F468429
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 604 | 355 | 578 | 327 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|8055225921|8055226415 |
| Length | 383 |
| Sequence | RSLDQMVPVTILTGFLGAGKTTLLKRILTEYHGKRIAVIENEFGPESIDNDLLVQDQDEEIIELSNGCVCCTVRGDLMRTLLDLRKRHESGELNFERVIIETTGMANPGPVCQTFFMDDDIAEYYRLDAVVTIVDAKHGMETLDEQEEAQKQVGFADRILISKKDLVTEAEYAALRRRIVHMNPRASIEAVNFGDTDLKKIIDISGFNLNTILDIDPQFLADDHPDAAHDHDHDHSHCDHDHGHCDHDHGHDHAHGHAHDHDHDPATCTNPDHNHGHSHKPAHNDNIGAFVFKSDKPFDPERLEEFLGGVVQVYGPDLLRYKGILYMKGINKRMLFQGVHMLMGAEPGKPWLANEKKTTKMVFIGRKLPQEIFTKGLEQCLAK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2599185292 | Achromobacter sp. NFACC18-2 | Isolate | Rhizoplane |
| 2 | 2643221569 | Achromobacter sp. Root565 | Isolate | Unclassified |
| 3 | 2643221594 | Achromobacter sp. Root170 | Isolate | Unclassified |
| 4 | 2643221621 | Achromobacter sp. Root83 | Isolate | Unclassified |
| 5 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 6 | 2739367655 | Pusillimonas sp. YR330 | Isolate | Unclassified |
| 7 | 2808606395 | Achromobacter sp. SLBN-14 | Isolate | Unclassified |
| 8 | 2808606418 | Herbaspirillum sp. SJZ107 | Isolate | Rhizosphere |
| 9 | 2855730933 | Achromobacter sp. HZ28 | Isolate | Nodule |
| 10 | 2855767633 | Achromobacter sp. HZ34 | Isolate | Nodule |
| 11 | 2857537821 | Achromobacter sp. R-71975 | Isolate | Unclassified |
| 12 | 2857542790 | Achromobacter sp. R-72367 | Isolate | Unclassified |
| 13 | 2857576091 | Pigmentiphaga sp. R-72090 | Isolate | Unclassified |
| 14 | 2858950400 | Achromobacter sp. K91 | Isolate | Unclassified |
| 15 | 2881412998 | Achromobacter aloeverae AVA-1 | Isolate | Unclassified |
| 16 | 2881927736 | Candidimonas sp. SYP-B2681 | Isolate | Rhizosphere |
| 17 | 2887375801 | Parapusillimonas sp. SGNA-6 | Isolate | Rhizosphere |
| 18 | 2895511927 | Pseudoxanthomonas sp. SGD-5-1 | Isolate | Rhizosphere |
| 19 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 20 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 21 | 2939669807 | Kaistia defluvii 3207 | Isolate | Rhizosphere |
| 22 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 23 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 24 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 25 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 26 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 27 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 28 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 29 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 30 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 31 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 32 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 33 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 37 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 39 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 49 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 55 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 60 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 63 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 71 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 72 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 73 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 74 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 76 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 77 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 78 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 79 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 80 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 81 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 82 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 83 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 84 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 85 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 86 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 87 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 88 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 90 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 91 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 92 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 93 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 94 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 95 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 96 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 97 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 98 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 100 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 101 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 119 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 121 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 174 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 177 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 178 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 179 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 180 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 181 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 182 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 183 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 184 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 185 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 186 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 187 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 188 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 189 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 190 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 191 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 192 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 193 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 194 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 195 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 196 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 197 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 198 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 199 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 200 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 201 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 202 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 203 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 204 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 205 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 206 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 207 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 208 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 209 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 210 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 211 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 212 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 213 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 214 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 215 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 216 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 217 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 218 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 219 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 220 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 221 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 222 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 296 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 297 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 298 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 299 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 300 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 301 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 302 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 303 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 304 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 305 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 306 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 307 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 336 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 337 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 338 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 339 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 340 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 341 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 342 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 344 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 349 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 350 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 353 | 8002392321 | Alcaligenes faecalis Mc250 | Isolate | Rhizosphere |
| 354 | 8048746797 | Alcaligenes endophyticus DSM 100498 | Isolate | Unclassified |
| 355 | 8055225921 | Achromobacter panacis KCTC 42751 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.53 |
| Metatranscriptomes | 0.17 |
| Isolates | 4.3 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.98 |
| Nodule | 0.33 |
| Rhizoplane | 0.99 |
| Rhizosphere | 90.89 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.8 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24737J22298_10068727 | 3300001990 | Bacteria | 1059 |
| 2 | JGI24735J21928_10054142 | 3300002067 | Bacteria | 1156 |
| 3 | JGI25151J46595_10002495 | 3300003187 | Bacteria | 10990 |
| 4 | rootH2_10004886 | 3300003320 | Bacteria | 25787 |
| 5 | Ga0055529_1000873 | 3300003763 | Bacteria | 17295 |
| 6 | Ga0055540_1001304 | 3300003792 | Bacteria | 15079 |
| 7 | Ga0058860_12046738 | 3300004801 | Bacteria | 1238 |
| 8 | Ga0065165_1001794 | 3300005262 | Bacteria | 21154 |
| 9 | Ga0065704_10088231 | 3300005289 | Bacteria | 2956 |
| 10 | Ga0065704_10181853 | 3300005289 | Bacteria | 1233 |
| 11 | Ga0065707_10031107 | 3300005295 | Bacteria | 1453 |
| 12 | Ga0070676_10009267 | 3300005328 | Bacteria | 5321 |
| 13 | Ga0070683_100123728 | 3300005329 | Bacteria | 2444 |
| 14 | Ga0070683_100148696 | 3300005329 | Bacteria | 2221 |
| 15 | Ga0070690_100000252 | 3300005330 | Bacteria | 27754 |
| 16 | Ga0070690_100020259 | 3300005330 | Bacteria | 4050 |
| 17 | Ga0070690_100156202 | 3300005330 | Bacteria | 1560 |
| 18 | Ga0068869_100000052 | 3300005334 | Bacteria | 50285 |
| 19 | Ga0068869_100016408 | 3300005334 | Bacteria | 4991 |
| 20 | Ga0068869_100032253 | 3300005334 | Bacteria | 3690 |
| 21 | Ga0070682_100040454 | 3300005337 | Bacteria | 2868 |
| 22 | Ga0068868_100001208 | 3300005338 | Bacteria | 17737 |
| 23 | Ga0068868_100058218 | 3300005338 | Bacteria | 3053 |
| 24 | Ga0070660_100194991 | 3300005339 | Bacteria | 1641 |
| 25 | Ga0070689_100000389 | 3300005340 | Bacteria | 25743 |
| 26 | Ga0070689_100039635 | 3300005340 | Bacteria | 3608 |
| 27 | Ga0070691_10000617 | 3300005341 | Bacteria | 13697 |
| 28 | Ga0070687_100000053 | 3300005343 | Bacteria | 37278 |
| 29 | Ga0070687_100057855 | 3300005343 | Bacteria | 2034 |
| 30 | Ga0070661_100060352 | 3300005344 | Bacteria | 2783 |
| 31 | Ga0070692_10139037 | 3300005345 | Bacteria | 1372 |
| 32 | Ga0070668_100028602 | 3300005347 | Bacteria | 4231 |
| 33 | Ga0070671_100324233 | 3300005355 | Bacteria | 1313 |
