1124 233
82 3300028786 Ga0307517_10010039 Ga0307517_100100392 234
83 3300031507 Ga0307509_10156812 Ga0307509_101568123 234
84 3300031616 Ga0307508_10003933 Ga0307508_1000393311 234
85 3300031730 Ga0307516_10035913 Ga0307516_100359132 234
86 3300046459 Ga0495629_0014292 Ga0495629_0014292_3354_4070 234
87 3300046492 Ga0495585_0055448 Ga0495585_0055448_797_1513 234
88 3300046519 Ga0495632_0023292 Ga0495632_0023292_744_1460 234
89 3300046558 Ga0495633_0007313 Ga0495633_0007313_4184_4900 234
90 3300046691 Ga0495670_0003457 Ga0495670_0003457_1353_2069 234
91 3300047321 Ga0495676_0155507 Ga0495676_0155507_540_1256 234
92 3300047446 Ga0495679_023539 Ga0495679_023539_348_1064 234
93 3300047447 Ga0495685_000366 Ga0495685_000366_5976_6692 234
94 3300047470 Ga0495681_0000244 Ga0495681_0000244_36549_37265 234
95 3300053083 Ga0495655_0036072 Ga0495655_0036072_350_1066 234
96 3300053086 Ga0500578_0020137 Ga0500578_0020137_761_1477 234
97 3300053094 Ga0500566_0062344 Ga0500566_0062344_588_1304 234
98 3300053099 Ga0500654_007417 Ga0500654_007417_3670_4386 234
99 3300053104 Ga0500556_0199442 Ga0500556_0199442_41_757 234
100 3300053109 Ga0500569_000605 Ga0500569_000605_3058_3774 234
101 3300053129 Ga0500628_003600 Ga0500628_003600_992_1708 234
102 3300053131 Ga0500652_002080 Ga0500652_002080_4043_4759 234
103 3300053134 Ga0500658_0014485 Ga0500658_0014485_1740_2456 234
104 3300053143 Ga0500579_068132 Ga0500579_068132_517_1233 234
105 3300053149 Ga0500600_0037520 Ga0500600_0037520_1592_2308 234
106 3300053153 Ga0500616_0011506 Ga0500616_0011506_2722_3438 234
107 3300053160 Ga0500633_0014358 Ga0500633_0014358_725_1441 234
108 3300053161 Ga0500634_0032214 Ga0500634_0032214_1704_2420 234
109 3300053732 Ga0500656_000368 Ga0500656_000368_1882_2598 234
110 3300053739 Ga0500587_004347 Ga0500587_004347_887_1603 234
111 3300031649 Ga0307514_10000866 Ga0307514_1000086614 235
112 3300031730 Ga0307516_10000836 Ga0307516_1000083631 235
113 3300033180 Ga0307510_10011375 Ga0307510_1001137512 235
114 3300046690 Ga0495624_0103190 Ga0495624_0103190_887_1606 235
115 3300049570 Ga0501033_0000386 Ga0501033_0000386_6951_7688 235
116 3300049571 Ga0501034_0014787 Ga0501034_0014787_5823_6560 235
117 3300049572 Ga0501036_0001683 Ga0501036_0001683_4297_5034 235
118 3300049574 Ga0501038_0353896 Ga0501038_0353896_177_914 235
119 3300049575 Ga0501039_0054427 Ga0501039_0054427_10_747 235
120 3300049579 Ga0501043_0003942 Ga0501043_0003942_9170_9907 235
121 3300049581 Ga0501047_0053202 Ga0501047_0053202_2043_2780 235
122 3300049586 Ga0501070_0004631 Ga0501070_0004631_4030_4767 235
123 3300049590 Ga0501074_0003992 Ga0501074_0003992_1168_1905 235
124 3300049822 Ga0501035_0002175 Ga0501035_0002175_12753_13490 235
125 3300053107 Ga0500560_046737 Ga0500560_046737_282_1001 235
126 3300053140 Ga0500573_0003286 Ga0500573_0003286_191_910 235
127 3300044684 Ga0466966_0186603 Ga0466966_0186603_118_828 236
128 3300045976 Ga0466967_0040967 Ga0466967_0040967_2739_3455 236
129 3300048088 Ga0495602_0590308 Ga0495602_0590308_30_746 236
130 3300049570 Ga0501033_0038220 Ga0501033_0038220_1980_2696 236
131 3300049573 Ga0501037_0195075 Ga0501037_0195075_69_785 236
132 3300049578 Ga0501042_0060219 Ga0501042_0060219_133_849 236
133 3300049581 Ga0501047_0327856 Ga0501047_0327856_26_742 236
134 3300049586 Ga0501070_0612310 Ga0501070_0612310_92_808 236
135 3300049822 Ga0501035_0026863 Ga0501035_0026863_3771_4487 236
136 3300049822 Ga0501035_0409138 Ga0501035_0409138_316_1032 236
137 3300049823 Ga0501044_0041638 Ga0501044_0041638_1200_1916 236
138 3300025302 Ga0207426_1001321 Ga0207426_10013214 237
139 3300025302 Ga0207426_1006641 Ga0207426_10066415 237
140 3300046454 Ga0495592_0036821 Ga0495592_0036821_659_1414 237
141 3300046455 Ga0495603_0047958 Ga0495603_0047958_1514_2269 237
142 3300046459 Ga0495629_0010114 Ga0495629_0010114_1728_2483 237
143 3300046459 Ga0495629_0120933 Ga0495629_0120933_662_1381 237
144 3300046462 Ga0495651_0111207 Ga0495651_0111207_21_776 237
145 3300046477 Ga0495664_0039464 Ga0495664_0039464_1243_1998 237
146 3300046492 Ga0495585_0010261 Ga0495585_0010261_4023_4742 237
147 3300046499 Ga0495594_0144151 Ga0495594_0144151_333_1088 237