| 34 | Ga0070673_100115740 | 3300005364 | Bacteria | 2230 |
| 35 | Ga0070688_100029277 | 3300005365 | Bacteria | 3296 |
| 36 | Ga0070701_10000715 | 3300005438 | Bacteria | 11745 |
| 37 | Ga0070705_100000253 | 3300005440 | Bacteria | 31805 |
| 38 | Ga0070705_100216425 | 3300005440 | Bacteria | 1324 |
| 39 | Ga0070700_100000315 | 3300005441 | Bacteria | 25119 |
| 40 | Ga0070694_100000058 | 3300005444 | Bacteria | 52128 |
| 41 | Ga0070694_100002229 | 3300005444 | Bacteria | 11451 |
| 42 | Ga0070694_100071945 | 3300005444 | Bacteria | 2384 |
| 43 | Ga0070681_10000135 | 3300005458 | Bacteria | 56156 |
| 44 | Ga0068867_100000138 | 3300005459 | Bacteria | 46832 |
| 45 | Ga0068867_100000606 | 3300005459 | Bacteria | 23757 |
| 46 | Ga0070706_100271404 | 3300005467 | Bacteria | 1583 |
| 47 | Ga0070707_100246947 | 3300005468 | Bacteria | 1737 |
| 48 | Ga0070698_100007456 | 3300005471 | Bacteria | 11837 |
| 49 | Ga0070699_100031058 | 3300005518 | Bacteria | 4613 |
| 50 | Ga0070679_100003288 | 3300005530 | Bacteria | 14791 |
| 51 | Ga0070684_100114077 | 3300005535 | Bacteria | 2425 |
| 52 | Ga0070697_100042484 | 3300005536 | Bacteria | 3679 |
| 53 | Ga0070697_100051073 | 3300005536 | Bacteria | 3359 |
| 54 | Ga0070697_100051687 | 3300005536 | Bacteria | 3339 |
| 55 | Ga0068853_100076273 | 3300005539 | Bacteria | 2927 |
| 56 | Ga0070672_100126507 | 3300005543 | Bacteria | 2096 |
| 57 | Ga0070686_100000132 | 3300005544 | Bacteria | 52774 |
| 58 | Ga0070686_100209737 | 3300005544 | Bacteria | 1401 |
| 59 | Ga0070686_100287090 | 3300005544 | Bacteria | 1216 |
| 60 | Ga0070695_100003131 | 3300005545 | Bacteria | 9640 |
| 61 | Ga0070695_100007668 | 3300005545 | Bacteria | 6392 |
| 62 | Ga0070695_100066871 | 3300005545 | Bacteria | 2343 |
| 63 | Ga0070696_100000008 | 3300005546 | Bacteria | 101365 |
| 64 | Ga0070696_100001158 | 3300005546 | Bacteria | 17126 |
| 65 | Ga0070696_100005606 | 3300005546 | Bacteria | 8381 |
| 66 | Ga0070693_100000008 | 3300005547 | Bacteria | 80726 |
| 67 | Ga0070693_100051317 | 3300005547 | Bacteria | 2362 |
| 68 | Ga0070665_100037212 | 3300005548 | Bacteria | 4895 |
| 69 | Ga0070704_100000044 | 3300005549 | Bacteria | 41217 |
| 70 | Ga0070704_100005086 | 3300005549 | Bacteria | 7651 |
| 71 | Ga0070704_100048851 | 3300005549 | Bacteria | 2964 |
| 72 | Ga0070704_100111318 | 3300005549 | Bacteria | 2084 |
| 73 | Ga0068855_100000880 | 3300005563 | Bacteria | 37235 |
| 74 | Ga0068857_100035419 | 3300005577 | Bacteria | 4421 |
| 75 | Ga0068854_100020104 | 3300005578 | Bacteria | 4511 |
| 76 | Ga0068856_100023595 | 3300005614 | Bacteria | 5982 |
| 77 | Ga0070702_100001364 | 3300005615 | Bacteria | 9953 |
| 78 | Ga0068852_100043798 | 3300005616 | Bacteria | 3797 |
| 79 | Ga0068859_100000906 | 3300005617 | Bacteria | 30276 |
| 80 | Ga0068859_100116479 | 3300005617 | Bacteria | 2737 |
| 81 | Ga0068859_100192221 | 3300005617 | Bacteria | 2125 |
| 82 | Ga0068864_100023385 | 3300005618 | Bacteria | 5189 |
| 83 | Ga0068864_100023782 | 3300005618 | Bacteria | 5147 |
| 84 | Ga0068866_10000228 | 3300005718 | Bacteria | 26370 |
| 85 | Ga0068870_10153187 | 3300005840 | Bacteria | 1360 |
| 86 | Ga0068863_100042981 | 3300005841 | Bacteria | 4292 |
| 87 | Ga0068863_100100760 | 3300005841 | Bacteria | 2745 |
| 88 | Ga0068858_100001268 | 3300005842 | Bacteria | 26119 |
| 89 | Ga0068858_100028208 | 3300005842 | Bacteria | 5216 |
| 90 | Ga0068858_100145324 | 3300005842 | Bacteria | 2227 |
| 91 | Ga0068860_100000634 | 3300005843 | Bacteria | 41350 |
| 92 | Ga0068860_100099911 | 3300005843 | Bacteria | 2768 |
| 93 | Ga0068862_100013191 | 3300005844 | Bacteria | 6835 |
| 94 | Ga0081455_10006431 | 3300005937 | Bacteria | 12592 |
| 95 | Ga0081538_10054631 | 3300005981 | Bacteria | 2360 |
| 96 | Ga0081539_10001863 | 3300005985 | Bacteria | 33168 |
| 97 | Ga0075364_10002138 | 3300006051 | Bacteria | 11061 |
| 98 | Ga0075364_10031646 | 3300006051 | Bacteria | 3399 |
| 99 | Ga0097621_100001432 | 3300006237 | Bacteria | 16367 |
| 100 | Ga0097621_100005388 | 3300006237 | Bacteria | 9017 |
| 101 | Ga0068871_100001506 | 3300006358 | Bacteria | 15616 |
| 102 | Ga0068871_100001528 | 3300006358 | Bacteria | 15507 |
| 103 | Ga0068871_100154129 | 3300006358 | Bacteria | 1961 |
| 104 | Ga0075428_100002230 | 3300006844 | Bacteria | 20981 |
| 105 | Ga0075428_100173639 | 3300006844 | Bacteria | 2335 |
| 106 | Ga0075430_100013776 | 3300006846 | Bacteria | 6889 |
| 107 | Ga0075430_100024254 | 3300006846 | Bacteria | 5161 |
| 108 | Ga0075430_100114290 | 3300006846 | Bacteria | 2249 |
| 109 | Ga0075431_100006205 | 3300006847 | Bacteria | 11867 |
| 110 | Ga0075431_100198555 | 3300006847 | Bacteria | 2053 |
| 111 | Ga0075433_10001672 | 3300006852 | Bacteria | 16524 |
| 112 | Ga0075433_10199199 | 3300006852 | Bacteria | 1781 |
| 113 | Ga0075434_100000002 | 3300006871 | Bacteria | 135661 |
| 114 | Ga0075434_100007238 | 3300006871 | Bacteria | 10270 |
| 115 | Ga0075434_100016362 | 3300006871 | Bacteria | 7129 |
| 116 | Ga0075434_100631694 | 3300006871 | Bacteria | 1089 |
| 117 | Ga0075429_100000150 | 3300006880 | Bacteria | 43105 |
| 118 | Ga0068865_100000276 | 3300006881 | Bacteria | 28251 |
| 119 | Ga0068865_100003876 | 3300006881 | Bacteria | 8972 |
| 120 | Ga0075436_100000603 | 3300006914 | Bacteria | 23562 |
| 121 | Ga0075436_100001674 | 3300006914 | Bacteria | 15155 |
| 122 | Ga0075436_100004083 | 3300006914 | Bacteria | 10016 |
| 123 | Ga0075436_100016677 | 3300006914 | Bacteria | 5028 |
| 124 | Ga0075436_100026284 | 3300006914 | Bacteria | 4008 |
| 125 | Ga0075436_100053577 | 3300006914 | Bacteria | 2785 |
| 126 | Ga0075436_100083408 | 3300006914 | Bacteria | 2217 |
| 127 | Ga0097620_100000906 | 3300006931 | Bacteria | 30276 |
| 128 | Ga0097620_100116483 | 3300006931 | Bacteria | 2737 |
| 129 | Ga0097620_100192205 | 3300006931 | Bacteria | 2125 |
| 130 | Ga0075435_100000089 | 3300007076 | Bacteria | 48555 |
| 131 | Ga0075435_100010608 | 3300007076 | Bacteria | 6743 |
| 132 | Ga0099794_10078305 | 3300007265 | Bacteria | 1627 |
| 133 | Ga0099794_10092931 | 3300007265 | Bacteria | 1499 |
| 134 | Ga0111539_10013589 | 3300009094 | Bacteria | 10178 |
| 135 | Ga0111539_10130762 | 3300009094 | Bacteria | 2940 |
| 136 | Ga0105245_10000221 | 3300009098 | Bacteria | 54253 |
| 137 | Ga0105245_10090380 | 3300009098 | Bacteria | 2816 |
| 138 | Ga0105245_10136158 | 3300009098 | Bacteria | 2308 |
| 139 | Ga0105247_10059608 | 3300009101 | Bacteria | 2363 |
| 140 | Ga0114129_10003624 | 3300009147 | Bacteria | 21726 |
| 141 | Ga0114129_10028894 | 3300009147 | Bacteria | 7856 |
| 142 | Ga0114129_10714052 | 3300009147 | Bacteria | 1287 |
| 143 | Ga0114129_10888562 | 3300009147 | Bacteria | 1130 |
| 144 | Ga0105243_10000288 | 3300009148 | Bacteria | 55680 |
| 145 | Ga0105243_10012184 | 3300009148 | Bacteria | 6502 |
| 146 | Ga0105241_10039260 | 3300009174 | Bacteria | 3570 |
| 147 | Ga0105242_10001306 | 3300009176 | Bacteria | 19723 |
| 148 | Ga0105248_10459174 | 3300009177 | Bacteria | 1436 |
| 149 | Ga0105238_10120296 | 3300009551 | Bacteria | 2605 |
| 150 | Ga0105249_10001638 | 3300009553 | Bacteria | 19611 |
| 151 | Ga0105239_10281374 | 3300010375 | Bacteria | 1873 |
| 152 | Ga0157371_10087470 | 3300013102 | Bacteria | 2207 |
| 153 | Ga0157371_10120043 | 3300013102 | Bacteria | 1869 |
| 154 | Ga0157378_10010643 | 3300013297 | Bacteria | 8038 |
| 155 | Ga0163162_10162512 | 3300013306 | Bacteria | 2355 |
| 156 | Ga0163162_10443289 | 3300013306 | Bacteria | 1431 |
| 157 | Ga0157372_10124018 | 3300013307 | Bacteria | 2970 |
| 158 | Ga0157375_10064022 | 3300013308 | Bacteria | 3660 |
| 159 | Ga0157380_10107610 | 3300014326 | Bacteria | 2336 |
| 160 | Ga0182008_10000904 | 3300014497 | Bacteria | 20630 |
| 161 | Ga0157376_10001746 | 3300014969 | Bacteria | 14461 |
| 162 | Ga0157376_10436625 | 3300014969 | Bacteria | 1274 |
| 163 | Ga0213876_10075294 | 3300021384 | Bacteria | 1783 |
| 164 | Ga0209258_102610 | 3300025242 | Bacteria | 4498 |
| 165 | Ga0209455_1000596 | 3300025272 | Bacteria | 23241 |
| 166 | Ga0209676_1014552 | 3300025292 | Bacteria | 2952 |
| 167 | Ga0209025_1000039 | 3300025294 | Bacteria | 377396 |
| 168 | Ga0209050_1000904 | 3300025298 | Bacteria | 39210 |
| 169 | Ga0209051_1000298 | 3300025303 | Bacteria | 78777 |
| 170 | Ga0209051_1042417 | 3300025303 | Bacteria | 1608 |
| 171 | Ga0207642_10000528 | 3300025899 | Bacteria | 11712 |
| 172 | Ga0207642_10031133 | 3300025899 | Bacteria | 2231 |
| 173 | Ga0207647_10023637 | 3300025904 | Bacteria | 4062 |
| 174 | Ga0207647_10076420 | 3300025904 | Bacteria | 2014 |
| 175 | Ga0207645_10102625 | 3300025907 | Bacteria | 1846 |
| 176 | Ga0207643_10147756 | 3300025908 | Bacteria | 1407 |
| 177 | Ga0207707_10003043 | 3300025912 | Bacteria | 14898 |
| 178 | Ga0207707_10248103 | 3300025912 | Bacteria | 1547 |
| 179 | Ga0207695_10210929 | 3300025913 | Bacteria | 1853 |
| 180 | Ga0207671_10169483 | 3300025914 | Bacteria | 1695 |
| 181 | Ga0207660_10000702 | 3300025917 | Bacteria | 22321 |
| 182 | Ga0207662_10000147 | 3300025918 | Bacteria | 33968 |
| 183 | Ga0207662_10140377 | 3300025918 | Bacteria | 1530 |
| 184 | Ga0207657_10083678 | 3300025919 | Bacteria | 2676 |
| 185 | Ga0207652_10004183 | 3300025921 | Bacteria | 11770 |
| 186 | Ga0207652_10272803 | 3300025921 | Bacteria | 1526 |
| 187 | Ga0207646_10262636 | 3300025922 | Bacteria | 1560 |
| 188 | Ga0207646_10339755 | 3300025922 | Bacteria | 1357 |
| 189 | Ga0207687_10000574 | 3300025927 | Bacteria | 24851 |
| 190 | Ga0207706_10136762 | 3300025933 | Bacteria | 2155 |
| 191 | Ga0207686_10000769 | 3300025934 | Bacteria | 19713 |
| 192 | Ga0207709_10000618 | 3300025935 | Bacteria | 29187 |
| 193 | Ga0207709_10001207 | 3300025935 | Bacteria | 18567 |
| 194 | Ga0207670_10001822 | 3300025936 | Bacteria | 11118 |
| 195 | Ga0207670_10077969 | 3300025936 | Bacteria | 2310 |
| 196 | Ga0207669_10246608 | 3300025937 | Bacteria | 1327 |
| 197 | Ga0207704_10021117 | 3300025938 | Bacteria | 3460 |
| 198 | Ga0207665_10113969 | 3300025939 | Bacteria | 1903 |
| 199 | Ga0207711_10022078 | 3300025941 | Bacteria | 5320 |
| 200 | Ga0207711_10265098 | 3300025941 | Bacteria | 1580 |
| 201 | Ga0207711_10374355 | 3300025941 | Bacteria | 1321 |
| 202 | Ga0207689_10002968 | 3300025942 | Bacteria | 15655 |
| 203 | Ga0207689_10011395 | 3300025942 | Bacteria | 7619 |
| 204 | Ga0207689_10032534 | 3300025942 | Bacteria | 4338 |
| 205 | Ga0207661_10388722 | 3300025944 | Bacteria | 1263 |
| 206 | Ga0207667_10023997 | 3300025949 | Bacteria | 6708 |
| 207 | Ga0207667_10084574 | 3300025949 | Bacteria | 3284 |
| 208 | Ga0207712_10004541 | 3300025961 | Bacteria | 8759 |
| 209 | Ga0207668_10018884 | 3300025972 | Bacteria | 4346 |
| 210 | Ga0207640_10168022 | 3300025981 | Bacteria | 1631 |
| 211 | Ga0207658_10124743 | 3300025986 | Bacteria | 2059 |
| 212 | Ga0207677_10001629 | 3300026023 | Bacteria | 11918 |
| 213 | Ga0207677_10296601 | 3300026023 | Bacteria | 1334 |
| 214 | Ga0207703_10005322 | 3300026035 | Bacteria | 10366 |
| 215 | Ga0207639_10044923 | 3300026041 | Bacteria | 3325 |
| 216 | Ga0207639_10085964 | 3300026041 | Bacteria | 2503 |
| 217 | Ga0207708_10005166 | 3300026075 | Bacteria | 9627 |
| 218 | Ga0207702_10034743 | 3300026078 | Bacteria | 4217 |
| 219 | Ga0207702_10210539 | 3300026078 | Bacteria | 1807 |
| 220 | Ga0207641_10064491 | 3300026088 | Bacteria | 3131 |
| 221 | Ga0207648_10000362 | 3300026089 | Bacteria | 50094 |
| 222 | Ga0207648_10001117 | 3300026089 | Bacteria | 30142 |
| 223 | Ga0207676_10045719 | 3300026095 | Bacteria | 3384 |
| 224 | Ga0207676_10173238 | 3300026095 | Bacteria | 1882 |
| 225 | Ga0207674_10100541 | 3300026116 | Bacteria | 2873 |
| 226 | Ga0207674_10285951 | 3300026116 | Bacteria | 1597 |
| 227 | Ga0207675_100000880 | 3300026118 | Bacteria | 29964 |
| 228 | Ga0207698_10035418 | 3300026142 | Bacteria | 3651 |
| 229 | Ga0209967_1001323 | 3300027364 | Bacteria | 3173 |
| 230 | Ga0209967_1001973 | 3300027364 | Bacteria | 2644 |
| 231 | Ga0209996_1001443 | 3300027395 | Bacteria | 2870 |
| 232 | Ga0209996_1004511 | 3300027395 | Bacteria | 1767 |
| 233 | Ga0209968_1003523 | 3300027526 | Bacteria | 2348 |
| 234 | Ga0209999_1002842 | 3300027543 | Bacteria | 3069 |
| 235 | Ga0209983_1006167 | 3300027665 | Bacteria | 2469 |
| 236 | Ga0209971_1003725 | 3300027682 | Bacteria | 3606 |
| 237 | Ga0209998_10030928 | 3300027717 | Bacteria | 1185 |
| 238 | Ga0207428_10002058 | 3300027907 | Bacteria | 20297 |
| 239 | Ga0207428_10019470 | 3300027907 | Bacteria | 5786 |
| 240 | Ga0207428_10058881 | 3300027907 | Bacteria | 3047 |
| 241 | Ga0268265_10000457 | 3300028380 | Bacteria | 43208 |
| 242 | Ga0268264_10001149 | 3300028381 | Bacteria | 25798 |
| 243 | Ga0265334_10017155 | 3300028573 | Bacteria | 2995 |
| 244 | Ga0265327_10013184 | 3300031251 | Bacteria | 5506 |
| 245 | Ga0316575_10004408 | 3300031665 | Bacteria | 4952 |
| 246 | Ga0316575_10006319 | 3300031665 | Bacteria | 4253 |
| 247 | Ga0307410_10081913 | 3300031852 | Bacteria | 2269 |
| 248 | Ga0307412_10000106 | 3300031911 | Bacteria | 67067 |
| 249 | Ga0307416_100330189 | 3300032002 | Bacteria | 1532 |
| 250 | Ga0307411_10175380 | 3300032005 | Bacteria | 1621 |
| 251 | Ga0373934_0000470 | 3300035086 | Bacteria | 14084 |
| 252 | Ga0373952_0020941 | 3300035092 | Bacteria | 1376 |
| 253 | Ga0373923_0011957 | 3300035111 | Bacteria | 3197 |
| 254 | Ga0373932_0027097 | 3300035112 | Bacteria | 1564 |
| 255 | Ga0373936_0005039 | 3300035113 | Bacteria | 4972 |
| 256 | Ga0373939_0082513 | 3300035114 | Bacteria | 1070 |
| 257 | Ga0373941_0002999 | 3300035115 | Bacteria | 3778 |
| 258 | Ga0373953_0001538 | 3300035117 | Bacteria | 6704 |
| 259 | Ga0373953_0007451 | 3300035117 | Bacteria | 3665 |
| 260 | Ga0373954_0000052 | 3300035118 | Bacteria | 41421 |
| 261 | Ga0373954_0000859 | 3300035118 | Bacteria | 11813 |
| 262 | Ga0373954_0001173 | 3300035118 | Bacteria | 10539 |
| 263 | Ga0373954_0007034 | 3300035118 | Bacteria | 4908 |
| 264 | Ga0373956_0000019 | 3300035119 | Bacteria | 50599 |
| 265 | Ga0373956_0002840 | 3300035119 | Bacteria | 7009 |
| 266 | Ga0373957_0000663 | 3300035120 | Bacteria | 8856 |
| 267 | Ga0373957_0002859 | 3300035120 | Bacteria | 4992 |
| 268 | Ga0373957_0083000 | 3300035120 | Bacteria | 1267 |
| 269 | Ga0373960_0017610 | 3300035121 | Bacteria | 1853 |
| 270 | Ga0373960_0031304 | 3300035121 | Bacteria | 1487 |
| 271 | Ga0373946_0015737 | 3300035171 | Bacteria | 2873 |
| 272 | Ga0373955_0005056 | 3300035172 | Bacteria | 5899 |
| 273 | Ga0373955_0023387 | 3300035172 | Bacteria | 3146 |
| 274 | Ga0373955_0054462 | 3300035172 | Bacteria | 2188 |
| 275 | Ga0373942_0008774 | 3300035207 | Bacteria | 2362 |
| 276 | Ga0373961_0013889 | 3300035241 | Bacteria | 2037 |
| 277 | Ga0373962_0026850 | 3300035242 | Bacteria | 1554 |
| 278 | Ga0316574_0011680 | 3300035398 | Bacteria | 5000 |
| 279 | Ga0316574_0222548 | 3300035398 | Bacteria | 1209 |
| 280 | Ga0373924_0000716 | 3300035410 | Bacteria | 10350 |
| 281 | Ga0373931_0000307 | 3300035691 | Bacteria | 20644 |
| 282 | Ga0373935_0017278 | 3300035692 | Bacteria | 4374 |
| 283 | Ga0373927_0120036 | 3300035695 | Bacteria | 1716 |
| 284 | Ga0373933_0012962 | 3300035724 | Bacteria | 4611 |
| 285 | Ga0373933_0019539 | 3300035724 | Bacteria | 3827 |
| 286 | Ga0373947_0028426 | 3300035725 | Bacteria | 3278 |
| 287 | Ga0373937_0000645 | 3300036401 | Bacteria | 30604 |
| 288 | Ga0373937_0000781 | 3300036401 | Bacteria | 27352 |
| 289 | Ga0373937_0093304 | 3300036401 | Bacteria | 2791 |
| 290 | Ga0373937_0174297 | 3300036401 | Bacteria | 2018 |
| 291 | Ga0373925_0056004 | 3300037068 | Bacteria | 2952 |
| 292 | Ga0395899_0090907 | 3300037312 | Bacteria | 2213 |
| 293 | Ga0395900_0001711 | 3300037418 | Bacteria | 25377 |
| 294 | Ga0395900_0004673 | 3300037418 | Bacteria | 14438 |
| 295 | Ga0395900_0004688 | 3300037418 | Bacteria | 14414 |
| 296 | Ga0395900_0005230 | 3300037418 | Bacteria | 13619 |
| 297 | Ga0395900_0119411 | 3300037418 | Bacteria | 2706 |
| 298 | Ga0395898_0004767 | 3300037466 | Bacteria | 14763 |
| 299 | Ga0395905_0000844 | 3300037471 | Bacteria | 40009 |
| 300 | Ga0395905_0255852 | 3300037471 | Bacteria | 1635 |
| 301 | Ga0395901_0010625 | 3300038443 | Bacteria | 9328 |
| 302 | Ga0395901_0032520 | 3300038443 | Bacteria | 5381 |
| 303 | Ga0395901_0206101 | 3300038443 | Bacteria | 2060 |
| 304 | Ga0451855_0606830 | 3300041511 | Bacteria | 1840 |
| 305 | Ga0439441_000508 | 3300042001 | Bacteria | 4260 |
| 306 | Ga0439435_0017748 | 3300042436 | Bacteria | 1803 |
| 307 | Ga0439460_0000008 | 3300042461 | Bacteria | 30223 |
| 308 | Ga0451577_0002438 | 3300042876 | Bacteria | 22187 |
| 309 | Ga0451577_0005329 | 3300042876 | Bacteria | 13213 |
| 310 | Ga0451577_0120917 | 3300042876 | Bacteria | 2345 |
| 311 | Ga0453684_0198717 | 3300044712 | Bacteria | 2339 |
| 312 | Ga0453684_0397811 | 3300044712 | Bacteria | 1543 |
| 313 | Ga0451576_0001013 | 3300045051 | Bacteria | 51916 |
| 314 | Ga0451576_0002279 | 3300045051 | Bacteria | 29284 |
| 315 | Ga0451576_0016576 | 3300045051 | Bacteria | 8126 |
| 316 | Ga0466967_0011832 | 3300045976 | Bacteria | 6637 |
| 317 | Ga0495627_004706 | 3300046453 | Bacteria | 5643 |
| 318 | Ga0495592_0005407 | 3300046454 | Bacteria | 9427 |
| 319 | Ga0495592_0016262 | 3300046454 | Bacteria | 5645 |
| 320 | Ga0495592_0019515 | 3300046454 | Bacteria | 5156 |
| 321 | Ga0495592_0022559 | 3300046454 | Bacteria | 4789 |
| 322 | Ga0495603_0056677 | 3300046455 | Bacteria | 2319 |
| 323 | Ga0495603_0130308 | 3300046455 | Bacteria | 1465 |
| 324 | Ga0495590_0000038 | 3300046457 | Bacteria | 127040 |
| 325 | Ga0495590_0003424 | 3300046457 | Bacteria | 6478 |
| 326 | Ga0495591_000214 | 3300046458 | Bacteria | 58417 |
| 327 | Ga0495651_0010533 | 3300046462 | Bacteria | 7106 |
| 328 | Ga0495651_0064189 | 3300046462 | Bacteria | 2806 |
| 329 | Ga0495653_0012139 | 3300046463 | Bacteria | 7029 |
| 330 | Ga0495653_0125599 | 3300046463 | Bacteria | 1822 |
| 331 | Ga0495580_0084661 | 3300046472 | Bacteria | 2208 |
| 332 | Ga0495639_0001353 | 3300046475 | Bacteria | 11001 |
| 333 | Ga0495639_0050190 | 3300046475 | Bacteria | 1895 |
| 334 | Ga0495662_0000837 | 3300046476 | Bacteria | 14929 |
| 335 | Ga0495664_0010041 | 3300046477 | Bacteria | 5309 |
| 336 | Ga0495584_0000429 | 3300046491 | Bacteria | 28957 |
| 337 | Ga0495584_0001438 | 3300046491 | Bacteria | 14342 |
| 338 | Ga0495585_0003308 | 3300046492 | Bacteria | 10942 |
| 339 | Ga0495585_0007112 | 3300046492 | Bacteria | 6876 |
| 340 | Ga0495594_0001543 | 3300046499 | Bacteria | 11956 |
| 341 | Ga0495594_0033176 | 3300046499 | Bacteria | 2805 |
| 342 | Ga0495596_0000918 | 3300046500 | Bacteria | 17539 |
| 343 | Ga0495596_0025563 | 3300046500 | Bacteria | 2386 |
| 344 | Ga0495596_0026937 | 3300046500 | Bacteria | 2314 |
| 345 | Ga0495607_0000009 | 3300046501 | Bacteria | 216674 |
| 346 | Ga0495607_0002073 | 3300046501 | Bacteria | 16741 |
| 347 | Ga0495583_0006913 | 3300046506 | Bacteria | 7294 |
| 348 | Ga0495606_0024408 | 3300046507 | Bacteria | 4357 |
| 349 | Ga0495608_0000439 | 3300046511 | Bacteria | 29042 |
| 350 | Ga0495608_0019614 | 3300046511 | Bacteria | 4652 |
| 351 | Ga0495608_0070876 | 3300046511 | Bacteria | 2275 |
| 352 | Ga0495610_0000481 | 3300046512 | Bacteria | 41196 |
| 353 | Ga0495616_0022574 | 3300046513 | Bacteria | 3398 |
| 354 | Ga0495616_0058908 | 3300046513 | Bacteria | 1890 |
| 355 | Ga0495618_0003523 | 3300046514 | Bacteria | 9723 |
| 356 | Ga0495618_0005327 | 3300046514 | Bacteria | 7850 |
| 357 | Ga0495628_0000681 | 3300046516 | Bacteria | 31276 |
| 358 | Ga0495628_0001953 | 3300046516 | Bacteria | 18701 |
| 359 | Ga0495628_0014895 | 3300046516 | Bacteria | 6502 |
| 360 | Ga0495628_0017207 | 3300046516 | Bacteria | 6021 |
| 361 | Ga0495630_0003806 | 3300046517 | Bacteria | 10526 |
| 362 | Ga0495630_0133784 | 3300046517 | Bacteria | 1884 |
| 363 | Ga0495630_0202332 | 3300046517 | Bacteria | 1515 |
| 364 | Ga0495631_0000290 | 3300046518 | Bacteria | 35042 |
| 365 | Ga0495631_0001484 | 3300046518 | Bacteria | 14221 |
| 366 | Ga0495632_0000403 | 3300046519 | Bacteria | 40753 |
| 367 | Ga0495637_0000003 | 3300046520 | Bacteria | 623293 |
| 368 | Ga0495643_0034379 | 3300046522 | Bacteria | 2798 |
| 369 | Ga0495644_0005654 | 3300046523 | Bacteria | 4876 |
| 370 | Ga0495644_0023665 | 3300046523 | Bacteria | 2338 |
| 371 | Ga0495644_0044660 | 3300046523 | Bacteria | 1667 |
| 372 | Ga0495648_0124826 | 3300046524 | Bacteria | 1377 |
| 373 | Ga0495666_0008954 | 3300046526 | Bacteria | 5010 |
| 374 | Ga0495666_0025688 | 3300046526 | Bacteria | 2908 |
| 375 | Ga0495642_0002404 | 3300046528 | Bacteria | 7621 |
| 376 | Ga0495642_0005355 | 3300046528 | Bacteria | 4922 |
| 377 | Ga0495642_0048624 | 3300046528 | Bacteria | 1740 |
| 378 | Ga0495652_0002007 | 3300046529 | Bacteria | 21698 |
| 379 | Ga0495640_0003703 | 3300046533 | Bacteria | 12278 |
| 380 | Ga0495640_0045620 | 3300046533 | Bacteria | 3040 |
| 381 | Ga0495586_0000894 | 3300046535 | Bacteria | 17010 |
| 382 | Ga0495586_0016421 | 3300046535 | Bacteria | 3937 |
| 383 | Ga0495586_0033127 | 3300046535 | Bacteria | 2772 |
| 384 | Ga0495587_0006531 | 3300046536 | Bacteria | 7599 |
| 385 | Ga0495587_0017253 | 3300046536 | Bacteria | 4487 |
| 386 | Ga0495587_0060017 | 3300046536 | Bacteria | 2231 |
| 387 | Ga0495587_0175258 | 3300046536 | Bacteria | 1217 |
| 388 | Ga0495598_0009521 | 3300046537 | Bacteria | 2300 |
| 389 | Ga0495597_0000349 | 3300046542 | Bacteria | 41320 |
| 390 | Ga0495645_0000366 | 3300046543 | Bacteria | 31440 |
| 391 | Ga0495633_0003404 | 3300046558 | Bacteria | 10620 |
| 392 | Ga0495667_0000661 | 3300046559 | Bacteria | 22019 |
| 393 | Ga0495667_0016446 | 3300046559 | Bacteria | 4997 |
| 394 | Ga0495656_0087622 | 3300046615 | Bacteria | 1418 |
| 395 | Ga0495668_0000359 | 3300046616 | Bacteria | 60366 |
| 396 | Ga0495668_0000699 | 3300046616 | Bacteria | 40382 |
| 397 | Ga0495668_0019173 | 3300046616 | Bacteria | 3947 |
| 398 | Ga0495634_0001760 | 3300046642 | Bacteria | 18738 |
| 399 | Ga0495634_0023506 | 3300046642 | Bacteria | 4330 |
| 400 | Ga0495611_0000317 | 3300046648 | Bacteria | 32281 |
| 401 | Ga0495611_0012445 | 3300046648 | Bacteria | 3617 |
| 402 | Ga0495635_0008699 | 3300046663 | Bacteria | 7090 |
| 403 | Ga0495635_0174272 | 3300046663 | Bacteria | 1462 |
| 404 | Ga0495659_0044460 | 3300046664 | Bacteria | 1597 |
| 405 | Ga0495661_0000819 | 3300046665 | Bacteria | 29159 |
| 406 | Ga0495661_0001210 | 3300046665 | Bacteria | 22396 |
| 407 | Ga0495657_0007439 | 3300046675 | Bacteria | 8459 |
| 408 | Ga0495599_0001911 | 3300046678 | Bacteria | 12058 |
| 409 | Ga0495599_0043119 | 3300046678 | Bacteria | 2831 |
| 410 | Ga0495647_0006405 | 3300046681 | Bacteria | 3895 |
| 411 | Ga0495647_0006529 | 3300046681 | Bacteria | 3869 |
| 412 | Ga0495658_0007805 | 3300046683 | Bacteria | 5297 |