148 3300046516 Ga0495628_0015589 Ga0495628_0015589_3817_4572 237
149 3300046526 Ga0495666_0085569 Ga0495666_0085569_394_1149 237
150 3300046529 Ga0495652_0019806 Ga0495652_0019806_2360_3115 237
151 3300046533 Ga0495640_0001318 Ga0495640_0001318_16319_17074 237
152 3300046642 Ga0495634_0108960 Ga0495634_0108960_417_1172 237
153 3300046675 Ga0495657_0052588 Ga0495657_0052588_365_1120 237
154 3300046689 Ga0495613_0008415 Ga0495613_0008415_5788_6543 237
155 3300046690 Ga0495624_0045478 Ga0495624_0045478_1722_2477 237
156 3300046809 Ga0495600_0057616 Ga0495600_0057616_206_961 237
157 3300047317 Ga0495604_0021665 Ga0495604_0021665_4122_4847 237
158 3300047317 Ga0495604_0030368 Ga0495604_0030368_2690_3445 237
159 3300047321 Ga0495676_0006378 Ga0495676_0006378_8171_8926 237
160 3300047444 Ga0495675_0014969 Ga0495675_0014969_2165_2920 237
161 3300049568 Ga0501031_0023828 Ga0501031_0023828_3194_3913 237
162 3300049569 Ga0501032_0002783 Ga0501032_0002783_9651_10370 237
163 3300049569 Ga0501032_0021149 Ga0501032_0021149_3190_3909 237
164 3300049570 Ga0501033_0025945 Ga0501033_0025945_648_1367 237
165 3300049571 Ga0501034_0049017 Ga0501034_0049017_3194_3913 237
166 3300049571 Ga0501034_0356848 Ga0501034_0356848_482_1201 237
167 3300049572 Ga0501036_0001699 Ga0501036_0001699_9772_10491 237
168 3300049572 Ga0501036_0212459 Ga0501036_0212459_103_822 237
169 3300049573 Ga0501037_0004902 Ga0501037_0004902_974_1693 237
170 3300049573 Ga0501037_0033367 Ga0501037_0033367_2962_3729 237
171 3300049574 Ga0501038_0030950 Ga0501038_0030950_3438_4157 237
172 3300049574 Ga0501038_0469565 Ga0501038_0469565_141_860 237
173 3300049575 Ga0501039_0035966 Ga0501039_0035966_575_1294 237
174 3300049576 Ga0501040_0252282 Ga0501040_0252282_453_1172 237
175 3300049577 Ga0501041_0005939 Ga0501041_0005939_2963_3682 237
176 3300049578 Ga0501042_0221221 Ga0501042_0221221_137_856 237
177 3300049579 Ga0501043_0028894 Ga0501043_0028894_3546_4265 237
178 3300049579 Ga0501043_0060160 Ga0501043_0060160_1038_1757 237
179 3300049580 Ga0501046_0031885 Ga0501046_0031885_3464_4183 237
180 3300049580 Ga0501046_0044321 Ga0501046_0044321_2027_2746 237
181 3300049581 Ga0501047_0000242 Ga0501047_0000242_48502_49269 237
182 3300049581 Ga0501047_0002545 Ga0501047_0002545_2996_3715 237
183 3300049581 Ga0501047_0014162 Ga0501047_0014162_3488_4207 237
184 3300049581 Ga0501047_0048055 Ga0501047_0048055_1866_2585 237
185 3300049582 Ga0501048_0160396 Ga0501048_0160396_87_806 237
186 3300049583 Ga0501067_0002580 Ga0501067_0002580_5217_5936 237
187 3300049584 Ga0501068_0000577 Ga0501068_0000577_17564_18283 237
188 3300049586 Ga0501070_0030214 Ga0501070_0030214_3046_3765 237
189 3300049587 Ga0501071_0025809 Ga0501071_0025809_3186_3905 237
190 3300049588 Ga0501072_0011329 Ga0501072_0011329_3402_4121 237
191 3300049589 Ga0501073_0005145 Ga0501073_0005145_8706_9425 237
192 3300049593 Ga0501077_0060424 Ga0501077_0060424_1368_2087 237
193 3300049744 Ga0501083_0026593 Ga0501083_0026593_398_1117 237
194 3300049822 Ga0501035_0005959 Ga0501035_0005959_246_965 237
195 3300049822 Ga0501035_0110452 Ga0501035_0110452_590_1309 237
196 3300049823 Ga0501044_0005221 Ga0501044_0005221_2992_3711 237
197 3300049823 Ga0501044_0012432 Ga0501044_0012432_5010_5729 237
198 3300049824 Ga0501045_0019570 Ga0501045_0019570_3550_4269 237
199 3300054114 Ga0501084_0031798 Ga0501084_0031798_3435_4154 237
200 3300060353 Ga0501082_0017080 Ga0501082_0017080_2653_3372 237
201 iso_pu_bacteria 3006321560 3006322382 238
202 3300037853 Ga0436364_0634101 Ga0436364_0634101_796_1515 239
203 3300049569 Ga0501032_0071008 Ga0501032_0071008_134_877 239
204 3300049574 Ga0501038_0022993 Ga0501038_0022993_172_915 239
205 3300049575 Ga0501039_0401595 Ga0501039_0401595_172_915 239
206 3300049579 Ga0501043_0086732 Ga0501043_0086732_741_1484 239
207 3300049581 Ga0501047_0392349 Ga0501047_0392349_316_1059 239
208 3300049822 Ga0501035_0007611 Ga0501035_0007611_1703_2446 239
209 3300049823 Ga0501044_0035840 Ga0501044_0035840_1587_2330 239
210 iso_pu_bacteria 2767802112 2768646847 240
211 iso_pu_bacteria 2867346516 2867351225 240
212 iso_pu_bacteria 3006393351 3006393368 240
213 iso_pu_bacteria 2643221587 2643945215 241
214 iso_pu_bacteria 2643221670 2644387445 241
215 iso_pu_bacteria 2643221677 2644432114 241
216 iso_pu_bacteria 2867369537 2867370571 241
217 iso_pu_bacteria 2867475112 2867478254 241
218 iso_pu_bacteria 2873151551 2873157082 241
219 iso_pu_bacteria 2918501144 2918503133 241
220 iso_pu_bacteria 2935390628 2935396210 241
221 iso_pu_bacteria 2990088156 2990089695 241
222 iso_pu_bacteria 2997451912 2997458607 241
223 iso_pu_bacteria 3006425503 3006426677 241
224 iso_pu_bacteria 8025478263 8025483228 241
225 iso_pu_bacteria 8033684223 8033687653 241
226 iso_pu_bacteria 8054160619 8054163604 241
227 iso_pu_bacteria 8056447290 8056450129 241
228 iso_pu_bacteria 8056667051 8056667890 241
229 iso_pu_bacteria 2547132111 2547409655 242
230 iso_pu_bacteria 2554235005 2554259036 242
231 iso_pu_bacteria 2582581313 2585306738 242
232 iso_pu_bacteria 2582581314 2585314151 242
233 iso_pu_bacteria 2616644814 2616694225 242
234 iso_pu_bacteria 2643221548 2643759251 242
235 iso_pu_bacteria 2643221578 2643897320 242
236 iso_pu_bacteria 2643221647 2644271057 242
237 iso_pu_bacteria 2643221678 2644435724 242
238 iso_pu_bacteria 2643221682 2644463331 242
239 iso_pu_bacteria 2643221714 2644629450 242
240 iso_pu_bacteria 2784132148 2784587318 242
241 iso_pu_bacteria 2784746763 2785345008 242
242 iso_pu_bacteria 2784746768 2785367869 242
243 iso_pu_bacteria 2786546132 2786668923 242
244 iso_pu_bacteria 2791355406 2793984592 242
245 iso_pu_bacteria 2802429296 2804844336 242
246 iso_pu_bacteria 2808606359 2808840533 242
247 iso_pu_bacteria 2808606375 2808919112 242
248 iso_pu_bacteria 2808606448 2809230891 242
249 iso_pu_bacteria 2808606982 2811847543 242
250 iso_pu_bacteria 2811994879 2812359650 242
251 iso_pu_bacteria 2811994917 2812481774 242
252 iso_pu_bacteria 2818991463 2819694175 242
253 iso_pu_bacteria 2852635781 2852638368 242
254 iso_pu_bacteria 2862178590 2862183009 242
255 iso_pu_bacteria 2862281513 2862288751 242
256 iso_pu_bacteria 2862290372 2862296593 242
257 iso_pu_bacteria 2862382967 2862385422 242
258 iso_pu_bacteria 2862507626 2862513609 242
259 iso_pu_bacteria 2862574272 2862583002 242
260 iso_pu_bacteria 2862705112 2862707765 242
261 iso_pu_bacteria 2863404153 2863406270 242
262 iso_pu_bacteria 2867428634 2867430728 242
263 iso_pu_bacteria 2875391855 2875393260 242
264 iso_pu_bacteria 2877676314 2877682691 242
265 iso_pu_bacteria 2912715099 2912721700 242
266 iso_pu_bacteria 2912723979 2912725545 242
267 iso_pu_bacteria 2912757875 2912759450 242
268 iso_pu_bacteria 2919468124 2919473021 242
269 iso_pu_bacteria 2946045630 2946051429 242
270 iso_pu_bacteria 2946064051 2946066259 242
271 iso_pu_bacteria 2946072368 2946074529 242
272 iso_pu_bacteria 2947224130 2947231116 242
273 iso_pu_bacteria 2954002825 2954004425 242
274 iso_pu_bacteria 2954380949 2954387873 242
275 iso_pu_bacteria 2954673503 2954675204 242
276 iso_pu_bacteria 2954682443 2954688931 242
277 iso_pu_bacteria 2954691527 2954698686 242
278 iso_pu_bacteria 2954701450 2954703537 242
279 iso_pu_bacteria 2954711539 2954717658 242
280 iso_pu_bacteria 2954721474 2954727624 242
281 iso_pu_bacteria 2954731030 2954734178 242
282 iso_pu_bacteria 2954740390 2954746518 242
283 iso_pu_bacteria 2954749733 2954753062 242
284 iso_pu_bacteria 2954759201 2954765634 242
285 iso_pu_bacteria 2966598605 2966603802 242
286 iso_pu_bacteria 2990044586 2990049359 242
287 iso_pu_bacteria 2990059506 2990064300 242
288 iso_pu_bacteria 2997600082 2997606654 242
289 iso_pu_bacteria 3006486233 3006488007 242
290 iso_pu_bacteria 3006493962 3006495484 242
291 iso_pu_bacteria 8008485437 8008489576 242
292 iso_pu_bacteria 8008558824 8008562038 242
293 iso_pu_bacteria 8008574985 8008580141 242
294 iso_pu_bacteria 8023623736 8023627564 242
295 iso_pu_bacteria 8025413630 8025417002 242
296 iso_pu_bacteria 8025524527 8025528848 242
297 iso_pu_bacteria 8047893842 8047899676 242
298 iso_pu_bacteria 8048127548 8048135504 242
299 iso_pu_bacteria 8048356638 8048359254 242
300 iso_pu_bacteria 8048369669 8048376625 242
301 iso_pu_bacteria 8048379754 8048385678 242
302 iso_pu_bacteria 8048406513 8048410061 242
303 iso_pu_bacteria 8056829672 8056831165 242