| 413 | Ga0495669_0001079 | 3300046684 | Bacteria | 11311 |
| 414 | Ga0495669_0011974 | 3300046684 | Bacteria | 3688 |
| 415 | Ga0495669_0099213 | 3300046684 | Bacteria | 1351 |
| 416 | Ga0495613_0007324 | 3300046689 | Bacteria | 8216 |
| 417 | Ga0495613_0031960 | 3300046689 | Bacteria | 3909 |
| 418 | Ga0495670_0051251 | 3300046691 | Bacteria | 2065 |
| 419 | Ga0495671_0002860 | 3300046692 | Bacteria | 10800 |
| 420 | Ga0495649_0025663 | 3300046694 | Bacteria | 3281 |
| 421 | Ga0495600_0028496 | 3300046809 | Bacteria | 3613 |
| 422 | Ga0495600_0047634 | 3300046809 | Bacteria | 2796 |
| 423 | Ga0495660_0008267 | 3300046810 | Bacteria | 6095 |
| 424 | Ga0495660_0013180 | 3300046810 | Bacteria | 4790 |
| 425 | Ga0495660_0053281 | 3300046810 | Bacteria | 2196 |
| 426 | Ga0495604_0018005 | 3300047317 | Bacteria | 5654 |
| 427 | Ga0495604_0188260 | 3300047317 | Bacteria | 1440 |
| 428 | Ga0495636_0036912 | 3300047318 | Bacteria | 2017 |
| 429 | Ga0495674_0005349 | 3300047319 | Bacteria | 12320 |
| 430 | Ga0495672_0000613 | 3300047320 | Bacteria | 39882 |
| 431 | Ga0495676_0007493 | 3300047321 | Bacteria | 10009 |
| 432 | Ga0495680_0002911 | 3300047322 | Bacteria | 17205 |
| 433 | Ga0495680_0027038 | 3300047322 | Bacteria | 4720 |
| 434 | Ga0495680_0035899 | 3300047322 | Bacteria | 3986 |
| 435 | Ga0495680_0040245 | 3300047322 | Bacteria | 3725 |
| 436 | Ga0495675_0027617 | 3300047444 | Bacteria | 3616 |
| 437 | Ga0495677_0000156 | 3300047445 | Bacteria | 32695 |
| 438 | Ga0495679_001947 | 3300047446 | Bacteria | 11028 |
| 439 | Ga0495679_013232 | 3300047446 | Bacteria | 3106 |
| 440 | Ga0495685_036197 | 3300047447 | Bacteria | 1694 |
| 441 | Ga0495681_0001507 | 3300047470 | Bacteria | 17394 |
| 442 | Ga0495681_0023570 | 3300047470 | Bacteria | 3266 |
| 443 | Ga0495684_0022750 | 3300047471 | Bacteria | 4820 |
| 444 | Ga0495684_0107191 | 3300047471 | Bacteria | 2110 |
| 445 | Ga0495686_0000381 | 3300047472 | Bacteria | 70993 |
| 446 | Ga0495686_0000846 | 3300047472 | Bacteria | 39307 |
| 447 | Ga0495686_0011458 | 3300047472 | Bacteria | 6244 |
| 448 | Ga0495626_0006746 | 3300048091 | Bacteria | 6493 |
| 449 | Ga0495626_0035635 | 3300048091 | Bacteria | 2374 |
| 450 | Ga0495626_0061992 | 3300048091 | Bacteria | 1699 |
| 451 | Ga0495626_0070416 | 3300048091 | Bacteria | 1573 |
| 452 | Ga0496100_0130637 | 3300048903 | Bacteria | 1768 |
| 453 | Ga0496101_0192711 | 3300048904 | Bacteria | 1573 |
| 454 | Ga0496105_0072416 | 3300048908 | Bacteria | 2848 |
| 455 | Ga0496109_0063874 | 3300048912 | Bacteria | 3367 |
| 456 | Ga0496113_0003150 | 3300048916 | Bacteria | 9819 |
| 457 | Ga0496118_0022065 | 3300048921 | Bacteria | 5581 |
| 458 | Ga0496118_0040114 | 3300048921 | Bacteria | 3726 |
| 459 | Ga0496119_0005661 | 3300048922 | Bacteria | 11855 |
| 460 | Ga0496120_0003037 | 3300048923 | Bacteria | 15840 |
| 461 | Ga0496121_0000165 | 3300048924 | Bacteria | 145052 |
| 462 | Ga0496121_0027758 | 3300048924 | Bacteria | 5289 |
| 463 | Ga0496123_0000966 | 3300048926 | Bacteria | 44396 |
| 464 | Ga0496124_0000007 | 3300048927 | Bacteria | 883534 |
| 465 | Ga0496125_0000121 | 3300048928 | Bacteria | 174971 |
| 466 | Ga0496125_0003065 | 3300048928 | Bacteria | 20867 |
| 467 | Ga0496125_0029029 | 3300048928 | Bacteria | 4980 |
| 468 | Ga0495678_000652 | 3300049459 | Bacteria | 31953 |
| 469 | Ga0495678_001446 | 3300049459 | Bacteria | 18703 |
| 470 | Ga0495682_0005681 | 3300049460 | Bacteria | 5151 |
| 471 | Ga0501031_0014068 | 3300049568 | Bacteria | 5206 |
| 472 | Ga0501032_0056266 | 3300049569 | Bacteria | 2644 |
| 473 | Ga0501033_0000919 | 3300049570 | Bacteria | 26915 |
| 474 | Ga0501033_0008890 | 3300049570 | Bacteria | 7759 |
| 475 | Ga0501033_0050339 | 3300049570 | Bacteria | 3091 |
| 476 | Ga0501034_0015074 | 3300049571 | Bacteria | 7947 |
| 477 | Ga0501034_0299001 | 3300049571 | Bacteria | 1546 |
| 478 | Ga0501036_0000418 | 3300049572 | Bacteria | 29982 |
| 479 | Ga0501036_0000974 | 3300049572 | Bacteria | 21624 |
| 480 | Ga0501037_0002535 | 3300049573 | Bacteria | 13194 |
| 481 | Ga0501037_0015192 | 3300049573 | Bacteria | 5665 |
| 482 | Ga0501038_0000189 | 3300049574 | Bacteria | 53371 |
| 483 | Ga0501038_0001437 | 3300049574 | Bacteria | 21855 |
| 484 | Ga0501038_0043569 | 3300049574 | Bacteria | 3902 |
| 485 | Ga0501038_0058153 | 3300049574 | Bacteria | 3316 |
| 486 | Ga0501039_0000247 | 3300049575 | Bacteria | 39539 |
| 487 | Ga0501039_0001909 | 3300049575 | Bacteria | 15432 |
| 488 | Ga0501040_0017391 | 3300049576 | Bacteria | 4772 |
| 489 | Ga0501040_0029406 | 3300049576 | Bacteria | 3708 |
| 490 | Ga0501040_0040415 | 3300049576 | Bacteria | 3174 |
| 491 | Ga0501040_0066095 | 3300049576 | Bacteria | 2491 |
| 492 | Ga0501041_0000032 | 3300049577 | Bacteria | 44999 |
| 493 | Ga0501041_0048172 | 3300049577 | Bacteria | 2595 |
| 494 | Ga0501043_0000727 | 3300049579 | Bacteria | 29186 |
| 495 | Ga0501043_0114295 | 3300049579 | Bacteria | 2119 |
| 496 | Ga0501046_0000156 | 3300049580 | Bacteria | 70512 |
| 497 | Ga0501046_0001315 | 3300049580 | Bacteria | 24072 |
| 498 | Ga0501046_0025304 | 3300049580 | Bacteria | 4859 |
| 499 | Ga0501046_0123646 | 3300049580 | Bacteria | 1967 |
| 500 | Ga0501046_0140667 | 3300049580 | Bacteria | 1826 |
| 501 | Ga0501047_0003680 | 3300049581 | Bacteria | 14449 |
| 502 | Ga0501047_0130282 | 3300049581 | Bacteria | 2396 |
| 503 | Ga0501067_0038157 | 3300049583 | Bacteria | 2668 |
| 504 | Ga0501070_0016624 | 3300049586 | Bacteria | 6181 |
| 505 | Ga0501071_0004130 | 3300049587 | Bacteria | 9179 |
| 506 | Ga0501071_0009047 | 3300049587 | Bacteria | 6612 |
| 507 | Ga0501071_0023569 | 3300049587 | Bacteria | 4299 |
| 508 | Ga0501072_0002789 | 3300049588 | Bacteria | 13112 |
| 509 | Ga0501072_0033056 | 3300049588 | Bacteria | 4052 |
| 510 | Ga0501075_0000053 | 3300049591 | Bacteria | 49110 |
| 511 | Ga0501075_0000179 | 3300049591 | Bacteria | 32841 |
| 512 | Ga0501075_0000790 | 3300049591 | Bacteria | 19774 |
| 513 | Ga0501076_0000575 | 3300049592 | Bacteria | 23441 |
| 514 | Ga0501076_0000683 | 3300049592 | Bacteria | 21818 |
| 515 | Ga0501076_0002082 | 3300049592 | Bacteria | 13718 |
| 516 | Ga0501076_0108769 | 3300049592 | Bacteria | 2239 |
| 517 | Ga0501077_0003937 | 3300049593 | Bacteria | 8950 |
| 518 | Ga0501077_0057987 | 3300049593 | Bacteria | 2458 |
| 519 | Ga0501079_0001973 | 3300049741 | Bacteria | 14712 |
| 520 | Ga0501079_0008097 | 3300049741 | Bacteria | 7962 |
| 521 | Ga0501080_0003200 | 3300049742 | Bacteria | 14440 |
| 522 | Ga0501080_0027030 | 3300049742 | Bacteria | 5335 |
| 523 | Ga0501080_0161465 | 3300049742 | Bacteria | 2069 |
| 524 | Ga0501081_0000127 | 3300049743 | Bacteria | 33437 |
| 525 | Ga0501035_0001123 | 3300049822 | Bacteria | 27958 |
| 526 | Ga0501035_0016865 | 3300049822 | Bacteria | 6733 |
| 527 | Ga0501035_0051757 | 3300049822 | Bacteria | 3675 |
| 528 | Ga0501035_0074262 | 3300049822 | Bacteria | 3008 |
| 529 | Ga0501035_0075583 | 3300049822 | Bacteria | 2979 |
| 530 | Ga0501044_0001590 | 3300049823 | Bacteria | 26597 |
| 531 | Ga0501044_0002136 | 3300049823 | Bacteria | 22649 |
| 532 | Ga0501044_0014614 | 3300049823 | Bacteria | 8465 |
| 533 | Ga0501044_0016393 | 3300049823 | Bacteria | 7955 |
| 534 | Ga0501044_0048025 | 3300049823 | Bacteria | 4412 |
| 535 | Ga0501045_0000135 | 3300049824 | Bacteria | 38657 |
| 536 | Ga0501045_0000372 | 3300049824 | Bacteria | 26953 |
| 537 | Ga0501045_0061022 | 3300049824 | Bacteria | 2765 |
| 538 | nmdc:mga00v17_15848_c1 | 3300050491 | Bacteria | 4239 |
| 539 | nmdc:mga00v17_1834_c1 | 3300050491 | Bacteria | 10994 |
| 540 | nmdc:mga00v17_38375_c1 | 3300050491 | Bacteria | 2864 |
| 541 | nmdc:mga05p37_1475_c1 | 3300050507 | Bacteria | 27330 |
| 542 | nmdc:mga05p37_34342_c1 | 3300050507 | Bacteria | 6211 |
| 543 | nmdc:mga09592_49624_c1 | 3300050508 | Bacteria | 3539 |
| 544 | nmdc:mga09592_8451_c1 | 3300050508 | Bacteria | 8371 |
| 545 | nmdc:mga06r32_48118_c1 | 3300050510 | Bacteria | 4076 |
| 546 | nmdc:mga06r32_66161_c1 | 3300050510 | Bacteria | 3487 |
| 547 | nmdc:mga08y16_17429_c1 | 3300050511 | Bacteria | 7563 |
| 548 | nmdc:mga08y16_7366_c1 | 3300050511 | Bacteria | 11540 |
| 549 | nmdc:mga08y16_79454_c1 | 3300050511 | Bacteria | 3419 |
| 550 | nmdc:mga08y16_8395_c1 | 3300050511 | Bacteria | 10808 |
| 551 | nmdc:mga0n895_1409_c1 | 3300050512 | Bacteria | 17946 |
| 552 | nmdc:mga0n895_36967_c1 | 3300050512 | Bacteria | 4720 |
| 553 | nmdc:mga0n895_3845_c1 | 3300050512 | Bacteria | 12188 |
| 554 | nmdc:mga0rr50_128_c1 | 3300050513 | Bacteria | 41482 |
| 555 | nmdc:mga0rr50_268168_c1 | 3300050513 | Bacteria | 1422 |
| 556 | nmdc:mga0rr50_300936_c1 | 3300050513 | Bacteria | 1342 |
| 557 | nmdc:mga0rr50_7448_c1 | 3300050513 | Bacteria | 6753 |
| 558 | nmdc:mga08x19_10877_c1 | 3300050514 | Bacteria | 5472 |
| 559 | nmdc:mga08x19_159004_c1 | 3300050514 | Bacteria | 1534 |
| 560 | nmdc:mga08x19_191358_c1 | 3300050514 | Bacteria | 1400 |
| 561 | nmdc:mga08x19_2600_c1 | 3300050514 | Bacteria | 10959 |
| 562 | nmdc:mga08x19_434_c1 | 3300050514 | Bacteria | 28646 |
| 563 | nmdc:mga08x19_61650_c1 | 3300050514 | Bacteria | 2431 |
| 564 | nmdc:mga08x19_96362_c1 | 3300050514 | Bacteria | 1958 |
| 565 | nmdc:mga0a205_160_c1 | 3300050515 | Bacteria | 44269 |
| 566 | nmdc:mga0a205_24856_c1 | 3300050515 | Bacteria | 5141 |
| 567 | Ga0495601_0001843 | 3300053077 | Bacteria | 11784 |
| 568 | Ga0495601_0220306 | 3300053077 | Bacteria | 1239 |
| 569 | Ga0495612_0049481 | 3300053078 | Bacteria | 1725 |
| 570 | Ga0495595_0048224 | 3300053084 | Bacteria | 1966 |
| 571 | Ga0495619_0013961 | 3300053085 | Bacteria | 5068 |
| 572 | Ga0500634_0037184 | 3300053161 | Bacteria | 2648 |
| 573 | Ga0500645_013205 | 3300053730 | Bacteria | 2656 |
| 574 | Ga0501084_0016187 | 3300054114 | Bacteria | 6193 |
| 575 | Ga0501082_0002807 | 3300060353 | Bacteria | 15203 |
| 576 | Ga0501082_0006238 | 3300060353 | Bacteria | 10350 |
| 577 | Ga0530510_0000115 | 3300061734 | Bacteria | 45273 |
| 578 | Ga0530510_0000160 | 3300061734 | Bacteria | 40364 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035114 | Ga0373939_0082513 | Ga0373939_0082513_11_799 | 253 |
| 2 | 3300005544 | Ga0070686_100287090 | Ga0070686_1002870902 | 254 |
| 3 | 3300046511 | Ga0495608_0070876 | Ga0495608_0070876_1315_2184 | 279 |
| 4 | 3300046810 | Ga0495660_0053281 | Ga0495660_0053281_1206_2177 | 281 |
| 5 | 3300037418 | Ga0395900_0119411 | Ga0395900_0119411_92_1069 | 306 |
| 6 | 3300038443 | Ga0395901_0032520 | Ga0395901_0032520_4014_4991 | 306 |
| 7 | 3300050491 | nmdc:mga00v17_38375_c1 | nmdc:mga00v17_38375_c1_166_1266 | 306 |
| 8 | 3300021384 | Ga0213876_10075294 | Ga0213876_100752942 | 307 |
| 9 | 3300031251 | Ga0265327_10013184 | Ga0265327_100131844 | 307 |
| 10 | 3300046491 | Ga0495584_0000429 | Ga0495584_0000429_11325_12386 | 307 |
| 11 | 3300046648 | Ga0495611_0000317 | Ga0495611_0000317_20772_21833 | 307 |
| 12 | 3300049574 | Ga0501038_0043569 | Ga0501038_0043569_362_1336 | 307 |
| 13 | 3300049575 | Ga0501039_0001909 | Ga0501039_0001909_12062_13036 | 307 |
| 14 | 3300049579 | Ga0501043_0114295 | Ga0501043_0114295_449_1423 | 307 |
| 15 | 3300049580 | Ga0501046_0123646 | Ga0501046_0123646_354_1328 | 307 |
| 16 | 3300049587 | Ga0501071_0023569 | Ga0501071_0023569_470_1444 | 307 |
| 17 | 3300049591 | Ga0501075_0000790 | Ga0501075_0000790_11236_12210 | 307 |