304 3300003320 rootH2_10024721 rootH2_100247214 245
305 3300003322 rootL2_10005501 rootL2_100055012 245
306 3300003323 rootH1_10087443 rootH1_100874434 245
307 3300025302 Ga0207426_1004573 Ga0207426_10045738 245
308 3300031824 Ga0307413_10341378 Ga0307413_103413782 245
309 3300032005 Ga0307411_10140372 Ga0307411_101403722 245
310 3300042138 Ga0450903_029165 Ga0450903_029165_73_810 245
311 3300046794 Ga0495589_0005381 Ga0495589_0005381_1011_1748 245
312 3300047318 Ga0495636_0053021 Ga0495636_0053021_718_1455 245
313 3300047447 Ga0495685_023578 Ga0495685_023578_606_1343 245
314 iso_pu_bacteria 2582581312 2585302055 245
315 iso_pu_bacteria 2616644941 2616899371 245
316 iso_pu_bacteria 2643221673 2644408465 245
317 iso_pu_bacteria 8025530807 8025535436 245
318 3300001989 JGI24739J22299_10023216 JGI24739J22299_100232161 246
319 3300002075 JGI24738J21930_10012233 JGI24738J21930_100122332 246
320 3300003316 rootH1_10023073 rootH1_100230734 246
321 3300003323 rootH1_10087437 rootH1_100874379 246
322 3300003578 Ga0006562J51391_1106064 Ga0006562J51391_11060648 246
323 3300003578 Ga0006562J51391_1106066 Ga0006562J51391_11060662 246
324 3300005539 Ga0068853_100770361 Ga0068853_1007703612 246
325 3300005614 Ga0068856_100154205 Ga0068856_1001542052 246
326 3300006038 Ga0075365_10041788 Ga0075365_100417883 246
327 3300006042 Ga0075368_10011784 Ga0075368_100117843 246
328 3300006048 Ga0075363_100030535 Ga0075363_1000305352 246
329 3300006178 Ga0075367_10055283 Ga0075367_100552832 246
330 3300009011 Ga0105251_10058360 Ga0105251_100583602 246
331 3300009148 Ga0105243_10172259 Ga0105243_101722592 246
332 3300009148 Ga0105243_10522817 Ga0105243_105228171 246
333 3300011119 Ga0105246_10024504 Ga0105246_100245043 246
334 3300013307 Ga0157372_10270517 Ga0157372_102705172 246
335 3300014497 Ga0182008_10002930 Ga0182008_1000293013 246
336 3300015262 Ga0182007_10001340 Ga0182007_100013408 246
337 3300015265 Ga0182005_1008312 Ga0182005_10083123 246
338 3300015688 Ga0183367_1007 Ga0183367_1007357 246
339 3300025735 Ga0207713_1062262 Ga0207713_10622622 246
340 3300025904 Ga0207647_10103995 Ga0207647_101039951 246
341 3300025981 Ga0207640_10118276 Ga0207640_101182762 246
342 3300026041 Ga0207639_10593419 Ga0207639_105934192 246
343 3300028379 Ga0268266_10474382 Ga0268266_104743822 246
344 3300028786 Ga0307517_10068717 Ga0307517_100687173 246
345 3300028794 Ga0307515_10001023 Ga0307515_100010238 246
346 3300028794 Ga0307515_10157830 Ga0307515_101578302 246
347 3300028794 Ga0307515_10240513 Ga0307515_102405132 246
348 3300030521 Ga0307511_10002015 Ga0307511_100020154 246
349 3300030522 Ga0307512_10001219 Ga0307512_1000121921 246
350 3300030522 Ga0307512_10012811 Ga0307512_100128113 246
351 3300030522 Ga0307512_10158624 Ga0307512_101586242 246
352 3300030736 Ga0316180_1119922 Ga0316180_11199222 246
353 3300031456 Ga0307513_10023919 Ga0307513_100239196 246
354 3300031456 Ga0307513_10093527 Ga0307513_100935274 246
355 3300031456 Ga0307513_10108458 Ga0307513_101084583 246
356 3300031507 Ga0307509_10010380 Ga0307509_100103808 246
357 3300031507 Ga0307509_10107841 Ga0307509_101078412 246
358 3300031507 Ga0307509_10122112 Ga0307509_101221122 246
359 3300031616 Ga0307508_10002617 Ga0307508_100026178 246
360 3300031616 Ga0307508_10007385 Ga0307508_100073858 246
361 3300031649 Ga0307514_10066796 Ga0307514_100667964 246
362 3300031730 Ga0307516_10146654 Ga0307516_101466542 246
363 3300031838 Ga0307518_10246664 Ga0307518_102466642 246
364 3300031852 Ga0307410_10200475 Ga0307410_102004752 246
365 3300031995 Ga0307409_100290845 Ga0307409_1002908451 246
366 3300032002 Ga0307416_100367978 Ga0307416_1003679782 246
367 3300033179 Ga0307507_10014046 Ga0307507_100140465 246
368 3300033179 Ga0307507_10073536 Ga0307507_100735364 246
369 3300033179 Ga0307507_10345660 Ga0307507_103456601 246
370 3300033180 Ga0307510_10008937 Ga0307510_100089378 246
371 3300033180 Ga0307510_10015509 Ga0307510_100155096 246
372 3300037312 Ga0395899_0172602 Ga0395899_0172602_725_1465 246
373 3300037418 Ga0395900_0026421 Ga0395900_0026421_3623_4363 246
374 3300037418 Ga0395900_0639617 Ga0395900_0639617_200_940 246
375 3300037466 Ga0395898_0003389 Ga0395898_0003389_8832_9572 246
376 3300037466 Ga0395898_0012758 Ga0395898_0012758_4305_5045 246
377 3300037466 Ga0395898_0398544 Ga0395898_0398544_96_836 246
378 3300037471 Ga0395905_0113848 Ga0395905_0113848_1581_2321 246
379 3300041404 Ga0439436_0000366 Ga0439436_0000366_4323_5063 246
380 3300041404 Ga0439436_0002119 Ga0439436_0002119_4616_5356 246
381 3300041406 Ga0439439_0008281 Ga0439439_0008281_1149_1889 246
382 3300041494 Ga0451837_1335871 Ga0451837_1335871_413_1153 246
383 3300041512 Ga0451853_0263207 Ga0451853_0263207_2100_2840 246
384 3300041512 Ga0451853_0543791 Ga0451853_0543791_976_1716 246
385 3300041999 Ga0439433_0000247 Ga0439433_0000247_6715_7455 246
386 3300041999 Ga0439433_0020186 Ga0439433_0020186_697_1437 246
387 3300042005 Ga0439448_0007003 Ga0439448_0007003_1470_2210 246
388 3300042007 Ga0439449_0000374 Ga0439449_0000374_10524_11264 246
389 3300042012 Ga0439455_0001016 Ga0439455_0001016_299_1039 246
390 3300042014 Ga0439457_000022 Ga0439457_000022_28126_28866 246
391 3300042014 Ga0439457_000358 Ga0439457_000358_600_1340 246
392 3300042015 Ga0439462_0030424 Ga0439462_0030424_357_1097 246
393 3300042122 Ga0450920_015340 Ga0450920_015340_538_1278 246
394 3300042131 Ga0450894_000108 Ga0450894_000108_546_1286 246
395 3300042131 Ga0450894_011415 Ga0450894_011415_121_861 246
396 3300042132 Ga0450895_002420 Ga0450895_002420_611_1351 246
397 3300042133 Ga0450896_001946 Ga0450896_001946_1384_2124 246
398 3300042134 Ga0450898_000274 Ga0450898_000274_4475_5215 246
399 3300042135 Ga0450899_000105 Ga0450899_000105_3295_4035 246
400 3300042138 Ga0450903_001441 Ga0450903_001441_3018_3758 246
401 3300042145 Ga0450906_012776 Ga0450906_012776_614_1354 246
402 3300042157 Ga0439458_0000302 Ga0439458_0000302_10461_11201 246
403 3300042157 Ga0439458_0020558 Ga0439458_0020558_291_1031 246
404 3300044656 Ga0466969_0044712 Ga0466969_0044712_518_1258 246
405 3300044656 Ga0466969_0177995 Ga0466969_0177995_155_895 246
406 3300044658 Ga0466972_0006803 Ga0466972_0006803_1766_2506 246
407 3300044658 Ga0466972_0007999 Ga0466972_0007999_355_1095 246
408 3300044658 Ga0466972_0087441 Ga0466972_0087441_451_1191 246
409 3300044683 Ga0466965_0008430 Ga0466965_0008430_3367_4107 246
410 3300044683 Ga0466965_0158076 Ga0466965_0158076_293_1033 246
411 3300044684 Ga0466966_0001836 Ga0466966_0001836_2637_3377 246
412 3300044684 Ga0466966_0005247 Ga0466966_0005247_4417_5157 246
413 3300044693 Ga0466961_0005229 Ga0466961_0005229_6225_6965 246
414 3300044693 Ga0466961_0006907 Ga0466961_0006907_5725_6465 246
415 3300044693 Ga0466961_0235576 Ga0466961_0235576_327_1067 246
416 3300044694 Ga0466963_0000206 Ga0466963_0000206_21521_22261 246
417 3300044694 Ga0466963_0000614 Ga0466963_0000614_3021_3761 246
418 3300044706 Ga0466964_0002142 Ga0466964_0002142_3188_3928 246
419 3300044706 Ga0466964_0061045 Ga0466964_0061045_411_1151 246
420 3300044719 Ga0466971_0003295 Ga0466971_0003295_1315_2055 246
421 3300044719 Ga0466971_0058340 Ga0466971_0058340_118_858 246
422 3300044765 Ga0466970_0045837 Ga0466970_0045837_1175_1915 246
423 3300044842 Ga0466957_0000450 Ga0466957_0000450_5385_6125 246
424 3300044842 Ga0466957_0129811 Ga0466957_0129811_739_1479 246
425 3300044842 Ga0466957_0355354 Ga0466957_0355354_122_874 246
426 3300044901 Ga0466960_0007225 Ga0466960_0007225_3473_4213 246
427 3300045049 Ga0466959_0003180 Ga0466959_0003180_1928_2668 246
428 3300045836 Ga0466958_0026392 Ga0466958_0026392_637_1377 246
429 3300045976 Ga0466967_0000259 Ga0466967_0000259_16193_16933 246
430 3300045976 Ga0466967_0008081 Ga0466967_0008081_2847_3587 246
431 3300045976 Ga0466967_0135100 Ga0466967_0135100_592_1332 246
432 3300046452 Ga0495617_027576 Ga0495617_027576_1025_1774 246
433 3300046452 Ga0495617_082039 Ga0495617_082039_27_818 246
434 3300046455 Ga0495603_0000118 Ga0495603_0000118_28159_28917 246
435 3300046455 Ga0495603_0001925 Ga0495603_0001925_5957_6697 246
436 3300046455 Ga0495603_0004752 Ga0495603_0004752_150_908 246
437 3300046455 Ga0495603_0006077 Ga0495603_0006077_3017_3757 246
438 3300046455 Ga0495603_0022015 Ga0495603_0022015_839_1630 246
439 3300046455 Ga0495603_0034869 Ga0495603_0034869_1910_2659 246
440 3300046459 Ga0495629_0003945 Ga0495629_0003945_817_1575 246