| 18 | 3300049592 | Ga0501076_0002082 | Ga0501076_0002082_11303_12277 | 307 |
| 19 | 3300049592 | Ga0501076_0108769 | Ga0501076_0108769_1204_2178 | 307 |
| 20 | 3300049593 | Ga0501077_0057987 | Ga0501077_0057987_1424_2398 | 307 |
| 21 | 3300049742 | Ga0501080_0003200 | Ga0501080_0003200_10481_11455 | 307 |
| 22 | 3300049824 | Ga0501045_0000135 | Ga0501045_0000135_19644_20618 | 307 |
| 23 | 3300060353 | Ga0501082_0006238 | Ga0501082_0006238_8901_9875 | 307 |
| 24 | iso_pu_bacteria | 2857542790 | 2857543920 | 307 |
| 25 | iso_pu_bacteria | 2895511927 | 2895513901 | 307 |
| 26 | 3300003763 | Ga0055529_1000873 | Ga0055529_100087315 | 308 |
| 27 | 3300025292 | Ga0209676_1014552 | Ga0209676_10145522 | 308 |
| 28 | 3300025298 | Ga0209050_1000904 | Ga0209050_10009048 | 308 |
| 29 | 3300025303 | Ga0209051_1042417 | Ga0209051_10424172 | 308 |
| 30 | 3300035120 | Ga0373957_0083000 | Ga0373957_0083000_11_964 | 308 |
| 31 | 3300046500 | Ga0495596_0025563 | Ga0495596_0025563_1314_2375 | 308 |
| 32 | 3300046810 | Ga0495660_0008267 | Ga0495660_0008267_2242_3303 | 308 |
| 33 | 3300047472 | Ga0495686_0000846 | Ga0495686_0000846_4547_5608 | 308 |
| 34 | 3300048921 | Ga0496118_0040114 | Ga0496118_0040114_791_1912 | 308 |
| 35 | 3300048924 | Ga0496121_0027758 | Ga0496121_0027758_3670_4773 | 308 |
| 36 | 3300048928 | Ga0496125_0029029 | Ga0496125_0029029_1295_2416 | 308 |
| 37 | 3300049460 | Ga0495682_0005681 | Ga0495682_0005681_1747_2808 | 308 |
| 38 | 3300049822 | Ga0501035_0074262 | Ga0501035_0074262_867_1949 | 308 |
| 39 | 3300049823 | Ga0501044_0001590 | Ga0501044_0001590_12624_13703 | 308 |
| 40 | 3300037471 | Ga0395905_0000844 | Ga0395905_0000844_24806_25846 | 309 |
| 41 | 3300046453 | Ga0495627_004706 | Ga0495627_004706_573_1622 | 309 |
| 42 | 3300046457 | Ga0495590_0000038 | Ga0495590_0000038_116130_117191 | 309 |
| 43 | 3300046458 | Ga0495591_000214 | Ga0495591_000214_4518_5579 | 309 |
| 44 | 3300046492 | Ga0495585_0003308 | Ga0495585_0003308_3419_4480 | 309 |
| 45 | 3300046492 | Ga0495585_0007112 | Ga0495585_0007112_3141_4202 | 309 |
| 46 | 3300046500 | Ga0495596_0026937 | Ga0495596_0026937_924_1985 | 309 |
| 47 | 3300046501 | Ga0495607_0002073 | Ga0495607_0002073_12052_13113 | 309 |
| 48 | 3300046512 | Ga0495610_0000481 | Ga0495610_0000481_3757_4818 | 309 |
| 49 | 3300046518 | Ga0495631_0000290 | Ga0495631_0000290_11315_12376 | 309 |
| 50 | 3300046520 | Ga0495637_0000003 | Ga0495637_0000003_564347_565408 | 309 |
| 51 | 3300046523 | Ga0495644_0005654 | Ga0495644_0005654_2022_3083 | 309 |
| 52 | 3300046528 | Ga0495642_0005355 | Ga0495642_0005355_3091_4152 | 309 |
| 53 | 3300046528 | Ga0495642_0048624 | Ga0495642_0048624_471_1532 | 309 |
| 54 | 3300046558 | Ga0495633_0003404 | Ga0495633_0003404_3097_4158 | 309 |
| 55 | 3300046616 | Ga0495668_0019173 | Ga0495668_0019173_667_1728 | 309 |
| 56 | 3300046648 | Ga0495611_0012445 | Ga0495611_0012445_1028_2089 | 309 |
| 57 | 3300046665 | Ga0495661_0001210 | Ga0495661_0001210_3177_4238 | 309 |
| 58 | 3300046684 | Ga0495669_0001079 | Ga0495669_0001079_2585_3646 | 309 |
| 59 | 3300046691 | Ga0495670_0051251 | Ga0495670_0051251_672_1721 | 309 |
| 60 | 3300046810 | Ga0495660_0013180 | Ga0495660_0013180_3254_4315 | 309 |
| 61 | 3300047320 | Ga0495672_0000613 | Ga0495672_0000613_26997_28058 | 309 |
| 62 | 3300047445 | Ga0495677_0000156 | Ga0495677_0000156_22298_23359 | 309 |
| 63 | 3300047446 | Ga0495679_013232 | Ga0495679_013232_1485_2546 | 309 |
| 64 | 3300047470 | Ga0495681_0001507 | Ga0495681_0001507_10257_11312 | 309 |
| 65 | 3300047470 | Ga0495681_0023570 | Ga0495681_0023570_1057_2118 | 309 |
| 66 | 3300047472 | Ga0495686_0011458 | Ga0495686_0011458_1816_2877 | 309 |
| 67 | 3300048091 | Ga0495626_0006746 | Ga0495626_0006746_3177_4238 | 309 |
| 68 | 3300049459 | Ga0495678_000652 | Ga0495678_000652_30867_31928 | 309 |
| 69 | iso_pu_bacteria | 2738541280 | 2738738234 | 309 |
| 70 | iso_pu_bacteria | 2808606418 | 2809146025 | 309 |
| 71 | iso_pu_bacteria | 2904449895 | 2904454322 | 309 |
| 72 | iso_pu_bacteria | 2904456579 | 2904462682 | 309 |
| 73 | iso_pu_bacteria | 2945972063 | 2945977278 | 309 |
| 74 | 3300005262 | Ga0065165_1001794 | Ga0065165_100179413 | 310 |
| 75 | 3300005295 | Ga0065707_10031107 | Ga0065707_100311072 | 310 |
| 76 | 3300005937 | Ga0081455_10006431 | Ga0081455_100064317 | 310 |
| 77 | 3300006051 | Ga0075364_10002138 | Ga0075364_1000213812 | 310 |
| 78 | 3300025941 | Ga0207711_10374355 | Ga0207711_103743551 | 310 |
| 79 | 3300037471 | Ga0395905_0255852 | Ga0395905_0255852_278_1333 | 310 |
| 80 | 3300046457 | Ga0495590_0003424 | Ga0495590_0003424_536_1597 | 310 |
| 81 | 3300046463 | Ga0495653_0125599 | Ga0495653_0125599_289_1356 | 310 |
| 82 | 3300046499 | Ga0495594_0001543 | Ga0495594_0001543_9233_10282 | 310 |
| 83 | 3300046506 | Ga0495583_0006913 | Ga0495583_0006913_3831_4898 | 310 |
| 84 | 3300046507 | Ga0495606_0024408 | Ga0495606_0024408_1795_2850 | 310 |
| 85 | 3300046513 | Ga0495616_0022574 | Ga0495616_0022574_2166_3227 | 310 |
| 86 | 3300046518 | Ga0495631_0001484 | Ga0495631_0001484_9931_10992 | 310 |
| 87 | 3300046523 | Ga0495644_0023665 | Ga0495644_0023665_1068_2117 | 310 |
| 88 | 3300046526 | Ga0495666_0025688 | Ga0495666_0025688_1657_2706 | 310 |
| 89 | 3300046528 | Ga0495642_0002404 | Ga0495642_0002404_5585_6634 | 310 |
| 90 | 3300046536 | Ga0495587_0060017 | Ga0495587_0060017_43_1110 | 310 |
| 91 | 3300046616 | Ga0495668_0000359 | Ga0495668_0000359_35278_36339 | 310 |
| 92 | 3300046665 | Ga0495661_0000819 | Ga0495661_0000819_9971_11026 | 310 |
| 93 | 3300046694 | Ga0495649_0025663 | Ga0495649_0025663_1895_2950 | 310 |
| 94 | 3300047322 | Ga0495680_0035899 | Ga0495680_0035899_808_1863 | 310 |
| 95 | 3300047446 | Ga0495679_001947 | Ga0495679_001947_8890_9951 | 310 |
| 96 | 3300047447 | Ga0495685_036197 | Ga0495685_036197_172_1233 | 310 |
| 97 | 3300048091 | Ga0495626_0035635 | Ga0495626_0035635_1087_2136 | 310 |
| 98 | 3300048903 | Ga0496100_0130637 | Ga0496100_0130637_493_1548 | 310 |
| 99 | 3300048904 | Ga0496101_0192711 | Ga0496101_0192711_477_1532 | 310 |
| 100 | 3300049583 | Ga0501067_0038157 | Ga0501067_0038157_1121_2176 | 310 |
| 101 | iso_pu_bacteria | 2939669807 | 2939672384 | 310 |
| 102 | 3300005330 | Ga0070690_100156202 | Ga0070690_1001562022 | 311 |
| 103 | 3300005440 | Ga0070705_100216425 | Ga0070705_1002164252 | 311 |
| 104 | 3300005444 | Ga0070694_100071945 | Ga0070694_1000719453 | 311 |
| 105 | 3300005458 | Ga0070681_10000135 | Ga0070681_1000013536 | 311 |
| 106 | 3300005468 | Ga0070707_100246947 | Ga0070707_1002469472 | 311 |
| 107 | 3300005518 | Ga0070699_100031058 | Ga0070699_1000310583 | 311 |
| 108 | 3300005536 | Ga0070697_100042484 | Ga0070697_1000424843 | 311 |
| 109 | 3300005536 | Ga0070697_100051073 | Ga0070697_1000510732 | 311 |
| 110 | 3300005545 | Ga0070695_100003131 | Ga0070695_1000031318 | 311 |
| 111 | 3300005546 | Ga0070696_100001158 | Ga0070696_1000011584 | 311 |
| 112 | 3300005549 | Ga0070704_100048851 | Ga0070704_1000488513 | 311 |
| 113 | 3300005841 | Ga0068863_100100760 | Ga0068863_1001007603 | 311 |
| 114 | 3300006846 | Ga0075430_100114290 | Ga0075430_1001142902 | 311 |
| 115 | 3300006847 | Ga0075431_100198555 | Ga0075431_1001985552 | 311 |
| 116 | 3300006871 | Ga0075434_100016362 | Ga0075434_1000163624 | 311 |
| 117 | 3300006914 | Ga0075436_100001674 | Ga0075436_10000167410 | 311 |
| 118 | 3300006914 | Ga0075436_100016677 | Ga0075436_1000166774 | 311 |
| 119 | 3300006914 | Ga0075436_100026284 | Ga0075436_1000262843 | 311 |
| 120 | 3300006914 | Ga0075436_100053577 | Ga0075436_1000535773 | 311 |
| 121 | 3300006914 | Ga0075436_100083408 | Ga0075436_1000834083 | 311 |
| 122 | 3300025912 | Ga0207707_10003043 | Ga0207707_100030432 | 311 |
| 123 | 3300025936 | Ga0207670_10077969 | Ga0207670_100779693 | 311 |
| 124 | 3300032005 | Ga0307411_10175380 | Ga0307411_101753802 | 311 |
| 125 | 3300035111 | Ga0373923_0011957 | Ga0373923_0011957_19_993 | 311 |
| 126 | 3300035113 | Ga0373936_0005039 | Ga0373936_0005039_2404_3378 | 311 |
| 127 | 3300035115 | Ga0373941_0002999 | Ga0373941_0002999_803_1768 | 311 |
| 128 | 3300035117 | Ga0373953_0001538 | Ga0373953_0001538_2274_3248 | 311 |
| 129 | 3300035117 | Ga0373953_0007451 | Ga0373953_0007451_1563_2525 | 311 |
| 130 | 3300035118 | Ga0373954_0007034 | Ga0373954_0007034_3059_4033 | 311 |
| 131 | 3300035119 | Ga0373956_0002840 | Ga0373956_0002840_350_1324 | 311 |
| 132 | 3300035120 | Ga0373957_0002859 | Ga0373957_0002859_3684_4658 | 311 |
| 133 | 3300035121 | Ga0373960_0017610 | Ga0373960_0017610_277_1242 | 311 |
| 134 | 3300035171 | Ga0373946_0015737 | Ga0373946_0015737_477_1451 | 311 |
| 135 | 3300035172 | Ga0373955_0005056 | Ga0373955_0005056_1775_2749 | 311 |
| 136 | 3300035172 | Ga0373955_0023387 | Ga0373955_0023387_1841_2803 | 311 |
| 137 | 3300035172 | Ga0373955_0054462 | Ga0373955_0054462_591_1556 | 311 |
| 138 | 3300035207 | Ga0373942_0008774 | Ga0373942_0008774_1312_2277 | 311 |
| 139 | 3300035398 | Ga0316574_0011680 | Ga0316574_0011680_1784_2749 | 311 |
| 140 | 3300035410 | Ga0373924_0000716 | Ga0373924_0000716_2046_3020 | 311 |
| 141 | 3300035692 | Ga0373935_0017278 | Ga0373935_0017278_2164_3138 | 311 |
| 142 | 3300035724 | Ga0373933_0012962 | Ga0373933_0012962_350_1324 | 311 |
| 143 | 3300036401 | Ga0373937_0093304 | Ga0373937_0093304_1380_2345 | 311 |
| 144 | 3300036401 | Ga0373937_0174297 | Ga0373937_0174297_350_1324 | 311 |
| 145 | 3300037068 | Ga0373925_0056004 | Ga0373925_0056004_494_1468 | 311 |
| 146 | 3300046454 | Ga0495592_0005407 | Ga0495592_0005407_3403_4368 | 311 |
| 147 | 3300046454 | Ga0495592_0016262 | Ga0495592_0016262_3024_3998 | 311 |
| 148 | 3300046454 | Ga0495592_0022559 | Ga0495592_0022559_122_1096 | 311 |
| 149 | 3300046455 | Ga0495603_0130308 | Ga0495603_0130308_108_1082 | 311 |
| 150 | 3300046462 | Ga0495651_0010533 | Ga0495651_0010533_3196_4170 | 311 |
| 151 | 3300046463 | Ga0495653_0012139 | Ga0495653_0012139_2374_3348 | 311 |
| 152 | 3300046472 | Ga0495580_0084661 | Ga0495580_0084661_885_1859 | 311 |
| 153 | 3300046475 | Ga0495639_0001353 | Ga0495639_0001353_9452_10426 | 311 |
| 154 | 3300046476 | Ga0495662_0000837 | Ga0495662_0000837_5097_6062 | 311 |
| 155 | 3300046477 | Ga0495664_0010041 | Ga0495664_0010041_3879_4853 | 311 |
| 156 | 3300046499 | Ga0495594_0033176 | Ga0495594_0033176_1174_2148 | 311 |
| 157 | 3300046511 | Ga0495608_0000439 | Ga0495608_0000439_24803_25768 | 311 |
| 158 | 3300046511 | Ga0495608_0019614 | Ga0495608_0019614_3329_4303 | 311 |
| 159 | 3300046514 | Ga0495618_0003523 | Ga0495618_0003523_8400_9374 | 311 |
| 160 | 3300046514 | Ga0495618_0005327 | Ga0495618_0005327_6222_7187 | 311 |
| 161 | 3300046516 | Ga0495628_0000681 | Ga0495628_0000681_29115_30089 | 311 |
| 162 | 3300046516 | Ga0495628_0001953 | Ga0495628_0001953_504_1469 | 311 |
| 163 | 3300046516 | Ga0495628_0014895 | Ga0495628_0014895_5049_6023 | 311 |
| 164 | 3300046516 | Ga0495628_0017207 | Ga0495628_0017207_4594_5568 | 311 |
| 165 | 3300046517 | Ga0495630_0003806 | Ga0495630_0003806_7348_8322 | 311 |
| 166 | 3300046517 | Ga0495630_0202332 | Ga0495630_0202332_289_1254 | 311 |
| 167 | 3300046522 | Ga0495643_0034379 | Ga0495643_0034379_136_1185 | 311 |
| 168 | 3300046524 | Ga0495648_0124826 | Ga0495648_0124826_259_1320 | 311 |
| 169 | 3300046526 | Ga0495666_0008954 | Ga0495666_0008954_746_1720 | 311 |
| 170 | 3300046529 | Ga0495652_0002007 | Ga0495652_0002007_16229_17203 | 311 |
| 171 | 3300046533 | Ga0495640_0003703 | Ga0495640_0003703_5219_6184 | 311 |
| 172 | 3300046533 | Ga0495640_0045620 | Ga0495640_0045620_594_1568 | 311 |
| 173 | 3300046535 | Ga0495586_0000894 | Ga0495586_0000894_5239_6204 | 311 |
| 174 | 3300046535 | Ga0495586_0016421 | Ga0495586_0016421_350_1324 | 311 |
| 175 | 3300046536 | Ga0495587_0006531 | Ga0495587_0006531_1905_2870 | 311 |
| 176 | 3300046536 | Ga0495587_0017253 | Ga0495587_0017253_1835_2809 | 311 |
| 177 | 3300046536 | Ga0495587_0175258 | Ga0495587_0175258_158_1132 | 311 |
| 178 | 3300046542 | Ga0495597_0000349 | Ga0495597_0000349_30439_31506 | 311 |
| 179 | 3300046543 | Ga0495645_0000366 | Ga0495645_0000366_11708_12682 | 311 |
| 180 | 3300046559 | Ga0495667_0000661 | Ga0495667_0000661_308_1273 | 311 |
| 181 | 3300046559 | Ga0495667_0016446 | Ga0495667_0016446_1601_2575 | 311 |
| 182 | 3300046615 | Ga0495656_0087622 | Ga0495656_0087622_12_977 | 311 |
| 183 | 3300046616 | Ga0495668_0000699 | Ga0495668_0000699_11128_12189 | 311 |
| 184 | 3300046642 | Ga0495634_0001760 | Ga0495634_0001760_344_1309 | 311 |
| 185 | 3300046642 | Ga0495634_0023506 | Ga0495634_0023506_983_1957 | 311 |
| 186 | 3300046663 | Ga0495635_0008699 | Ga0495635_0008699_3448_4422 | 311 |
| 187 | 3300046663 | Ga0495635_0174272 | Ga0495635_0174272_291_1256 | 311 |
| 188 | 3300046675 | Ga0495657_0007439 | Ga0495657_0007439_3277_4251 | 311 |
| 189 | 3300046678 | Ga0495599_0001911 | Ga0495599_0001911_9109_10083 | 311 |
| 190 | 3300046678 | Ga0495599_0043119 | Ga0495599_0043119_1508_2482 | 311 |
| 191 | 3300046681 | Ga0495647_0006405 | Ga0495647_0006405_2392_3366 | 311 |
| 192 | 3300046683 | Ga0495658_0007805 | Ga0495658_0007805_1838_2812 | 311 |
| 193 | 3300046689 | Ga0495613_0007324 | Ga0495613_0007324_10_975 | 311 |
| 194 | 3300046689 | Ga0495613_0031960 | Ga0495613_0031960_1458_2432 | 311 |
| 195 | 3300046692 | Ga0495671_0002860 | Ga0495671_0002860_9708_10757 | 311 |
| 196 | 3300046809 | Ga0495600_0028496 | Ga0495600_0028496_2521_3486 | 311 |
| 197 | 3300046809 | Ga0495600_0047634 | Ga0495600_0047634_1473_2447 | 311 |
| 198 | 3300047317 | Ga0495604_0018005 | Ga0495604_0018005_4440_5405 | 311 |
| 199 | 3300047317 | Ga0495604_0188260 | Ga0495604_0188260_367_1332 | 311 |
| 200 | 3300047319 | Ga0495674_0005349 | Ga0495674_0005349_3001_3975 | 311 |
| 201 | 3300047322 | Ga0495680_0002911 | Ga0495680_0002911_15442_16407 | 311 |
| 202 | 3300047322 | Ga0495680_0027038 | Ga0495680_0027038_2274_3248 | 311 |
| 203 | 3300047444 | Ga0495675_0027617 | Ga0495675_0027617_1432_2406 | 311 |
| 204 | 3300047471 | Ga0495684_0022750 | Ga0495684_0022750_695_1669 | 311 |
| 205 | 3300047471 | Ga0495684_0107191 | Ga0495684_0107191_1116_2090 | 311 |
| 206 | 3300047472 | Ga0495686_0000381 | Ga0495686_0000381_49035_50099 | 311 |
| 207 | 3300048091 | Ga0495626_0061992 | Ga0495626_0061992_546_1589 | 311 |
| 208 | 3300048091 | Ga0495626_0070416 | Ga0495626_0070416_42_1103 | 311 |
| 209 | 3300048912 | Ga0496109_0063874 | Ga0496109_0063874_366_1409 | 311 |
| 210 | 3300048916 | Ga0496113_0003150 | Ga0496113_0003150_6317_7360 | 311 |
| 211 | 3300048926 | Ga0496123_0000966 | Ga0496123_0000966_35554_36597 | 311 |
| 212 | 3300048928 | Ga0496125_0003065 | Ga0496125_0003065_10631_11674 | 311 |
| 213 | 3300049459 | Ga0495678_001446 | Ga0495678_001446_9916_10953 | 311 |
| 214 | 3300049568 | Ga0501031_0014068 | Ga0501031_0014068_1049_2158 | 311 |
| 215 | 3300049569 | Ga0501032_0056266 | Ga0501032_0056266_1345_2454 | 311 |
| 216 | 3300049570 | Ga0501033_0000919 | Ga0501033_0000919_9164_10273 | 311 |
| 217 | 3300049570 | Ga0501033_0050339 | Ga0501033_0050339_286_1401 | 311 |
| 218 | 3300049571 | Ga0501034_0015074 | Ga0501034_0015074_5473_6582 | 311 |
| 219 | 3300049571 | Ga0501034_0299001 | Ga0501034_0299001_59_1174 | 311 |
| 220 | 3300049572 | Ga0501036_0000418 | Ga0501036_0000418_23257_24366 | 311 |
| 221 | 3300049573 | Ga0501037_0002535 | Ga0501037_0002535_1199_2308 | 311 |
| 222 | 3300049574 | Ga0501038_0001437 | Ga0501038_0001437_11456_12565 | 311 |
| 223 | 3300049574 | Ga0501038_0058153 | Ga0501038_0058153_1561_2526 | 311 |
| 224 | 3300049576 | Ga0501040_0017391 | Ga0501040_0017391_777_1739 | 311 |
| 225 | 3300049576 | Ga0501040_0029406 | Ga0501040_0029406_2145_3113 | 311 |
| 226 | 3300049577 | Ga0501041_0048172 | Ga0501041_0048172_958_1926 | 311 |
| 227 | 3300049579 | Ga0501043_0000727 | Ga0501043_0000727_17008_18117 | 311 |
| 228 | 3300049580 | Ga0501046_0001315 | Ga0501046_0001315_2410_3519 | 311 |
| 229 | 3300049580 | Ga0501046_0025304 | Ga0501046_0025304_3453_4421 | 311 |
| 230 | 3300049581 | Ga0501047_0003680 | Ga0501047_0003680_10437_11546 | 311 |
| 231 | 3300049587 | Ga0501071_0009047 | Ga0501071_0009047_630_1598 | 311 |
| 232 | 3300049591 | Ga0501075_0000179 | Ga0501075_0000179_5192_6160 | 311 |
| 233 | 3300049592 | Ga0501076_0000575 | Ga0501076_0000575_8691_9659 | 311 |
| 234 | 3300049741 | Ga0501079_0001973 | Ga0501079_0001973_3069_4037 | 311 |
| 235 | 3300049822 | Ga0501035_0001123 | Ga0501035_0001123_6581_7690 | 311 |
| 236 | 3300049823 | Ga0501044_0016393 | Ga0501044_0016393_4243_5352 | 311 |
| 237 | 3300049823 | Ga0501044_0048025 | Ga0501044_0048025_2291_3394 | 311 |
| 238 | 3300050491 | nmdc:mga00v17_1834_c1 | nmdc:mga00v17_1834_c1_1775_2893 | 311 |
| 239 | 3300050510 | nmdc:mga06r32_66161_c1 | nmdc:mga06r32_66161_c1_1449_2414 | 311 |
| 240 | 3300050512 | nmdc:mga0n895_36967_c1 | nmdc:mga0n895_36967_c1_549_1514 | 311 |
| 241 | 3300050514 | nmdc:mga08x19_2600_c1 | nmdc:mga08x19_2600_c1_1716_2681 | 311 |
| 242 | 3300050514 | nmdc:mga08x19_96362_c1 | nmdc:mga08x19_96362_c1_673_1647 | 311 |
| 243 | 3300050515 | nmdc:mga0a205_24856_c1 | nmdc:mga0a205_24856_c1_3522_4487 | 311 |
| 244 | 3300053077 | Ga0495601_0001843 | Ga0495601_0001843_2674_3648 | 311 |
| 245 | 3300053078 | Ga0495612_0049481 | Ga0495612_0049481_131_1105 | 311 |
| 246 | 3300053085 | Ga0495619_0013961 | Ga0495619_0013961_63_1037 | 311 |
| 247 | 3300060353 | Ga0501082_0002807 | Ga0501082_0002807_870_1838 | 311 |
| 248 | 3300003792 | Ga0055540_1001304 | Ga0055540_100130418 | 312 |
| 249 | 3300005289 | Ga0065704_10088231 | Ga0065704_100882312 | 312 |
| 250 | 3300005471 | Ga0070698_100007456 | Ga0070698_1000074567 | 312 |
| 251 | 3300005539 | Ga0068853_100076273 | Ga0068853_1000762732 | 312 |
| 252 | 3300005577 | Ga0068857_100035419 | Ga0068857_1000354194 | 312 |
| 253 | 3300006051 | Ga0075364_10031646 | Ga0075364_100316463 | 312 |
| 254 | 3300007265 | Ga0099794_10092931 | Ga0099794_100929312 | 312 |
| 255 | 3300013102 | Ga0157371_10120043 | Ga0157371_101200432 | 312 |
| 256 | 3300014497 | Ga0182008_10000904 | Ga0182008_1000090420 | 312 |
| 257 | 3300025242 | Ga0209258_102610 | Ga0209258_1026104 | 312 |
| 258 | 3300025272 | Ga0209455_1000596 | Ga0209455_10005967 | 312 |
| 259 | 3300025303 | Ga0209051_1000298 | Ga0209051_100029820 | 312 |
| 260 | 3300025922 | Ga0207646_10262636 | Ga0207646_102626362 | 312 |
| 261 | 3300026041 | Ga0207639_10044923 | Ga0207639_100449233 | 312 |
| 262 | 3300026116 | Ga0207674_10285951 | Ga0207674_102859512 | 312 |
| 263 | 3300031911 | Ga0307412_10000106 | Ga0307412_1000010658 | 312 |
| 264 | 3300037312 | Ga0395899_0090907 | Ga0395899_0090907_610_1749 | 312 |
| 265 | 3300037418 | Ga0395900_0004688 | Ga0395900_0004688_2730_3869 | 312 |
| 266 | 3300037418 | Ga0395900_0005230 | Ga0395900_0005230_1773_2750 | 312 |
| 267 | 3300037466 | Ga0395898_0004767 | Ga0395898_0004767_2588_3565 | 312 |
| 268 | 3300038443 | Ga0395901_0010625 | Ga0395901_0010625_6700_7677 | 312 |
| 269 | 3300038443 | Ga0395901_0206101 | Ga0395901_0206101_750_1841 | 312 |
| 270 | 3300042876 | Ga0451577_0120917 | Ga0451577_0120917_469_1560 | 312 |
| 271 | 3300044712 | Ga0453684_0397811 | Ga0453684_0397811_15_1106 | 312 |
| 272 | 3300046500 | Ga0495596_0000918 | Ga0495596_0000918_12692_13756 | 312 |
| 273 | 3300046501 | Ga0495607_0000009 | Ga0495607_0000009_6481_7611 | 312 |
| 274 | 3300046513 | Ga0495616_0058908 | Ga0495616_0058908_564_1628 | 312 |
| 275 | 3300046519 | Ga0495632_0000403 | Ga0495632_0000403_11172_12239 | 312 |
| 276 | 3300046684 | Ga0495669_0011974 | Ga0495669_0011974_1269_2333 | 312 |
| 277 | 3300048908 | Ga0496105_0072416 | Ga0496105_0072416_1447_2553 | 312 |
| 278 | 3300048921 | Ga0496118_0022065 | Ga0496118_0022065_217_1335 | 312 |
| 279 | 3300048922 | Ga0496119_0005661 | Ga0496119_0005661_2132_3250 | 312 |
| 280 | 3300048923 | Ga0496120_0003037 | Ga0496120_0003037_13585_14703 | 312 |
| 281 | 3300048924 | Ga0496121_0000165 | Ga0496121_0000165_98637_99755 | 312 |
| 282 | 3300048927 | Ga0496124_0000007 | Ga0496124_0000007_243359_244558 | 312 |
| 283 | 3300048928 | Ga0496125_0000121 | Ga0496125_0000121_109106_110224 | 312 |
| 284 | 3300050491 | nmdc:mga00v17_15848_c1 | nmdc:mga00v17_15848_c1_1085_2170 | 312 |
| 285 | 3300003187 | JGI25151J46595_10002495 | JGI25151J46595_100024957 | 313 |
| 286 | 3300005334 | Ga0068869_100016408 | Ga0068869_1000164082 | 313 |
| 287 | 3300005338 | Ga0068868_100058218 | Ga0068868_1000582181 | 313 |
| 288 | 3300005364 | Ga0070673_100115740 | Ga0070673_1001157403 | 313 |
| 289 | 3300005548 | Ga0070665_100037212 | Ga0070665_1000372125 | 313 |
| 290 | 3300005617 | Ga0068859_100192221 | Ga0068859_1001922213 | 313 |
| 291 | 3300005618 | Ga0068864_100023782 | Ga0068864_1000237824 | 313 |
| 292 | 3300005841 | Ga0068863_100042981 | Ga0068863_1000429813 | 313 |
| 293 | 3300005842 | Ga0068858_100145324 | Ga0068858_1001453242 | 313 |
| 294 | 3300005843 | Ga0068860_100099911 | Ga0068860_1000999112 | 313 |
| 295 | 3300006358 | Ga0068871_100154129 | Ga0068871_1001541292 | 313 |
| 296 | 3300006931 | Ga0097620_100192205 | Ga0097620_1001922053 | 313 |
| 297 | 3300009098 | Ga0105245_10090380 | Ga0105245_100903802 | 313 |
| 298 | 3300009101 | Ga0105247_10059608 | Ga0105247_100596081 | 313 |
| 299 | 3300013306 | Ga0163162_10162512 | Ga0163162_101625121 | 313 |
| 300 | 3300014969 | Ga0157376_10436625 | Ga0157376_104366251 | 313 |
| 301 | 3300025294 | Ga0209025_1000039 | Ga0209025_1000039159 | 313 |
| 302 | 3300025941 | Ga0207711_10022078 | Ga0207711_100220785 | 313 |
| 303 | 3300025942 | Ga0207689_10011395 | Ga0207689_100113953 | 313 |
| 304 | 3300025986 | Ga0207658_10124743 | Ga0207658_101247432 | 313 |
| 305 | 3300026023 | Ga0207677_10296601 | Ga0207677_102966011 | 313 |
| 306 | 3300026088 | Ga0207641_10064491 | Ga0207641_100644912 | 313 |
| 307 | 3300026095 | Ga0207676_10173238 | Ga0207676_101732381 | 313 |
| 308 | 3300027717 | Ga0209998_10030928 | Ga0209998_100309281 | 313 |
| 309 | 3300046491 | Ga0495584_0001438 | Ga0495584_0001438_6859_8013 | 313 |
| 310 | 3300049822 | Ga0501035_0051757 | Ga0501035_0051757_1092_2192 | 313 |
| 311 | 3300049823 | Ga0501044_0002136 | Ga0501044_0002136_1233_2339 | 313 |
| 312 | 3300053161 | Ga0500634_0037184 | Ga0500634_0037184_330_1466 | 313 |
| 313 | 3300005444 | Ga0070694_100002229 | Ga0070694_10000222913 | 314 |
| 314 | 3300005545 | Ga0070695_100007668 | Ga0070695_1000076689 | 314 |
| 315 | 3300005547 | Ga0070693_100051317 | Ga0070693_1000513171 | 314 |
| 316 | 3300005617 | Ga0068859_100116479 | Ga0068859_1001164792 | 314 |
| 317 | 3300006931 | Ga0097620_100116483 | Ga0097620_1001164833 | 314 |
| 318 | 3300009098 | Ga0105245_10136158 | Ga0105245_101361583 | 314 |
| 319 | 3300025922 | Ga0207646_10339755 | Ga0207646_103397552 | 314 |
| 320 | 3300035092 | Ga0373952_0020941 | Ga0373952_0020941_337_1311 | 314 |