441 3300046459 Ga0495629_0041454 Ga0495629_0041454_968_1726 246
442 3300046459 Ga0495629_0063297 Ga0495629_0063297_1519_2268 246
443 3300046459 Ga0495629_0071439 Ga0495629_0071439_289_1032 246
444 3300046459 Ga0495629_0121638 Ga0495629_0121638_878_1618 246
445 3300046459 Ga0495629_0239512 Ga0495629_0239512_32_772 246
446 3300046460 Ga0495638_0047464 Ga0495638_0047464_861_1604 246
447 3300046460 Ga0495638_0088642 Ga0495638_0088642_556_1314 246
448 3300046460 Ga0495638_0099678 Ga0495638_0099678_97_846 246
449 3300046462 Ga0495651_0003371 Ga0495651_0003371_10031_10774 246
450 3300046473 Ga0495582_0032257 Ga0495582_0032257_1020_1760 246
451 3300046474 Ga0495605_0016422 Ga0495605_0016422_912_1661 246
452 3300046474 Ga0495605_0061207 Ga0495605_0061207_531_1271 246
453 3300046475 Ga0495639_0004088 Ga0495639_0004088_4787_5527 246
454 3300046476 Ga0495662_0002106 Ga0495662_0002106_8844_9587 246
455 3300046476 Ga0495662_0007559 Ga0495662_0007559_4320_5060 246
456 3300046476 Ga0495662_0010516 Ga0495662_0010516_973_1713 246
457 3300046492 Ga0495585_0010501 Ga0495585_0010501_731_1522 246
458 3300046492 Ga0495585_0049655 Ga0495585_0049655_644_1402 246
459 3300046499 Ga0495594_0001176 Ga0495594_0001176_3871_4629 246
460 3300046499 Ga0495594_0009930 Ga0495594_0009930_1925_2716 246
461 3300046499 Ga0495594_0030143 Ga0495594_0030143_1181_1921 246
462 3300046499 Ga0495594_0034759 Ga0495594_0034759_1358_2101 246
463 3300046499 Ga0495594_0051543 Ga0495594_0051543_814_1563 246
464 3300046501 Ga0495607_0020472 Ga0495607_0020472_517_1308 246
465 3300046501 Ga0495607_0052749 Ga0495607_0052749_702_1451 246
466 3300046506 Ga0495583_0045601 Ga0495583_0045601_952_1692 246
467 3300046506 Ga0495583_0054882 Ga0495583_0054882_352_1101 246
468 3300046507 Ga0495606_0270725 Ga0495606_0270725_171_911 246
469 3300046512 Ga0495610_0122134 Ga0495610_0122134_313_1053 246
470 3300046513 Ga0495616_0026098 Ga0495616_0026098_684_1433 246
471 3300046515 Ga0495620_0029923 Ga0495620_0029923_889_1629 246
472 3300046515 Ga0495620_0077425 Ga0495620_0077425_280_1020 246
473 3300046517 Ga0495630_0206540 Ga0495630_0206540_170_913 246
474 3300046518 Ga0495631_0058212 Ga0495631_0058212_76_834 246
475 3300046519 Ga0495632_0072680 Ga0495632_0072680_446_1195 246
476 3300046522 Ga0495643_0009939 Ga0495643_0009939_1134_1874 246
477 3300046522 Ga0495643_0096993 Ga0495643_0096993_690_1430 246
478 3300046524 Ga0495648_0030033 Ga0495648_0030033_2427_3176 246
479 3300046524 Ga0495648_0077934 Ga0495648_0077934_234_974 246
480 3300046526 Ga0495666_0013360 Ga0495666_0013360_800_1549 246
481 3300046528 Ga0495642_0100832 Ga0495642_0100832_320_1060 246
482 3300046530 Ga0495654_0040072 Ga0495654_0040072_1047_1796 246
483 3300046533 Ga0495640_0011041 Ga0495640_0011041_5350_6090 246
484 3300046535 Ga0495586_0036445 Ga0495586_0036445_1672_2415 246
485 3300046538 Ga0495609_0030567 Ga0495609_0030567_1040_1789 246
486 3300046542 Ga0495597_0034116 Ga0495597_0034116_387_1127 246
487 3300046543 Ga0495645_0023913 Ga0495645_0023913_155_898 246
488 3300046557 Ga0495622_0017124 Ga0495622_0017124_673_1431 246
489 3300046558 Ga0495633_0027927 Ga0495633_0027927_1189_1938 246
490 3300046616 Ga0495668_0021470 Ga0495668_0021470_1586_2335 246
491 3300046616 Ga0495668_0049069 Ga0495668_0049069_788_1528 246
492 3300046660 Ga0495625_0002244 Ga0495625_0002244_3953_4696 246
493 3300046660 Ga0495625_0098008 Ga0495625_0098008_904_1644 246
494 3300046663 Ga0495635_0001097 Ga0495635_0001097_14957_15700 246
495 3300046665 Ga0495661_0050132 Ga0495661_0050132_1528_2319 246
496 3300046665 Ga0495661_0097235 Ga0495661_0097235_569_1318 246
497 3300046674 Ga0495588_0000445 Ga0495588_0000445_1189_1932 246
498 3300046674 Ga0495588_0010380 Ga0495588_0010380_2070_2810 246
499 3300046674 Ga0495588_0021761 Ga0495588_0021761_986_1726 246
500 3300046675 Ga0495657_0020324 Ga0495657_0020324_3109_3849 246
501 3300046675 Ga0495657_0134276 Ga0495657_0134276_202_945 246
502 3300046679 Ga0495623_0125399 Ga0495623_0125399_85_825 246
503 3300046680 Ga0495646_0001636 Ga0495646_0001636_81_824 246
504 3300046683 Ga0495658_0157644 Ga0495658_0157644_78_821 246
505 3300046689 Ga0495613_0004176 Ga0495613_0004176_776_1534 246
506 3300046689 Ga0495613_0007570 Ga0495613_0007570_4411_5154 246
507 3300046689 Ga0495613_0030282 Ga0495613_0030282_2293_3033 246
508 3300046689 Ga0495613_0078439 Ga0495613_0078439_1000_1740 246
509 3300046689 Ga0495613_0147517 Ga0495613_0147517_295_1038 246
510 3300046690 Ga0495624_0103283 Ga0495624_0103283_769_1518 246
511 3300046691 Ga0495670_0066056 Ga0495670_0066056_997_1788 246
512 3300046692 Ga0495671_0010283 Ga0495671_0010283_3913_4656 246
513 3300046694 Ga0495649_0040194 Ga0495649_0040194_935_1675 246
514 3300046694 Ga0495649_0058789 Ga0495649_0058789_103_843 246
515 3300046794 Ga0495589_0015151 Ga0495589_0015151_2001_2792 246
516 3300046794 Ga0495589_0016573 Ga0495589_0016573_1214_2005 246
517 3300046794 Ga0495589_0035373 Ga0495589_0035373_835_1575 246
518 3300046794 Ga0495589_0043392 Ga0495589_0043392_545_1294 246
519 3300046810 Ga0495660_0044575 Ga0495660_0044575_776_1516 246
520 3300047315 Ga0495581_0033869 Ga0495581_0033869_1022_1762 246
521 3300047317 Ga0495604_0001163 Ga0495604_0001163_19011_19754 246
522 3300047318 Ga0495636_0006783 Ga0495636_0006783_1123_1863 246
523 3300047318 Ga0495636_0019021 Ga0495636_0019021_1586_2326 246
524 3300047321 Ga0495676_0006095 Ga0495676_0006095_950_1708 246
525 3300047321 Ga0495676_0006752 Ga0495676_0006752_1899_2657 246
526 3300047321 Ga0495676_0100105 Ga0495676_0100105_1068_1817 246
527 3300047321 Ga0495676_0117948 Ga0495676_0117948_435_1226 246
528 3300047321 Ga0495676_0144812 Ga0495676_0144812_213_953 246
529 3300047322 Ga0495680_0126684 Ga0495680_0126684_715_1455 246
530 3300047443 Ga0495687_001939 Ga0495687_001939_528_1271 246
531 3300047443 Ga0495687_015487 Ga0495687_015487_1275_2015 246
532 3300047443 Ga0495687_031460 Ga0495687_031460_89_829 246
533 3300047443 Ga0495687_053637 Ga0495687_053637_570_1319 246
534 3300047444 Ga0495675_0006059 Ga0495675_0006059_1212_1952 246
535 3300047445 Ga0495677_0032423 Ga0495677_0032423_241_981 246
536 3300047445 Ga0495677_0052230 Ga0495677_0052230_516_1307 246
537 3300047447 Ga0495685_007458 Ga0495685_007458_2318_3058 246
538 3300047447 Ga0495685_013110 Ga0495685_013110_1828_2619 246
539 3300047447 Ga0495685_028440 Ga0495685_028440_757_1506 246
540 3300047447 Ga0495685_047415 Ga0495685_047415_321_1061 246
541 3300047470 Ga0495681_0001646 Ga0495681_0001646_8815_9558 246
542 3300047472 Ga0495686_0071796 Ga0495686_0071796_769_1512 246
543 3300047472 Ga0495686_0074653 Ga0495686_0074653_759_1508 246
544 3300047472 Ga0495686_0088048 Ga0495686_0088048_17_757 246
545 3300047673 Ga0495593_0006201 Ga0495593_0006201_5895_6638 246
546 3300047673 Ga0495593_0077706 Ga0495593_0077706_58_798 246
547 3300048089 Ga0495614_0001487 Ga0495614_0001487_6530_7273 246
548 3300048089 Ga0495614_0006637 Ga0495614_0006637_3801_4559 246
549 3300048089 Ga0495614_0044557 Ga0495614_0044557_555_1346 246
550 3300048089 Ga0495614_0113887 Ga0495614_0113887_283_1023 246
551 3300048089 Ga0495614_0238693 Ga0495614_0238693_25_765 246
552 3300048091 Ga0495626_0030009 Ga0495626_0030009_976_1725 246
553 3300048909 Ga0496106_0076835 Ga0496106_0076835_882_1640 246
554 3300048916 Ga0496113_0508843 Ga0496113_0508843_45_785 246
555 3300049459 Ga0495678_015428 Ga0495678_015428_2038_2787 246
556 3300049568 Ga0501031_0018732 Ga0501031_0018732_738_1478 246
557 3300049569 Ga0501032_0015658 Ga0501032_0015658_3139_3879 246
558 3300049570 Ga0501033_0004222 Ga0501033_0004222_10056_10796 246
559 3300049570 Ga0501033_0046503 Ga0501033_0046503_700_1440 246
560 3300049570 Ga0501033_0100035 Ga0501033_0100035_293_1033 246
561 3300049571 Ga0501034_0008282 Ga0501034_0008282_5846_6586 246
562 3300049571 Ga0501034_0010345 Ga0501034_0010345_4931_5671 246
563 3300049571 Ga0501034_0105345 Ga0501034_0105345_1324_2064 246
564 3300049571 Ga0501034_0182285 Ga0501034_0182285_1174_1914 246
565 3300049572 Ga0501036_0004838 Ga0501036_0004838_3812_4552 246
566 3300049573 Ga0501037_0005556 Ga0501037_0005556_1295_2035 246
567 3300049573 Ga0501037_0018664 Ga0501037_0018664_1207_1947 246
568 3300049574 Ga0501038_0000642 Ga0501038_0000642_20146_20886 246
569 3300049574 Ga0501038_0052616 Ga0501038_0052616_842_1582 246