| 321 | 3300035695 | Ga0373927_0120036 | Ga0373927_0120036_222_1196 | 314 |
| 322 | 3300041511 | Ga0451855_0606830 | Ga0451855_0606830_201_1217 | 314 |
| 323 | 3300049822 | Ga0501035_0075583 | Ga0501035_0075583_606_1694 | 314 |
| 324 | 3300049823 | Ga0501044_0014614 | Ga0501044_0014614_2998_4086 | 314 |
| 325 | 3300053730 | Ga0500645_013205 | Ga0500645_013205_102_1079 | 314 |
| 326 | 3300003320 | rootH2_10004886 | rootH2_1000488613 | 315 |
| 327 | 3300004801 | Ga0058860_12046738 | Ga0058860_120467381 | 315 |
| 328 | 3300005289 | Ga0065704_10181853 | Ga0065704_101818531 | 315 |
| 329 | 3300005328 | Ga0070676_10009267 | Ga0070676_100092674 | 315 |
| 330 | 3300005329 | Ga0070683_100148696 | Ga0070683_1001486963 | 315 |
| 331 | 3300005330 | Ga0070690_100000252 | Ga0070690_10000025227 | 315 |
| 332 | 3300005330 | Ga0070690_100020259 | Ga0070690_1000202592 | 315 |
| 333 | 3300005334 | Ga0068869_100000052 | Ga0068869_10000005212 | 315 |
| 334 | 3300005334 | Ga0068869_100032253 | Ga0068869_1000322533 | 315 |
| 335 | 3300005337 | Ga0070682_100040454 | Ga0070682_1000404543 | 315 |
| 336 | 3300005338 | Ga0068868_100001208 | Ga0068868_1000012083 | 315 |
| 337 | 3300005340 | Ga0070689_100000389 | Ga0070689_1000003895 | 315 |
| 338 | 3300005340 | Ga0070689_100039635 | Ga0070689_1000396353 | 315 |
| 339 | 3300005341 | Ga0070691_10000617 | Ga0070691_1000061717 | 315 |
| 340 | 3300005343 | Ga0070687_100000053 | Ga0070687_10000005317 | 315 |
| 341 | 3300005343 | Ga0070687_100057855 | Ga0070687_1000578552 | 315 |
| 342 | 3300005345 | Ga0070692_10139037 | Ga0070692_101390371 | 315 |
| 343 | 3300005347 | Ga0070668_100028602 | Ga0070668_1000286023 | 315 |
| 344 | 3300005355 | Ga0070671_100324233 | Ga0070671_1003242332 | 315 |
| 345 | 3300005365 | Ga0070688_100029277 | Ga0070688_1000292773 | 315 |
| 346 | 3300005438 | Ga0070701_10000715 | Ga0070701_100007152 | 315 |
| 347 | 3300005440 | Ga0070705_100000253 | Ga0070705_10000025324 | 315 |
| 348 | 3300005441 | Ga0070700_100000315 | Ga0070700_1000003153 | 315 |
| 349 | 3300005444 | Ga0070694_100000058 | Ga0070694_10000005829 | 315 |
| 350 | 3300005459 | Ga0068867_100000138 | Ga0068867_10000013811 | 315 |
| 351 | 3300005459 | Ga0068867_100000606 | Ga0068867_10000060610 | 315 |
| 352 | 3300005467 | Ga0070706_100271404 | Ga0070706_1002714041 | 315 |
| 353 | 3300005530 | Ga0070679_100003288 | Ga0070679_10000328812 | 315 |
| 354 | 3300005536 | Ga0070697_100051687 | Ga0070697_1000516872 | 315 |
| 355 | 3300005543 | Ga0070672_100126507 | Ga0070672_1001265072 | 315 |
| 356 | 3300005544 | Ga0070686_100000132 | Ga0070686_1000001327 | 315 |
| 357 | 3300005544 | Ga0070686_100209737 | Ga0070686_1002097371 | 315 |
| 358 | 3300005545 | Ga0070695_100066871 | Ga0070695_1000668712 | 315 |
| 359 | 3300005546 | Ga0070696_100000008 | Ga0070696_10000000838 | 315 |
| 360 | 3300005546 | Ga0070696_100005606 | Ga0070696_1000056066 | 315 |
| 361 | 3300005547 | Ga0070693_100000008 | Ga0070693_10000000839 | 315 |
| 362 | 3300005549 | Ga0070704_100000044 | Ga0070704_10000004428 | 315 |
| 363 | 3300005549 | Ga0070704_100005086 | Ga0070704_1000050869 | 315 |
| 364 | 3300005549 | Ga0070704_100111318 | Ga0070704_1001113182 | 315 |
| 365 | 3300005563 | Ga0068855_100000880 | Ga0068855_10000088028 | 315 |
| 366 | 3300005578 | Ga0068854_100020104 | Ga0068854_1000201042 | 315 |
| 367 | 3300005614 | Ga0068856_100023595 | Ga0068856_1000235953 | 315 |
| 368 | 3300005615 | Ga0070702_100001364 | Ga0070702_1000013647 | 315 |
| 369 | 3300005617 | Ga0068859_100000906 | Ga0068859_10000090610 | 315 |
| 370 | 3300005618 | Ga0068864_100023385 | Ga0068864_1000233856 | 315 |
| 371 | 3300005718 | Ga0068866_10000228 | Ga0068866_1000022823 | 315 |
| 372 | 3300005840 | Ga0068870_10153187 | Ga0068870_101531872 | 315 |
| 373 | 3300005842 | Ga0068858_100001268 | Ga0068858_10000126817 | 315 |
| 374 | 3300005842 | Ga0068858_100028208 | Ga0068858_1000282082 | 315 |
| 375 | 3300005843 | Ga0068860_100000634 | Ga0068860_10000063422 | 315 |
| 376 | 3300005844 | Ga0068862_100013191 | Ga0068862_1000131913 | 315 |
| 377 | 3300005981 | Ga0081538_10054631 | Ga0081538_100546311 | 315 |
| 378 | 3300005985 | Ga0081539_10001863 | Ga0081539_1000186323 | 315 |
| 379 | 3300006237 | Ga0097621_100001432 | Ga0097621_10000143220 | 315 |
| 380 | 3300006237 | Ga0097621_100005388 | Ga0097621_1000053885 | 315 |
| 381 | 3300006358 | Ga0068871_100001506 | Ga0068871_1000015067 | 315 |
| 382 | 3300006358 | Ga0068871_100001528 | Ga0068871_1000015282 | 315 |
| 383 | 3300006844 | Ga0075428_100002230 | Ga0075428_1000022306 | 315 |
| 384 | 3300006844 | Ga0075428_100173639 | Ga0075428_1001736393 | 315 |
| 385 | 3300006846 | Ga0075430_100013776 | Ga0075430_1000137766 | 315 |
| 386 | 3300006846 | Ga0075430_100024254 | Ga0075430_1000242545 | 315 |
| 387 | 3300006847 | Ga0075431_100006205 | Ga0075431_10000620511 | 315 |
| 388 | 3300006852 | Ga0075433_10001672 | Ga0075433_1000167214 | 315 |
| 389 | 3300006852 | Ga0075433_10199199 | Ga0075433_101991992 | 315 |
| 390 | 3300006871 | Ga0075434_100000002 | Ga0075434_10000000281 | 315 |
| 391 | 3300006871 | Ga0075434_100007238 | Ga0075434_1000072389 | 315 |
| 392 | 3300006871 | Ga0075434_100631694 | Ga0075434_1006316941 | 315 |
| 393 | 3300006880 | Ga0075429_100000150 | Ga0075429_10000015045 | 315 |
| 394 | 3300006881 | Ga0068865_100000276 | Ga0068865_10000027630 | 315 |
| 395 | 3300006881 | Ga0068865_100003876 | Ga0068865_1000038766 | 315 |
| 396 | 3300006914 | Ga0075436_100000603 | Ga0075436_1000006039 | 315 |
| 397 | 3300006914 | Ga0075436_100004083 | Ga0075436_1000040838 | 315 |
| 398 | 3300006931 | Ga0097620_100000906 | Ga0097620_10000090610 | 315 |
| 399 | 3300007076 | Ga0075435_100000089 | Ga0075435_10000008933 | 315 |
| 400 | 3300007076 | Ga0075435_100010608 | Ga0075435_1000106082 | 315 |
| 401 | 3300007265 | Ga0099794_10078305 | Ga0099794_100783052 | 315 |
| 402 | 3300009094 | Ga0111539_10013589 | Ga0111539_100135896 | 315 |
| 403 | 3300009094 | Ga0111539_10130762 | Ga0111539_101307623 | 315 |
| 404 | 3300009098 | Ga0105245_10000221 | Ga0105245_100002219 | 315 |
| 405 | 3300009147 | Ga0114129_10003624 | Ga0114129_1000362425 | 315 |
| 406 | 3300009147 | Ga0114129_10028894 | Ga0114129_100288947 | 315 |
| 407 | 3300009147 | Ga0114129_10714052 | Ga0114129_107140522 | 315 |
| 408 | 3300009147 | Ga0114129_10888562 | Ga0114129_108885622 | 315 |
| 409 | 3300009148 | Ga0105243_10000288 | Ga0105243_100002889 | 315 |
| 410 | 3300009148 | Ga0105243_10012184 | Ga0105243_100121843 | 315 |
| 411 | 3300009174 | Ga0105241_10039260 | Ga0105241_100392602 | 315 |
| 412 | 3300009176 | Ga0105242_10001306 | Ga0105242_1000130620 | 315 |
| 413 | 3300009177 | Ga0105248_10459174 | Ga0105248_104591742 | 315 |
| 414 | 3300009553 | Ga0105249_10001638 | Ga0105249_1000163817 | 315 |
| 415 | 3300013297 | Ga0157378_10010643 | Ga0157378_1001064310 | 315 |
| 416 | 3300013306 | Ga0163162_10443289 | Ga0163162_104432891 | 315 |
| 417 | 3300013308 | Ga0157375_10064022 | Ga0157375_100640224 | 315 |
| 418 | 3300014326 | Ga0157380_10107610 | Ga0157380_101076103 | 315 |
| 419 | 3300014969 | Ga0157376_10001746 | Ga0157376_1000174620 | 315 |
| 420 | 3300025899 | Ga0207642_10000528 | Ga0207642_100005287 | 315 |
| 421 | 3300025899 | Ga0207642_10031133 | Ga0207642_100311332 | 315 |
| 422 | 3300025904 | Ga0207647_10023637 | Ga0207647_100236373 | 315 |
| 423 | 3300025907 | Ga0207645_10102625 | Ga0207645_101026252 | 315 |
| 424 | 3300025908 | Ga0207643_10147756 | Ga0207643_101477562 | 315 |
| 425 | 3300025912 | Ga0207707_10248103 | Ga0207707_102481032 | 315 |
| 426 | 3300025917 | Ga0207660_10000702 | Ga0207660_1000070221 | 315 |
| 427 | 3300025918 | Ga0207662_10000147 | Ga0207662_1000014726 | 315 |
| 428 | 3300025918 | Ga0207662_10140377 | Ga0207662_101403772 | 315 |
| 429 | 3300025921 | Ga0207652_10004183 | Ga0207652_100041839 | 315 |
| 430 | 3300025921 | Ga0207652_10272803 | Ga0207652_102728032 | 315 |
| 431 | 3300025927 | Ga0207687_10000574 | Ga0207687_1000057421 | 315 |
| 432 | 3300025933 | Ga0207706_10136762 | Ga0207706_101367622 | 315 |
| 433 | 3300025934 | Ga0207686_10000769 | Ga0207686_1000076920 | 315 |
| 434 | 3300025935 | Ga0207709_10000618 | Ga0207709_1000061832 | 315 |
| 435 | 3300025935 | Ga0207709_10001207 | Ga0207709_1000120723 | 315 |
| 436 | 3300025936 | Ga0207670_10001822 | Ga0207670_100018227 | 315 |
| 437 | 3300025937 | Ga0207669_10246608 | Ga0207669_102466082 | 315 |
| 438 | 3300025938 | Ga0207704_10021117 | Ga0207704_100211172 | 315 |
| 439 | 3300025939 | Ga0207665_10113969 | Ga0207665_101139693 | 315 |
| 440 | 3300025941 | Ga0207711_10265098 | Ga0207711_102650981 | 315 |
| 441 | 3300025942 | Ga0207689_10002968 | Ga0207689_1000296810 | 315 |
| 442 | 3300025942 | Ga0207689_10032534 | Ga0207689_100325342 | 315 |
| 443 | 3300025949 | Ga0207667_10023997 | Ga0207667_100239972 | 315 |
| 444 | 3300025949 | Ga0207667_10084574 | Ga0207667_100845744 | 315 |
| 445 | 3300025961 | Ga0207712_10004541 | Ga0207712_100045416 | 315 |
| 446 | 3300025972 | Ga0207668_10018884 | Ga0207668_100188843 | 315 |
| 447 | 3300025981 | Ga0207640_10168022 | Ga0207640_101680222 | 315 |
| 448 | 3300026023 | Ga0207677_10001629 | Ga0207677_100016295 | 315 |
| 449 | 3300026035 | Ga0207703_10005322 | Ga0207703_100053227 | 315 |
| 450 | 3300026041 | Ga0207639_10085964 | Ga0207639_100859642 | 315 |
| 451 | 3300026075 | Ga0207708_10005166 | Ga0207708_100051666 | 315 |
| 452 | 3300026078 | Ga0207702_10034743 | Ga0207702_100347435 | 315 |
| 453 | 3300026089 | Ga0207648_10000362 | Ga0207648_1000036228 | 315 |
| 454 | 3300026089 | Ga0207648_10001117 | Ga0207648_1000111728 | 315 |
| 455 | 3300026095 | Ga0207676_10045719 | Ga0207676_100457193 | 315 |
| 456 | 3300026116 | Ga0207674_10100541 | Ga0207674_101005413 | 315 |
| 457 | 3300026118 | Ga0207675_100000880 | Ga0207675_10000088010 | 315 |
| 458 | 3300027364 | Ga0209967_1001323 | Ga0209967_10013232 | 315 |
| 459 | 3300027364 | Ga0209967_1001973 | Ga0209967_10019732 | 315 |
| 460 | 3300027395 | Ga0209996_1001443 | Ga0209996_10014433 | 315 |
| 461 | 3300027395 | Ga0209996_1004511 | Ga0209996_10045112 | 315 |
| 462 | 3300027526 | Ga0209968_1003523 | Ga0209968_10035232 | 315 |
| 463 | 3300027543 | Ga0209999_1002842 | Ga0209999_10028423 | 315 |
| 464 | 3300027665 | Ga0209983_1006167 | Ga0209983_10061673 | 315 |
| 465 | 3300027682 | Ga0209971_1003725 | Ga0209971_10037252 | 315 |
| 466 | 3300027907 | Ga0207428_10002058 | Ga0207428_1000205819 | 315 |
| 467 | 3300027907 | Ga0207428_10019470 | Ga0207428_100194705 | 315 |
| 468 | 3300027907 | Ga0207428_10058881 | Ga0207428_100588813 | 315 |
| 469 | 3300028380 | Ga0268265_10000457 | Ga0268265_1000045750 | 315 |
| 470 | 3300028381 | Ga0268264_10001149 | Ga0268264_1000114927 | 315 |
| 471 | 3300028573 | Ga0265334_10017155 | Ga0265334_100171553 | 315 |
| 472 | 3300031665 | Ga0316575_10004408 | Ga0316575_100044084 | 315 |
| 473 | 3300031665 | Ga0316575_10006319 | Ga0316575_100063195 | 315 |
| 474 | 3300031852 | Ga0307410_10081913 | Ga0307410_100819131 | 315 |
| 475 | 3300032002 | Ga0307416_100330189 | Ga0307416_1003301892 | 315 |
| 476 | 3300035086 | Ga0373934_0000470 | Ga0373934_0000470_9286_10302 | 315 |
| 477 | 3300035112 | Ga0373932_0027097 | Ga0373932_0027097_537_1517 | 315 |
| 478 | 3300035118 | Ga0373954_0000052 | Ga0373954_0000052_9137_10117 | 315 |
| 479 | 3300035118 | Ga0373954_0000859 | Ga0373954_0000859_7631_8734 | 315 |