570 3300049574 Ga0501038_0097624 Ga0501038_0097624_1228_1968 246
571 3300049575 Ga0501039_0358092 Ga0501039_0358092_241_981 246
572 3300049580 Ga0501046_0031520 Ga0501046_0031520_2390_3130 246
573 3300049580 Ga0501046_0036855 Ga0501046_0036855_2836_3576 246
574 3300049581 Ga0501047_0004059 Ga0501047_0004059_10706_11446 246
575 3300049581 Ga0501047_0064929 Ga0501047_0064929_2552_3292 246
576 3300049581 Ga0501047_0128187 Ga0501047_0128187_155_895 246
577 3300049582 Ga0501048_0016256 Ga0501048_0016256_2824_3564 246
578 3300049582 Ga0501048_0150271 Ga0501048_0150271_588_1328 246
579 3300049586 Ga0501070_0148488 Ga0501070_0148488_177_917 246
580 3300049586 Ga0501070_0180176 Ga0501070_0180176_383_1123 246
581 3300049586 Ga0501070_0237511 Ga0501070_0237511_511_1251 246
582 3300049822 Ga0501035_0029531 Ga0501035_0029531_4082_4822 246
583 3300049822 Ga0501035_0042566 Ga0501035_0042566_2189_2929 246
584 3300049822 Ga0501035_0060220 Ga0501035_0060220_1714_2454 246
585 3300049822 Ga0501035_0170234 Ga0501035_0170234_759_1499 246
586 3300049822 Ga0501035_0316374 Ga0501035_0316374_279_1019 246
587 3300049823 Ga0501044_0001763 Ga0501044_0001763_19880_20620 246
588 3300049823 Ga0501044_0041736 Ga0501044_0041736_3320_4060 246
589 3300049823 Ga0501044_0071335 Ga0501044_0071335_558_1298 246
590 3300049823 Ga0501044_0076761 Ga0501044_0076761_358_1098 246
591 3300049823 Ga0501044_0086247 Ga0501044_0086247_2011_2751 246
592 3300049824 Ga0501045_0132106 Ga0501045_0132106_902_1642 246
593 3300050490 nmdc:mga03n38_7094_c1 nmdc:mga03n38_7094_c1_956_1696 246
594 3300050494 nmdc:mga06z11_36288_c1 nmdc:mga06z11_36288_c1_689_1429 246
595 3300050495 nmdc:mga04h51_185569_c1 nmdc:mga04h51_185569_c1_39_779 246
596 3300050495 nmdc:mga04h51_3553_c1 nmdc:mga04h51_3553_c1_2369_3109 246
597 3300053079 Ga0500610_0162205 Ga0500610_0162205_34_777 246
598 3300053095 Ga0500640_061452 Ga0500640_061452_259_1002 246
599 3300053098 Ga0500650_0146509 Ga0500650_0146509_88_831 246
600 3300053107 Ga0500560_009773 Ga0500560_009773_259_1002 246
601 3300053149 Ga0500600_0129328 Ga0500600_0129328_381_1121 246
602 3300061719 Ga0466962_0000264 Ga0466962_0000264_15901_16641 246
603 3300061719 Ga0466962_0136932 Ga0466962_0136932_411_1151 246
604 3300061719 Ga0466962_0145675 Ga0466962_0145675_27_767 246

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02190

LON_substr_bdg

ATP-dependent protease La (LON) substrate-binding domain

1

253

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ljc-assembly1.cif.gz_A crystal structure of lon n-terminal domain. 0.8559 2 232
2ane-assembly1.cif.gz_D crystal structure of n-terminal domain of e.coli lon protease 0.8501 4 138
2ane-assembly1.cif.gz_D crystal structure of n-terminal domain of e.coli lon protease 0.836 4 138
7cr9-assembly1.cif.gz_A crystal structure of the n-terminal fragment (residue 1-206) of lona protease from meiothermus taiwanensis 0.8345 2 228
7yux-assembly1.cif.gz_F mtalon-adp for the spiral oligomers of hexamer 0.8223 6 232
ID Description Score Start End Superfamily
af_A0A2R8PXH8_356_472_2.30.130.40 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;LON domain-like 0.9126 5 138 2.30.130.40
af_K7KDV3_6_113_2.30.130.40 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;LON domain-like 0.9094 6 125 2.30.130.40
af_I1KCV7_279_380_2.30.130.40 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;LON domain-like 0.9058 5 140 2.30.130.40
af_I1K7N5_54_171_2.30.130.40 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;LON domain-like 0.9053 3 138 2.30.130.40
af_Q9VSB2_786_901_2.30.130.40 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;LON domain-like 0.9021 5 138 2.30.130.40
ID Description Score Start End GO Terms
AF-A0A535QVG7-F1-model_v4 Peptidase S16 0.9011 1 232
AF-A0A7W1J299-F1-model_v4 LON peptidase substrate-binding domain-containing protein 0.8984 4 232
AF-A0A7Y2NDC2-F1-model_v4 LON peptidase substrate-binding domain-containing protein 0.8947 2 232
AF-A0A7Y5BYD0-F1-model_v4 LON peptidase substrate-binding domain-containing protein 0.8884 5 232
AF-A0A6I5E6C9-F1-model_v4 deleted 0.888 2 246

Feature Viewer

pLDDT pTM Quality
85.54 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map