| 480 | 3300035118 | Ga0373954_0001173 | Ga0373954_0001173_6120_7172 | 315 |
| 481 | 3300035119 | Ga0373956_0000019 | Ga0373956_0000019_47418_48434 | 315 |
| 482 | 3300035120 | Ga0373957_0000663 | Ga0373957_0000663_954_1970 | 315 |
| 483 | 3300035121 | Ga0373960_0031304 | Ga0373960_0031304_54_1034 | 315 |
| 484 | 3300035241 | Ga0373961_0013889 | Ga0373961_0013889_25_1017 | 315 |
| 485 | 3300035242 | Ga0373962_0026850 | Ga0373962_0026850_19_999 | 315 |
| 486 | 3300035398 | Ga0316574_0222548 | Ga0316574_0222548_62_1042 | 315 |
| 487 | 3300035691 | Ga0373931_0000307 | Ga0373931_0000307_19166_20146 | 315 |
| 488 | 3300035724 | Ga0373933_0019539 | Ga0373933_0019539_2244_3260 | 315 |
| 489 | 3300035725 | Ga0373947_0028426 | Ga0373947_0028426_134_1114 | 315 |
| 490 | 3300036401 | Ga0373937_0000645 | Ga0373937_0000645_2340_3320 | 315 |
| 491 | 3300036401 | Ga0373937_0000781 | Ga0373937_0000781_22922_23938 | 315 |
| 492 | 3300037418 | Ga0395900_0004673 | Ga0395900_0004673_10756_11862 | 315 |
| 493 | 3300042001 | Ga0439441_000508 | Ga0439441_000508_525_1520 | 315 |
| 494 | 3300042436 | Ga0439435_0017748 | Ga0439435_0017748_176_1171 | 315 |
| 495 | 3300042461 | Ga0439460_0000008 | Ga0439460_0000008_22616_23596 | 315 |
| 496 | 3300042876 | Ga0451577_0002438 | Ga0451577_0002438_9777_10913 | 315 |
| 497 | 3300042876 | Ga0451577_0005329 | Ga0451577_0005329_5475_6596 | 315 |
| 498 | 3300044712 | Ga0453684_0198717 | Ga0453684_0198717_523_1623 | 315 |
| 499 | 3300045051 | Ga0451576_0001013 | Ga0451576_0001013_6784_7764 | 315 |
| 500 | 3300045051 | Ga0451576_0002279 | Ga0451576_0002279_14901_16022 | 315 |
| 501 | 3300045051 | Ga0451576_0016576 | Ga0451576_0016576_6509_7489 | 315 |
| 502 | 3300045976 | Ga0466967_0011832 | Ga0466967_0011832_4202_5182 | 315 |
| 503 | 3300046454 | Ga0495592_0019515 | Ga0495592_0019515_1051_2154 | 315 |
| 504 | 3300046455 | Ga0495603_0056677 | Ga0495603_0056677_11_991 | 315 |
| 505 | 3300046462 | Ga0495651_0064189 | Ga0495651_0064189_441_1457 | 315 |
| 506 | 3300046475 | Ga0495639_0050190 | Ga0495639_0050190_199_1182 | 315 |
| 507 | 3300046517 | Ga0495630_0133784 | Ga0495630_0133784_629_1618 | 315 |
| 508 | 3300046523 | Ga0495644_0044660 | Ga0495644_0044660_82_1062 | 315 |
| 509 | 3300046535 | Ga0495586_0033127 | Ga0495586_0033127_1514_2494 | 315 |
| 510 | 3300046537 | Ga0495598_0009521 | Ga0495598_0009521_99_1079 | 315 |
| 511 | 3300046664 | Ga0495659_0044460 | Ga0495659_0044460_554_1534 | 315 |
| 512 | 3300046681 | Ga0495647_0006529 | Ga0495647_0006529_1777_2757 | 315 |
| 513 | 3300046684 | Ga0495669_0099213 | Ga0495669_0099213_172_1152 | 315 |
| 514 | 3300047318 | Ga0495636_0036912 | Ga0495636_0036912_705_1703 | 315 |
| 515 | 3300047321 | Ga0495676_0007493 | Ga0495676_0007493_1092_2072 | 315 |
| 516 | 3300047322 | Ga0495680_0040245 | Ga0495680_0040245_833_1849 | 315 |
| 517 | 3300049570 | Ga0501033_0008890 | Ga0501033_0008890_212_1192 | 315 |
| 518 | 3300049572 | Ga0501036_0000974 | Ga0501036_0000974_15266_16246 | 315 |
| 519 | 3300049573 | Ga0501037_0015192 | Ga0501037_0015192_4491_5468 | 315 |
| 520 | 3300049574 | Ga0501038_0000189 | Ga0501038_0000189_30608_31588 | 315 |
| 521 | 3300049575 | Ga0501039_0000247 | Ga0501039_0000247_16957_17937 | 315 |
| 522 | 3300049576 | Ga0501040_0040415 | Ga0501040_0040415_806_1786 | 315 |
| 523 | 3300049576 | Ga0501040_0066095 | Ga0501040_0066095_1361_2341 | 315 |
| 524 | 3300049577 | Ga0501041_0000032 | Ga0501041_0000032_32051_33031 | 315 |
| 525 | 3300049580 | Ga0501046_0000156 | Ga0501046_0000156_36376_37356 | 315 |
| 526 | 3300049580 | Ga0501046_0140667 | Ga0501046_0140667_412_1389 | 315 |
| 527 | 3300049581 | Ga0501047_0130282 | Ga0501047_0130282_607_1701 | 315 |
| 528 | 3300049586 | Ga0501070_0016624 | Ga0501070_0016624_43_1023 | 315 |
| 529 | 3300049587 | Ga0501071_0004130 | Ga0501071_0004130_2867_3847 | 315 |
| 530 | 3300049588 | Ga0501072_0002789 | Ga0501072_0002789_9859_10839 | 315 |
| 531 | 3300049588 | Ga0501072_0033056 | Ga0501072_0033056_965_1942 | 315 |
| 532 | 3300049591 | Ga0501075_0000053 | Ga0501075_0000053_33031_34011 | 315 |
| 533 | 3300049592 | Ga0501076_0000683 | Ga0501076_0000683_12857_13837 | 315 |
| 534 | 3300049593 | Ga0501077_0003937 | Ga0501077_0003937_2638_3618 | 315 |
| 535 | 3300049741 | Ga0501079_0008097 | Ga0501079_0008097_6447_7427 | 315 |
| 536 | 3300049742 | Ga0501080_0027030 | Ga0501080_0027030_230_1207 | 315 |
| 537 | 3300049742 | Ga0501080_0161465 | Ga0501080_0161465_228_1208 | 315 |
| 538 | 3300049743 | Ga0501081_0000127 | Ga0501081_0000127_27124_28104 | 315 |
| 539 | 3300049822 | Ga0501035_0016865 | Ga0501035_0016865_4870_5850 | 315 |
| 540 | 3300049824 | Ga0501045_0000372 | Ga0501045_0000372_7549_8529 | 315 |
| 541 | 3300049824 | Ga0501045_0061022 | Ga0501045_0061022_701_1684 | 315 |
| 542 | 3300050507 | nmdc:mga05p37_1475_c1 | nmdc:mga05p37_1475_c1_3068_4048 | 315 |
| 543 | 3300050507 | nmdc:mga05p37_34342_c1 | nmdc:mga05p37_34342_c1_448_1443 | 315 |
| 544 | 3300050508 | nmdc:mga09592_49624_c1 | nmdc:mga09592_49624_c1_1639_2634 | 315 |
| 545 | 3300050508 | nmdc:mga09592_8451_c1 | nmdc:mga09592_8451_c1_5213_6193 | 315 |
| 546 | 3300050510 | nmdc:mga06r32_48118_c1 | nmdc:mga06r32_48118_c1_1435_2430 | 315 |
| 547 | 3300050511 | nmdc:mga08y16_17429_c1 | nmdc:mga08y16_17429_c1_5188_6168 | 315 |
| 548 | 3300050511 | nmdc:mga08y16_7366_c1 | nmdc:mga08y16_7366_c1_4570_5550 | 315 |
| 549 | 3300050511 | nmdc:mga08y16_79454_c1 | nmdc:mga08y16_79454_c1_753_1733 | 315 |
| 550 | 3300050511 | nmdc:mga08y16_8395_c1 | nmdc:mga08y16_8395_c1_2984_3964 | 315 |
| 551 | 3300050512 | nmdc:mga0n895_1409_c1 | nmdc:mga0n895_1409_c1_9937_10917 | 315 |
| 552 | 3300050512 | nmdc:mga0n895_3845_c1 | nmdc:mga0n895_3845_c1_524_1513 | 315 |
| 553 | 3300050513 | nmdc:mga0rr50_128_c1 | nmdc:mga0rr50_128_c1_23103_24083 | 315 |
| 554 | 3300050513 | nmdc:mga0rr50_268168_c1 | nmdc:mga0rr50_268168_c1_100_1098 | 315 |
| 555 | 3300050513 | nmdc:mga0rr50_300936_c1 | nmdc:mga0rr50_300936_c1_134_1114 | 315 |
| 556 | 3300050513 | nmdc:mga0rr50_7448_c1 | nmdc:mga0rr50_7448_c1_653_1642 | 315 |
| 557 | 3300050514 | nmdc:mga08x19_10877_c1 | nmdc:mga08x19_10877_c1_1788_2768 | 315 |
| 558 | 3300050514 | nmdc:mga08x19_159004_c1 | nmdc:mga08x19_159004_c1_144_1133 | 315 |
| 559 | 3300050514 | nmdc:mga08x19_191358_c1 | nmdc:mga08x19_191358_c1_362_1342 | 315 |
| 560 | 3300050514 | nmdc:mga08x19_434_c1 | nmdc:mga08x19_434_c1_17398_18378 | 315 |
| 561 | 3300050514 | nmdc:mga08x19_61650_c1 | nmdc:mga08x19_61650_c1_1398_2411 | 315 |
| 562 | 3300050515 | nmdc:mga0a205_160_c1 | nmdc:mga0a205_160_c1_31839_32819 | 315 |
| 563 | 3300053077 | Ga0495601_0220306 | Ga0495601_0220306_35_1138 | 315 |
| 564 | 3300053084 | Ga0495595_0048224 | Ga0495595_0048224_656_1672 | 315 |
| 565 | 3300054114 | Ga0501084_0016187 | Ga0501084_0016187_2337_3317 | 315 |
| 566 | 3300061734 | Ga0530510_0000115 | Ga0530510_0000115_33629_34609 | 315 |
| 567 | 3300061734 | Ga0530510_0000160 | Ga0530510_0000160_30467_31450 | 315 |
| 568 | iso_pu_bacteria | 2599185292 | 2599904342 | 315 |
| 569 | iso_pu_bacteria | 2643221569 | 2643863713 | 315 |
| 570 | iso_pu_bacteria | 2643221594 | 2643982915 | 315 |
| 571 | iso_pu_bacteria | 2643221621 | 2644123242 | 315 |
| 572 | iso_pu_bacteria | 2739367655 | 2739611583 | 315 |
| 573 | iso_pu_bacteria | 2808606395 | 2809033505 | 315 |
| 574 | iso_pu_bacteria | 2855730933 | 2855735420 | 315 |
| 575 | iso_pu_bacteria | 2855767633 | 2855771203 | 315 |
| 576 | iso_pu_bacteria | 2857537821 | 2857537995 | 315 |
| 577 | iso_pu_bacteria | 2857576091 | 2857577963 | 315 |
| 578 | iso_pu_bacteria | 2858950400 | 2858954244 | 315 |
| 579 | iso_pu_bacteria | 2881412998 | 2881416922 | 315 |
| 580 | iso_pu_bacteria | 2881927736 | 2881929108 | 315 |
| 581 | iso_pu_bacteria | 2887375801 | 2887376068 | 315 |
| 582 | iso_pu_bacteria | 2941479691 | 2941484236 | 315 |
| 583 | iso_pu_bacteria | 8002392321 | 8002392737 | 315 |
| 584 | iso_pu_bacteria | 8048746797 | 8048747209 | 315 |
| 585 | iso_pu_bacteria | 8055225921 | 8055226415 | 315 |
| 586 | 3300001990 | JGI24737J22298_10068727 | JGI24737J22298_100687271 | 316 |
| 587 | 3300002067 | JGI24735J21928_10054142 | JGI24735J21928_100541421 | 316 |
| 588 | 3300005329 | Ga0070683_100123728 | Ga0070683_1001237282 | 316 |
| 589 | 3300005339 | Ga0070660_100194991 | Ga0070660_1001949912 | 316 |
| 590 | 3300005344 | Ga0070661_100060352 | Ga0070661_1000603522 | 316 |
| 591 | 3300005535 | Ga0070684_100114077 | Ga0070684_1001140772 | 316 |
| 592 | 3300005616 | Ga0068852_100043798 | Ga0068852_1000437982 | 316 |
| 593 | 3300009551 | Ga0105238_10120296 | Ga0105238_101202961 | 316 |
| 594 | 3300010375 | Ga0105239_10281374 | Ga0105239_102813742 | 316 |
| 595 | 3300013102 | Ga0157371_10087470 | Ga0157371_100874702 | 316 |
| 596 | 3300013307 | Ga0157372_10124018 | Ga0157372_101240182 | 316 |
| 597 | 3300025904 | Ga0207647_10076420 | Ga0207647_100764202 | 316 |
| 598 | 3300025913 | Ga0207695_10210929 | Ga0207695_102109292 | 316 |
| 599 | 3300025914 | Ga0207671_10169483 | Ga0207671_101694832 | 316 |
| 600 | 3300025919 | Ga0207657_10083678 | Ga0207657_100836784 | 316 |
| 601 | 3300025944 | Ga0207661_10388722 | Ga0207661_103887222 | 316 |
| 602 | 3300026078 | Ga0207702_10210539 | Ga0207702_102105392 | 316 |
| 603 | 3300026142 | Ga0207698_10035418 | Ga0207698_100354182 | 316 |
| 604 | 3300037418 | Ga0395900_0001711 | Ga0395900_0001711_10943_11908 | 316 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2wsm-assembly1.cif.gz_A | crystal structure of hydrogenase maturation factor hypb from archaeoglobus fulgidus | 0.7538 | 5 | 184 |
| 4ixn-assembly1.cif.gz_A | crystal structure of zn(ii)-bound e37a,c66a,c67a triple mutant yjia gtpase | 0.7479 | 3 | 314 |
| 4ixn-assembly1.cif.gz_A | crystal structure of zn(ii)-bound e37a,c66a,c67a triple mutant yjia gtpase | 0.7415 | 3 | 314 |
| 4hz5-assembly1.cif.gz_A | pyrrolopyrimidine inhibitors of dna gyrase b and topoisomerase iv, part i: structure guided discovery and optimization of dual targeting agents with potent, broad-spectrum enzymatic activity | 0.7221 | 247 | 299 |
| 4ixm-assembly1.cif.gz_A | crystal structure of zn(ii)-bound yjia gtpase from e. coli | 0.7163 | 3 | 314 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0R0I7G4_81_290_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9204 | 5 | 194 | 3.40.50.300 |
| af_Q2G0W4_1_229_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8969 | 3 | 200 | 3.40.50.300 |
| af_Q2G0B0_6_202_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8779 | 4 | 192 | 3.40.50.300 |
| af_Q9M8L6_331_443_3.30.1220.10 | Alpha Beta;2-Layer Sandwich;Hypothetical Protein Yjia; Chain: A;domain 2;CobW-like, C-terminal domain | 0.8706 | 207 | 313 | 3.30.1220.10 |
| af_Q2G0W4_241_375_3.30.1220.10 | Alpha Beta;2-Layer Sandwich;Hypothetical Protein Yjia; Chain: A;domain 2;CobW-like, C-terminal domain | 0.8698 | 218 | 313 | 3.30.1220.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A258C7H6-F1-model_v4 | deleted | 0.9843 | 222 | 314 |
|
| AF-A0A645I1T3-F1-model_v4 | Putative GTP-binding protein YjiA | 0.983 | 222 | 314 |
GO:0005737
|
| AF-A0A4V1TZ45-F1-model_v4 | deleted | 0.9806 | 217 | 314 |
|
| AF-X1F0I2-F1-model_v4 | CobW C-terminal domain-containing protein | 0.9803 | 221 | 314 |
|
| AF-A0A7R9VUA8-F1-model_v4 | CobW C-terminal domain-containing protein | 0.9752 | 228 | 314 |
GO:0005737
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar