F468429

General Info

Members Datasets Scaffolds Average Seq Length
604 355 578 327

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8055225921|8055226415
Length 383
Sequence RSLDQMVPVTILTGFLGAGKTTLLKRILTEYHGKRIAVIENEFGPESIDNDLLVQDQDEEIIELSNGCVCCTVRGDLMRTLLDLRKRHESGELNFERVIIETTGMANPGPVCQTFFMDDDIAEYYRLDAVVTIVDAKHGMETLDEQEEAQKQVGFADRILISKKDLVTEAEYAALRRRIVHMNPRASIEAVNFGDTDLKKIIDISGFNLNTILDIDPQFLADDHPDAAHDHDHDHSHCDHDHGHCDHDHGHDHAHGHAHDHDHDPATCTNPDHNHGHSHKPAHNDNIGAFVFKSDKPFDPERLEEFLGGVVQVYGPDLLRYKGILYMKGINKRMLFQGVHMLMGAEPGKPWLANEKKTTKMVFIGRKLPQEIFTKGLEQCLAK

Samples

Sample ID Description Type Environment
1 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
2 2643221569 Achromobacter sp. Root565 Isolate Unclassified
3 2643221594 Achromobacter sp. Root170 Isolate Unclassified
4 2643221621 Achromobacter sp. Root83 Isolate Unclassified
5 2738541280 Massilia sp. GV090 Isolate Unclassified
6 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
7 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
8 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
9 2855730933 Achromobacter sp. HZ28 Isolate Nodule
10 2855767633 Achromobacter sp. HZ34 Isolate Nodule
11 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
12 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
13 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
14 2858950400 Achromobacter sp. K91 Isolate Unclassified
15 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
16 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
17 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
18 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
19 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
20 2904456579 Variovorax sp. 2002 Isolate Unclassified
21 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
22 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
23 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
24 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
25 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
26 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
27 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
28 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
29 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
30 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
31 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
32 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
33 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
34 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
35 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
36 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
37 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
38 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
39 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
40 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
41 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
42 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
43 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
44 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
45 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
46 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
47 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
48 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
49 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
50 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
51 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
52 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
53 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
54 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
55 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
56 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
57 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
58 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
59 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
60 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
61 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
62 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
63 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
64 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
65 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
66 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
67 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
68 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
69 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
70 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
71 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
72 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
73 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
74 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
75 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
76 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
77 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
78 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
79 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
80 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
81 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
82 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
83 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
84 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
85 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
86 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
87 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
88 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
90 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
91 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
92 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
93 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
94 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
95 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
96 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
97 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
98 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
100 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
101 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
103 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
104 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
106 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
107 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
108 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
109 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
110 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
111 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
112 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
113 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
116 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
117 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
118 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
119 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
120 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
121 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
125 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
174 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
177 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
178 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
179 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
180 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
181 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
182 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
183 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
184 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
185 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
186 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
187 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
188 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
189 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
190 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
191 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
192 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
193 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
194 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
195 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
196 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
197 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
198 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
199 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
200 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
201 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
202 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
203 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
204 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
205 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
206 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
207 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
208 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
209 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
210 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
211 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
212 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
213 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
214 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
215 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
216 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
217 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
218 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
219 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
220 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
221 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
222 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
223 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
224 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
225 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
226 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
227 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
228 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
229 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
230 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
231 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
232 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
233 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
234 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
235 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
236 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
237 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
238 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
239 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
240 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
241 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
242 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
243 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
244 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
245 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
246 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
247 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
248 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
249 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
250 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
251 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
252 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
253 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
254 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
255 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
256 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
257 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
258 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
259 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
260 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
261 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
262 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
263 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
264 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
265 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
266 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
267 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
268 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
269 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
270 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
271 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
272 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
273 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
274 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
275 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
276 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
277 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
278 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
279 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
280 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
281 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
282 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
283 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
284 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
285 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
286 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
287 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
288 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
289 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
290 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
291 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
292 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
293 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
294 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
295 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
296 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
297 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
298 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
299 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
300 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
301 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
302 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
303 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
304 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
305 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
306 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
307 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
308 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
309 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
310 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
311 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
312 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
314 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
315 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
316 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
317 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
318 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
319 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
320 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
321 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
323 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
324 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
325 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
326 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
327 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
328 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
329 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
330 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
331 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
332 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
333 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
334 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
335 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
336 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
337 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
338 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
339 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
340 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
341 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
342 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
343 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
344 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
345 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
346 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
347 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
348 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
349 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
350 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
351 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
352 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
353 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere
354 8048746797 Alcaligenes endophyticus DSM 100498 Isolate Unclassified
355 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.53
Metatranscriptomes 0.17
Isolates 4.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.98
Nodule 0.33
Rhizoplane 0.99
Rhizosphere 90.89
Stem 0
Stem Tuber 0
Unclassified 4.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10068727 3300001990 Bacteria 1059
2 JGI24735J21928_10054142 3300002067 Bacteria 1156
3 JGI25151J46595_10002495 3300003187 Bacteria 10990
4 rootH2_10004886 3300003320 Bacteria 25787
5 Ga0055529_1000873 3300003763 Bacteria 17295
6 Ga0055540_1001304 3300003792 Bacteria 15079
7 Ga0058860_12046738 3300004801 Bacteria 1238
8 Ga0065165_1001794 3300005262 Bacteria 21154
9 Ga0065704_10088231 3300005289 Bacteria 2956
10 Ga0065704_10181853 3300005289 Bacteria 1233
11 Ga0065707_10031107 3300005295 Bacteria 1453
12 Ga0070676_10009267 3300005328 Bacteria 5321
13 Ga0070683_100123728 3300005329 Bacteria 2444
14 Ga0070683_100148696 3300005329 Bacteria 2221
15 Ga0070690_100000252 3300005330 Bacteria 27754
16 Ga0070690_100020259 3300005330 Bacteria 4050
17 Ga0070690_100156202 3300005330 Bacteria 1560
18 Ga0068869_100000052 3300005334 Bacteria 50285
19 Ga0068869_100016408 3300005334 Bacteria 4991
20 Ga0068869_100032253 3300005334 Bacteria 3690
21 Ga0070682_100040454 3300005337 Bacteria 2868
22 Ga0068868_100001208 3300005338 Bacteria 17737
23 Ga0068868_100058218 3300005338 Bacteria 3053
24 Ga0070660_100194991 3300005339 Bacteria 1641
25 Ga0070689_100000389 3300005340 Bacteria 25743
26 Ga0070689_100039635 3300005340 Bacteria 3608
27 Ga0070691_10000617 3300005341 Bacteria 13697
28 Ga0070687_100000053 3300005343 Bacteria 37278
29 Ga0070687_100057855 3300005343 Bacteria 2034
30 Ga0070661_100060352 3300005344 Bacteria 2783
31 Ga0070692_10139037 3300005345 Bacteria 1372
32 Ga0070668_100028602 3300005347 Bacteria 4231
33 Ga0070671_100324233 3300005355 Bacteria 1313
34 Ga0070673_100115740 3300005364 Bacteria 2230
35 Ga0070688_100029277 3300005365 Bacteria 3296
36 Ga0070701_10000715 3300005438 Bacteria 11745
37 Ga0070705_100000253 3300005440 Bacteria 31805
38 Ga0070705_100216425 3300005440 Bacteria 1324
39 Ga0070700_100000315 3300005441 Bacteria 25119
40 Ga0070694_100000058 3300005444 Bacteria 52128
41 Ga0070694_100002229 3300005444 Bacteria 11451
42 Ga0070694_100071945 3300005444 Bacteria 2384
43 Ga0070681_10000135 3300005458 Bacteria 56156
44 Ga0068867_100000138 3300005459 Bacteria 46832
45 Ga0068867_100000606 3300005459 Bacteria 23757
46 Ga0070706_100271404 3300005467 Bacteria 1583
47 Ga0070707_100246947 3300005468 Bacteria 1737
48 Ga0070698_100007456 3300005471 Bacteria 11837
49 Ga0070699_100031058 3300005518 Bacteria 4613
50 Ga0070679_100003288 3300005530 Bacteria 14791
51 Ga0070684_100114077 3300005535 Bacteria 2425
52 Ga0070697_100042484 3300005536 Bacteria 3679
53 Ga0070697_100051073 3300005536 Bacteria 3359
54 Ga0070697_100051687 3300005536 Bacteria 3339
55 Ga0068853_100076273 3300005539 Bacteria 2927
56 Ga0070672_100126507 3300005543 Bacteria 2096
57 Ga0070686_100000132 3300005544 Bacteria 52774
58 Ga0070686_100209737 3300005544 Bacteria 1401
59 Ga0070686_100287090 3300005544 Bacteria 1216
60 Ga0070695_100003131 3300005545 Bacteria 9640
61 Ga0070695_100007668 3300005545 Bacteria 6392
62 Ga0070695_100066871 3300005545 Bacteria 2343
63 Ga0070696_100000008 3300005546 Bacteria 101365
64 Ga0070696_100001158 3300005546 Bacteria 17126
65 Ga0070696_100005606 3300005546 Bacteria 8381
66 Ga0070693_100000008 3300005547 Bacteria 80726
67 Ga0070693_100051317 3300005547 Bacteria 2362
68 Ga0070665_100037212 3300005548 Bacteria 4895
69 Ga0070704_100000044 3300005549 Bacteria 41217
70 Ga0070704_100005086 3300005549 Bacteria 7651
71 Ga0070704_100048851 3300005549 Bacteria 2964
72 Ga0070704_100111318 3300005549 Bacteria 2084
73 Ga0068855_100000880 3300005563 Bacteria 37235
74 Ga0068857_100035419 3300005577 Bacteria 4421
75 Ga0068854_100020104 3300005578 Bacteria 4511
76 Ga0068856_100023595 3300005614 Bacteria 5982
77 Ga0070702_100001364 3300005615 Bacteria 9953
78 Ga0068852_100043798 3300005616 Bacteria 3797
79 Ga0068859_100000906 3300005617 Bacteria 30276
80 Ga0068859_100116479 3300005617 Bacteria 2737
81 Ga0068859_100192221 3300005617 Bacteria 2125
82 Ga0068864_100023385 3300005618 Bacteria 5189
83 Ga0068864_100023782 3300005618 Bacteria 5147
84 Ga0068866_10000228 3300005718 Bacteria 26370
85 Ga0068870_10153187 3300005840 Bacteria 1360
86 Ga0068863_100042981 3300005841 Bacteria 4292
87 Ga0068863_100100760 3300005841 Bacteria 2745
88 Ga0068858_100001268 3300005842 Bacteria 26119
89 Ga0068858_100028208 3300005842 Bacteria 5216
90 Ga0068858_100145324 3300005842 Bacteria 2227
91 Ga0068860_100000634 3300005843 Bacteria 41350
92 Ga0068860_100099911 3300005843 Bacteria 2768
93 Ga0068862_100013191 3300005844 Bacteria 6835
94 Ga0081455_10006431 3300005937 Bacteria 12592
95 Ga0081538_10054631 3300005981 Bacteria 2360
96 Ga0081539_10001863 3300005985 Bacteria 33168
97 Ga0075364_10002138 3300006051 Bacteria 11061
98 Ga0075364_10031646 3300006051 Bacteria 3399
99 Ga0097621_100001432 3300006237 Bacteria 16367
100 Ga0097621_100005388 3300006237 Bacteria 9017
101 Ga0068871_100001506 3300006358 Bacteria 15616
102 Ga0068871_100001528 3300006358 Bacteria 15507
103 Ga0068871_100154129 3300006358 Bacteria 1961
104 Ga0075428_100002230 3300006844 Bacteria 20981
105 Ga0075428_100173639 3300006844 Bacteria 2335
106 Ga0075430_100013776 3300006846 Bacteria 6889
107 Ga0075430_100024254 3300006846 Bacteria 5161
108 Ga0075430_100114290 3300006846 Bacteria 2249
109 Ga0075431_100006205 3300006847 Bacteria 11867
110 Ga0075431_100198555 3300006847 Bacteria 2053
111 Ga0075433_10001672 3300006852 Bacteria 16524
112 Ga0075433_10199199 3300006852 Bacteria 1781
113 Ga0075434_100000002 3300006871 Bacteria 135661
114 Ga0075434_100007238 3300006871 Bacteria 10270
115 Ga0075434_100016362 3300006871 Bacteria 7129
116 Ga0075434_100631694 3300006871 Bacteria 1089
117 Ga0075429_100000150 3300006880 Bacteria 43105
118 Ga0068865_100000276 3300006881 Bacteria 28251
119 Ga0068865_100003876 3300006881 Bacteria 8972
120 Ga0075436_100000603 3300006914 Bacteria 23562
121 Ga0075436_100001674 3300006914 Bacteria 15155
122 Ga0075436_100004083 3300006914 Bacteria 10016
123 Ga0075436_100016677 3300006914 Bacteria 5028
124 Ga0075436_100026284 3300006914 Bacteria 4008
125 Ga0075436_100053577 3300006914 Bacteria 2785
126 Ga0075436_100083408 3300006914 Bacteria 2217
127 Ga0097620_100000906 3300006931 Bacteria 30276
128 Ga0097620_100116483 3300006931 Bacteria 2737
129 Ga0097620_100192205 3300006931 Bacteria 2125
130 Ga0075435_100000089 3300007076 Bacteria 48555
131 Ga0075435_100010608 3300007076 Bacteria 6743
132 Ga0099794_10078305 3300007265 Bacteria 1627
133 Ga0099794_10092931 3300007265 Bacteria 1499
134 Ga0111539_10013589 3300009094 Bacteria 10178
135 Ga0111539_10130762 3300009094 Bacteria 2940
136 Ga0105245_10000221 3300009098 Bacteria 54253
137 Ga0105245_10090380 3300009098 Bacteria 2816
138 Ga0105245_10136158 3300009098 Bacteria 2308
139 Ga0105247_10059608 3300009101 Bacteria 2363
140 Ga0114129_10003624 3300009147 Bacteria 21726
141 Ga0114129_10028894 3300009147 Bacteria 7856
142 Ga0114129_10714052 3300009147 Bacteria 1287
143 Ga0114129_10888562 3300009147 Bacteria 1130
144 Ga0105243_10000288 3300009148 Bacteria 55680
145 Ga0105243_10012184 3300009148 Bacteria 6502
146 Ga0105241_10039260 3300009174 Bacteria 3570
147 Ga0105242_10001306 3300009176 Bacteria 19723
148 Ga0105248_10459174 3300009177 Bacteria 1436
149 Ga0105238_10120296 3300009551 Bacteria 2605
150 Ga0105249_10001638 3300009553 Bacteria 19611
151 Ga0105239_10281374 3300010375 Bacteria 1873
152 Ga0157371_10087470 3300013102 Bacteria 2207
153 Ga0157371_10120043 3300013102 Bacteria 1869
154 Ga0157378_10010643 3300013297 Bacteria 8038
155 Ga0163162_10162512 3300013306 Bacteria 2355
156 Ga0163162_10443289 3300013306 Bacteria 1431
157 Ga0157372_10124018 3300013307 Bacteria 2970
158 Ga0157375_10064022 3300013308 Bacteria 3660
159 Ga0157380_10107610 3300014326 Bacteria 2336
160 Ga0182008_10000904 3300014497 Bacteria 20630
161 Ga0157376_10001746 3300014969 Bacteria 14461
162 Ga0157376_10436625 3300014969 Bacteria 1274
163 Ga0213876_10075294 3300021384 Bacteria 1783
164 Ga0209258_102610 3300025242 Bacteria 4498
165 Ga0209455_1000596 3300025272 Bacteria 23241
166 Ga0209676_1014552 3300025292 Bacteria 2952
167 Ga0209025_1000039 3300025294 Bacteria 377396
168 Ga0209050_1000904 3300025298 Bacteria 39210
169 Ga0209051_1000298 3300025303 Bacteria 78777
170 Ga0209051_1042417 3300025303 Bacteria 1608
171 Ga0207642_10000528 3300025899 Bacteria 11712
172 Ga0207642_10031133 3300025899 Bacteria 2231
173 Ga0207647_10023637 3300025904 Bacteria 4062
174 Ga0207647_10076420 3300025904 Bacteria 2014
175 Ga0207645_10102625 3300025907 Bacteria 1846
176 Ga0207643_10147756 3300025908 Bacteria 1407
177 Ga0207707_10003043 3300025912 Bacteria 14898
178 Ga0207707_10248103 3300025912 Bacteria 1547
179 Ga0207695_10210929 3300025913 Bacteria 1853
180 Ga0207671_10169483 3300025914 Bacteria 1695
181 Ga0207660_10000702 3300025917 Bacteria 22321
182 Ga0207662_10000147 3300025918 Bacteria 33968
183 Ga0207662_10140377 3300025918 Bacteria 1530
184 Ga0207657_10083678 3300025919 Bacteria 2676
185 Ga0207652_10004183 3300025921 Bacteria 11770
186 Ga0207652_10272803 3300025921 Bacteria 1526
187 Ga0207646_10262636 3300025922 Bacteria 1560
188 Ga0207646_10339755 3300025922 Bacteria 1357
189 Ga0207687_10000574 3300025927 Bacteria 24851
190 Ga0207706_10136762 3300025933 Bacteria 2155
191 Ga0207686_10000769 3300025934 Bacteria 19713
192 Ga0207709_10000618 3300025935 Bacteria 29187
193 Ga0207709_10001207 3300025935 Bacteria 18567
194 Ga0207670_10001822 3300025936 Bacteria 11118
195 Ga0207670_10077969 3300025936 Bacteria 2310
196 Ga0207669_10246608 3300025937 Bacteria 1327
197 Ga0207704_10021117 3300025938 Bacteria 3460
198 Ga0207665_10113969 3300025939 Bacteria 1903
199 Ga0207711_10022078 3300025941 Bacteria 5320
200 Ga0207711_10265098 3300025941 Bacteria 1580
201 Ga0207711_10374355 3300025941 Bacteria 1321
202 Ga0207689_10002968 3300025942 Bacteria 15655
203 Ga0207689_10011395 3300025942 Bacteria 7619
204 Ga0207689_10032534 3300025942 Bacteria 4338
205 Ga0207661_10388722 3300025944 Bacteria 1263
206 Ga0207667_10023997 3300025949 Bacteria 6708
207 Ga0207667_10084574 3300025949 Bacteria 3284
208 Ga0207712_10004541 3300025961 Bacteria 8759
209 Ga0207668_10018884 3300025972 Bacteria 4346
210 Ga0207640_10168022 3300025981 Bacteria 1631
211 Ga0207658_10124743 3300025986 Bacteria 2059
212 Ga0207677_10001629 3300026023 Bacteria 11918
213 Ga0207677_10296601 3300026023 Bacteria 1334
214 Ga0207703_10005322 3300026035 Bacteria 10366
215 Ga0207639_10044923 3300026041 Bacteria 3325
216 Ga0207639_10085964 3300026041 Bacteria 2503
217 Ga0207708_10005166 3300026075 Bacteria 9627
218 Ga0207702_10034743 3300026078 Bacteria 4217
219 Ga0207702_10210539 3300026078 Bacteria 1807
220 Ga0207641_10064491 3300026088 Bacteria 3131
221 Ga0207648_10000362 3300026089 Bacteria 50094
222 Ga0207648_10001117 3300026089 Bacteria 30142
223 Ga0207676_10045719 3300026095 Bacteria 3384
224 Ga0207676_10173238 3300026095 Bacteria 1882
225 Ga0207674_10100541 3300026116 Bacteria 2873
226 Ga0207674_10285951 3300026116 Bacteria 1597
227 Ga0207675_100000880 3300026118 Bacteria 29964
228 Ga0207698_10035418 3300026142 Bacteria 3651
229 Ga0209967_1001323 3300027364 Bacteria 3173
230 Ga0209967_1001973 3300027364 Bacteria 2644
231 Ga0209996_1001443 3300027395 Bacteria 2870
232 Ga0209996_1004511 3300027395 Bacteria 1767
233 Ga0209968_1003523 3300027526 Bacteria 2348
234 Ga0209999_1002842 3300027543 Bacteria 3069
235 Ga0209983_1006167 3300027665 Bacteria 2469
236 Ga0209971_1003725 3300027682 Bacteria 3606
237 Ga0209998_10030928 3300027717 Bacteria 1185
238 Ga0207428_10002058 3300027907 Bacteria 20297
239 Ga0207428_10019470 3300027907 Bacteria 5786
240 Ga0207428_10058881 3300027907 Bacteria 3047
241 Ga0268265_10000457 3300028380 Bacteria 43208
242 Ga0268264_10001149 3300028381 Bacteria 25798
243 Ga0265334_10017155 3300028573 Bacteria 2995
244 Ga0265327_10013184 3300031251 Bacteria 5506
245 Ga0316575_10004408 3300031665 Bacteria 4952
246 Ga0316575_10006319 3300031665 Bacteria 4253
247 Ga0307410_10081913 3300031852 Bacteria 2269
248 Ga0307412_10000106 3300031911 Bacteria 67067
249 Ga0307416_100330189 3300032002 Bacteria 1532
250 Ga0307411_10175380 3300032005 Bacteria 1621
251 Ga0373934_0000470 3300035086 Bacteria 14084
252 Ga0373952_0020941 3300035092 Bacteria 1376
253 Ga0373923_0011957 3300035111 Bacteria 3197
254 Ga0373932_0027097 3300035112 Bacteria 1564
255 Ga0373936_0005039 3300035113 Bacteria 4972
256 Ga0373939_0082513 3300035114 Bacteria 1070
257 Ga0373941_0002999 3300035115 Bacteria 3778
258 Ga0373953_0001538 3300035117 Bacteria 6704
259 Ga0373953_0007451 3300035117 Bacteria 3665
260 Ga0373954_0000052 3300035118 Bacteria 41421
261 Ga0373954_0000859 3300035118 Bacteria 11813
262 Ga0373954_0001173 3300035118 Bacteria 10539
263 Ga0373954_0007034 3300035118 Bacteria 4908
264 Ga0373956_0000019 3300035119 Bacteria 50599
265 Ga0373956_0002840 3300035119 Bacteria 7009
266 Ga0373957_0000663 3300035120 Bacteria 8856
267 Ga0373957_0002859 3300035120 Bacteria 4992
268 Ga0373957_0083000 3300035120 Bacteria 1267
269 Ga0373960_0017610 3300035121 Bacteria 1853
270 Ga0373960_0031304 3300035121 Bacteria 1487
271 Ga0373946_0015737 3300035171 Bacteria 2873
272 Ga0373955_0005056 3300035172 Bacteria 5899
273 Ga0373955_0023387 3300035172 Bacteria 3146
274 Ga0373955_0054462 3300035172 Bacteria 2188
275 Ga0373942_0008774 3300035207 Bacteria 2362
276 Ga0373961_0013889 3300035241 Bacteria 2037
277 Ga0373962_0026850 3300035242 Bacteria 1554
278 Ga0316574_0011680 3300035398 Bacteria 5000
279 Ga0316574_0222548 3300035398 Bacteria 1209
280 Ga0373924_0000716 3300035410 Bacteria 10350
281 Ga0373931_0000307 3300035691 Bacteria 20644
282 Ga0373935_0017278 3300035692 Bacteria 4374
283 Ga0373927_0120036 3300035695 Bacteria 1716
284 Ga0373933_0012962 3300035724 Bacteria 4611
285 Ga0373933_0019539 3300035724 Bacteria 3827
286 Ga0373947_0028426 3300035725 Bacteria 3278
287 Ga0373937_0000645 3300036401 Bacteria 30604
288 Ga0373937_0000781 3300036401 Bacteria 27352
289 Ga0373937_0093304 3300036401 Bacteria 2791
290 Ga0373937_0174297 3300036401 Bacteria 2018
291 Ga0373925_0056004 3300037068 Bacteria 2952
292 Ga0395899_0090907 3300037312 Bacteria 2213
293 Ga0395900_0001711 3300037418 Bacteria 25377
294 Ga0395900_0004673 3300037418 Bacteria 14438
295 Ga0395900_0004688 3300037418 Bacteria 14414
296 Ga0395900_0005230 3300037418 Bacteria 13619
297 Ga0395900_0119411 3300037418 Bacteria 2706
298 Ga0395898_0004767 3300037466 Bacteria 14763
299 Ga0395905_0000844 3300037471 Bacteria 40009
300 Ga0395905_0255852 3300037471 Bacteria 1635
301 Ga0395901_0010625 3300038443 Bacteria 9328
302 Ga0395901_0032520 3300038443 Bacteria 5381
303 Ga0395901_0206101 3300038443 Bacteria 2060
304 Ga0451855_0606830 3300041511 Bacteria 1840
305 Ga0439441_000508 3300042001 Bacteria 4260
306 Ga0439435_0017748 3300042436 Bacteria 1803
307 Ga0439460_0000008 3300042461 Bacteria 30223
308 Ga0451577_0002438 3300042876 Bacteria 22187
309 Ga0451577_0005329 3300042876 Bacteria 13213
310 Ga0451577_0120917 3300042876 Bacteria 2345
311 Ga0453684_0198717 3300044712 Bacteria 2339
312 Ga0453684_0397811 3300044712 Bacteria 1543
313 Ga0451576_0001013 3300045051 Bacteria 51916
314 Ga0451576_0002279 3300045051 Bacteria 29284
315 Ga0451576_0016576 3300045051 Bacteria 8126
316 Ga0466967_0011832 3300045976 Bacteria 6637
317 Ga0495627_004706 3300046453 Bacteria 5643
318 Ga0495592_0005407 3300046454 Bacteria 9427
319 Ga0495592_0016262 3300046454 Bacteria 5645
320 Ga0495592_0019515 3300046454 Bacteria 5156
321 Ga0495592_0022559 3300046454 Bacteria 4789
322 Ga0495603_0056677 3300046455 Bacteria 2319
323 Ga0495603_0130308 3300046455 Bacteria 1465
324 Ga0495590_0000038 3300046457 Bacteria 127040
325 Ga0495590_0003424 3300046457 Bacteria 6478
326 Ga0495591_000214 3300046458 Bacteria 58417
327 Ga0495651_0010533 3300046462 Bacteria 7106
328 Ga0495651_0064189 3300046462 Bacteria 2806
329 Ga0495653_0012139 3300046463 Bacteria 7029
330 Ga0495653_0125599 3300046463 Bacteria 1822
331 Ga0495580_0084661 3300046472 Bacteria 2208
332 Ga0495639_0001353 3300046475 Bacteria 11001
333 Ga0495639_0050190 3300046475 Bacteria 1895
334 Ga0495662_0000837 3300046476 Bacteria 14929
335 Ga0495664_0010041 3300046477 Bacteria 5309
336 Ga0495584_0000429 3300046491 Bacteria 28957
337 Ga0495584_0001438 3300046491 Bacteria 14342
338 Ga0495585_0003308 3300046492 Bacteria 10942
339 Ga0495585_0007112 3300046492 Bacteria 6876
340 Ga0495594_0001543 3300046499 Bacteria 11956
341 Ga0495594_0033176 3300046499 Bacteria 2805
342 Ga0495596_0000918 3300046500 Bacteria 17539
343 Ga0495596_0025563 3300046500 Bacteria 2386
344 Ga0495596_0026937 3300046500 Bacteria 2314
345 Ga0495607_0000009 3300046501 Bacteria 216674
346 Ga0495607_0002073 3300046501 Bacteria 16741
347 Ga0495583_0006913 3300046506 Bacteria 7294
348 Ga0495606_0024408 3300046507 Bacteria 4357
349 Ga0495608_0000439 3300046511 Bacteria 29042
350 Ga0495608_0019614 3300046511 Bacteria 4652
351 Ga0495608_0070876 3300046511 Bacteria 2275
352 Ga0495610_0000481 3300046512 Bacteria 41196
353 Ga0495616_0022574 3300046513 Bacteria 3398
354 Ga0495616_0058908 3300046513 Bacteria 1890
355 Ga0495618_0003523 3300046514 Bacteria 9723
356 Ga0495618_0005327 3300046514 Bacteria 7850
357 Ga0495628_0000681 3300046516 Bacteria 31276
358 Ga0495628_0001953 3300046516 Bacteria 18701
359 Ga0495628_0014895 3300046516 Bacteria 6502
360 Ga0495628_0017207 3300046516 Bacteria 6021
361 Ga0495630_0003806 3300046517 Bacteria 10526
362 Ga0495630_0133784 3300046517 Bacteria 1884
363 Ga0495630_0202332 3300046517 Bacteria 1515
364 Ga0495631_0000290 3300046518 Bacteria 35042
365 Ga0495631_0001484 3300046518 Bacteria 14221
366 Ga0495632_0000403 3300046519 Bacteria 40753
367 Ga0495637_0000003 3300046520 Bacteria 623293
368 Ga0495643_0034379 3300046522 Bacteria 2798
369 Ga0495644_0005654 3300046523 Bacteria 4876
370 Ga0495644_0023665 3300046523 Bacteria 2338
371 Ga0495644_0044660 3300046523 Bacteria 1667
372 Ga0495648_0124826 3300046524 Bacteria 1377
373 Ga0495666_0008954 3300046526 Bacteria 5010
374 Ga0495666_0025688 3300046526 Bacteria 2908
375 Ga0495642_0002404 3300046528 Bacteria 7621
376 Ga0495642_0005355 3300046528 Bacteria 4922
377 Ga0495642_0048624 3300046528 Bacteria 1740
378 Ga0495652_0002007 3300046529 Bacteria 21698
379 Ga0495640_0003703 3300046533 Bacteria 12278
380 Ga0495640_0045620 3300046533 Bacteria 3040
381 Ga0495586_0000894 3300046535 Bacteria 17010
382 Ga0495586_0016421 3300046535 Bacteria 3937
383 Ga0495586_0033127 3300046535 Bacteria 2772
384 Ga0495587_0006531 3300046536 Bacteria 7599
385 Ga0495587_0017253 3300046536 Bacteria 4487
386 Ga0495587_0060017 3300046536 Bacteria 2231
387 Ga0495587_0175258 3300046536 Bacteria 1217
388 Ga0495598_0009521 3300046537 Bacteria 2300
389 Ga0495597_0000349 3300046542 Bacteria 41320
390 Ga0495645_0000366 3300046543 Bacteria 31440
391 Ga0495633_0003404 3300046558 Bacteria 10620
392 Ga0495667_0000661 3300046559 Bacteria 22019
393 Ga0495667_0016446 3300046559 Bacteria 4997
394 Ga0495656_0087622 3300046615 Bacteria 1418
395 Ga0495668_0000359 3300046616 Bacteria 60366
396 Ga0495668_0000699 3300046616 Bacteria 40382
397 Ga0495668_0019173 3300046616 Bacteria 3947
398 Ga0495634_0001760 3300046642 Bacteria 18738
399 Ga0495634_0023506 3300046642 Bacteria 4330
400 Ga0495611_0000317 3300046648 Bacteria 32281
401 Ga0495611_0012445 3300046648 Bacteria 3617
402 Ga0495635_0008699 3300046663 Bacteria 7090
403 Ga0495635_0174272 3300046663 Bacteria 1462
404 Ga0495659_0044460 3300046664 Bacteria 1597
405 Ga0495661_0000819 3300046665 Bacteria 29159
406 Ga0495661_0001210 3300046665 Bacteria 22396
407 Ga0495657_0007439 3300046675 Bacteria 8459
408 Ga0495599_0001911 3300046678 Bacteria 12058
409 Ga0495599_0043119 3300046678 Bacteria 2831
410 Ga0495647_0006405 3300046681 Bacteria 3895
411 Ga0495647_0006529 3300046681 Bacteria 3869
412 Ga0495658_0007805 3300046683 Bacteria 5297
413 Ga0495669_0001079 3300046684 Bacteria 11311
414 Ga0495669_0011974 3300046684 Bacteria 3688
415 Ga0495669_0099213 3300046684 Bacteria 1351
416 Ga0495613_0007324 3300046689 Bacteria 8216
417 Ga0495613_0031960 3300046689 Bacteria 3909
418 Ga0495670_0051251 3300046691 Bacteria 2065
419 Ga0495671_0002860 3300046692 Bacteria 10800
420 Ga0495649_0025663 3300046694 Bacteria 3281
421 Ga0495600_0028496 3300046809 Bacteria 3613
422 Ga0495600_0047634 3300046809 Bacteria 2796
423 Ga0495660_0008267 3300046810 Bacteria 6095
424 Ga0495660_0013180 3300046810 Bacteria 4790
425 Ga0495660_0053281 3300046810 Bacteria 2196
426 Ga0495604_0018005 3300047317 Bacteria 5654
427 Ga0495604_0188260 3300047317 Bacteria 1440
428 Ga0495636_0036912 3300047318 Bacteria 2017
429 Ga0495674_0005349 3300047319 Bacteria 12320
430 Ga0495672_0000613 3300047320 Bacteria 39882
431 Ga0495676_0007493 3300047321 Bacteria 10009
432 Ga0495680_0002911 3300047322 Bacteria 17205
433 Ga0495680_0027038 3300047322 Bacteria 4720
434 Ga0495680_0035899 3300047322 Bacteria 3986
435 Ga0495680_0040245 3300047322 Bacteria 3725
436 Ga0495675_0027617 3300047444 Bacteria 3616
437 Ga0495677_0000156 3300047445 Bacteria 32695
438 Ga0495679_001947 3300047446 Bacteria 11028
439 Ga0495679_013232 3300047446 Bacteria 3106
440 Ga0495685_036197 3300047447 Bacteria 1694
441 Ga0495681_0001507 3300047470 Bacteria 17394
442 Ga0495681_0023570 3300047470 Bacteria 3266
443 Ga0495684_0022750 3300047471 Bacteria 4820
444 Ga0495684_0107191 3300047471 Bacteria 2110
445 Ga0495686_0000381 3300047472 Bacteria 70993
446 Ga0495686_0000846 3300047472 Bacteria 39307
447 Ga0495686_0011458 3300047472 Bacteria 6244
448 Ga0495626_0006746 3300048091 Bacteria 6493
449 Ga0495626_0035635 3300048091 Bacteria 2374
450 Ga0495626_0061992 3300048091 Bacteria 1699
451 Ga0495626_0070416 3300048091 Bacteria 1573
452 Ga0496100_0130637 3300048903 Bacteria 1768
453 Ga0496101_0192711 3300048904 Bacteria 1573
454 Ga0496105_0072416 3300048908 Bacteria 2848
455 Ga0496109_0063874 3300048912 Bacteria 3367
456 Ga0496113_0003150 3300048916 Bacteria 9819
457 Ga0496118_0022065 3300048921 Bacteria 5581
458 Ga0496118_0040114 3300048921 Bacteria 3726
459 Ga0496119_0005661 3300048922 Bacteria 11855
460 Ga0496120_0003037 3300048923 Bacteria 15840
461 Ga0496121_0000165 3300048924 Bacteria 145052
462 Ga0496121_0027758 3300048924 Bacteria 5289
463 Ga0496123_0000966 3300048926 Bacteria 44396
464 Ga0496124_0000007 3300048927 Bacteria 883534
465 Ga0496125_0000121 3300048928 Bacteria 174971
466 Ga0496125_0003065 3300048928 Bacteria 20867
467 Ga0496125_0029029 3300048928 Bacteria 4980
468 Ga0495678_000652 3300049459 Bacteria 31953
469 Ga0495678_001446 3300049459 Bacteria 18703
470 Ga0495682_0005681 3300049460 Bacteria 5151
471 Ga0501031_0014068 3300049568 Bacteria 5206
472 Ga0501032_0056266 3300049569 Bacteria 2644
473 Ga0501033_0000919 3300049570 Bacteria 26915
474 Ga0501033_0008890 3300049570 Bacteria 7759
475 Ga0501033_0050339 3300049570 Bacteria 3091
476 Ga0501034_0015074 3300049571 Bacteria 7947
477 Ga0501034_0299001 3300049571 Bacteria 1546
478 Ga0501036_0000418 3300049572 Bacteria 29982
479 Ga0501036_0000974 3300049572 Bacteria 21624
480 Ga0501037_0002535 3300049573 Bacteria 13194
481 Ga0501037_0015192 3300049573 Bacteria 5665
482 Ga0501038_0000189 3300049574 Bacteria 53371
483 Ga0501038_0001437 3300049574 Bacteria 21855
484 Ga0501038_0043569 3300049574 Bacteria 3902
485 Ga0501038_0058153 3300049574 Bacteria 3316
486 Ga0501039_0000247 3300049575 Bacteria 39539
487 Ga0501039_0001909 3300049575 Bacteria 15432
488 Ga0501040_0017391 3300049576 Bacteria 4772
489 Ga0501040_0029406 3300049576 Bacteria 3708
490 Ga0501040_0040415 3300049576 Bacteria 3174
491 Ga0501040_0066095 3300049576 Bacteria 2491
492 Ga0501041_0000032 3300049577 Bacteria 44999
493 Ga0501041_0048172 3300049577 Bacteria 2595
494 Ga0501043_0000727 3300049579 Bacteria 29186
495 Ga0501043_0114295 3300049579 Bacteria 2119
496 Ga0501046_0000156 3300049580 Bacteria 70512
497 Ga0501046_0001315 3300049580 Bacteria 24072
498 Ga0501046_0025304 3300049580 Bacteria 4859
499 Ga0501046_0123646 3300049580 Bacteria 1967
500 Ga0501046_0140667 3300049580 Bacteria 1826
501 Ga0501047_0003680 3300049581 Bacteria 14449
502 Ga0501047_0130282 3300049581 Bacteria 2396
503 Ga0501067_0038157 3300049583 Bacteria 2668
504 Ga0501070_0016624 3300049586 Bacteria 6181
505 Ga0501071_0004130 3300049587 Bacteria 9179
506 Ga0501071_0009047 3300049587 Bacteria 6612
507 Ga0501071_0023569 3300049587 Bacteria 4299
508 Ga0501072_0002789 3300049588 Bacteria 13112
509 Ga0501072_0033056 3300049588 Bacteria 4052
510 Ga0501075_0000053 3300049591 Bacteria 49110
511 Ga0501075_0000179 3300049591 Bacteria 32841
512 Ga0501075_0000790 3300049591 Bacteria 19774
513 Ga0501076_0000575 3300049592 Bacteria 23441
514 Ga0501076_0000683 3300049592 Bacteria 21818
515 Ga0501076_0002082 3300049592 Bacteria 13718
516 Ga0501076_0108769 3300049592 Bacteria 2239
517 Ga0501077_0003937 3300049593 Bacteria 8950
518 Ga0501077_0057987 3300049593 Bacteria 2458
519 Ga0501079_0001973 3300049741 Bacteria 14712
520 Ga0501079_0008097 3300049741 Bacteria 7962
521 Ga0501080_0003200 3300049742 Bacteria 14440
522 Ga0501080_0027030 3300049742 Bacteria 5335
523 Ga0501080_0161465 3300049742 Bacteria 2069
524 Ga0501081_0000127 3300049743 Bacteria 33437
525 Ga0501035_0001123 3300049822 Bacteria 27958
526 Ga0501035_0016865 3300049822 Bacteria 6733
527 Ga0501035_0051757 3300049822 Bacteria 3675
528 Ga0501035_0074262 3300049822 Bacteria 3008
529 Ga0501035_0075583 3300049822 Bacteria 2979
530 Ga0501044_0001590 3300049823 Bacteria 26597
531 Ga0501044_0002136 3300049823 Bacteria 22649
532 Ga0501044_0014614 3300049823 Bacteria 8465
533 Ga0501044_0016393 3300049823 Bacteria 7955
534 Ga0501044_0048025 3300049823 Bacteria 4412
535 Ga0501045_0000135 3300049824 Bacteria 38657
536 Ga0501045_0000372 3300049824 Bacteria 26953
537 Ga0501045_0061022 3300049824 Bacteria 2765
538 nmdc:mga00v17_15848_c1 3300050491 Bacteria 4239
539 nmdc:mga00v17_1834_c1 3300050491 Bacteria 10994
540 nmdc:mga00v17_38375_c1 3300050491 Bacteria 2864
541 nmdc:mga05p37_1475_c1 3300050507 Bacteria 27330
542 nmdc:mga05p37_34342_c1 3300050507 Bacteria 6211
543 nmdc:mga09592_49624_c1 3300050508 Bacteria 3539
544 nmdc:mga09592_8451_c1 3300050508 Bacteria 8371
545 nmdc:mga06r32_48118_c1 3300050510 Bacteria 4076
546 nmdc:mga06r32_66161_c1 3300050510 Bacteria 3487
547 nmdc:mga08y16_17429_c1 3300050511 Bacteria 7563
548 nmdc:mga08y16_7366_c1 3300050511 Bacteria 11540
549 nmdc:mga08y16_79454_c1 3300050511 Bacteria 3419
550 nmdc:mga08y16_8395_c1 3300050511 Bacteria 10808
551 nmdc:mga0n895_1409_c1 3300050512 Bacteria 17946
552 nmdc:mga0n895_36967_c1 3300050512 Bacteria 4720
553 nmdc:mga0n895_3845_c1 3300050512 Bacteria 12188
554 nmdc:mga0rr50_128_c1 3300050513 Bacteria 41482
555 nmdc:mga0rr50_268168_c1 3300050513 Bacteria 1422
556 nmdc:mga0rr50_300936_c1 3300050513 Bacteria 1342
557 nmdc:mga0rr50_7448_c1 3300050513 Bacteria 6753
558 nmdc:mga08x19_10877_c1 3300050514 Bacteria 5472
559 nmdc:mga08x19_159004_c1 3300050514 Bacteria 1534
560 nmdc:mga08x19_191358_c1 3300050514 Bacteria 1400
561 nmdc:mga08x19_2600_c1 3300050514 Bacteria 10959
562 nmdc:mga08x19_434_c1 3300050514 Bacteria 28646
563 nmdc:mga08x19_61650_c1 3300050514 Bacteria 2431
564 nmdc:mga08x19_96362_c1 3300050514 Bacteria 1958
565 nmdc:mga0a205_160_c1 3300050515 Bacteria 44269
566 nmdc:mga0a205_24856_c1 3300050515 Bacteria 5141
567 Ga0495601_0001843 3300053077 Bacteria 11784
568 Ga0495601_0220306 3300053077 Bacteria 1239
569 Ga0495612_0049481 3300053078 Bacteria 1725
570 Ga0495595_0048224 3300053084 Bacteria 1966
571 Ga0495619_0013961 3300053085 Bacteria 5068
572 Ga0500634_0037184 3300053161 Bacteria 2648
573 Ga0500645_013205 3300053730 Bacteria 2656
574 Ga0501084_0016187 3300054114 Bacteria 6193
575 Ga0501082_0002807 3300060353 Bacteria 15203
576 Ga0501082_0006238 3300060353 Bacteria 10350
577 Ga0530510_0000115 3300061734 Bacteria 45273
578 Ga0530510_0000160 3300061734 Bacteria 40364

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035114 Ga0373939_0082513 Ga0373939_0082513_11_799 253
2 3300005544 Ga0070686_100287090 Ga0070686_1002870902 254
3 3300046511 Ga0495608_0070876 Ga0495608_0070876_1315_2184 279
4 3300046810 Ga0495660_0053281 Ga0495660_0053281_1206_2177 281
5 3300037418 Ga0395900_0119411 Ga0395900_0119411_92_1069 306
6 3300038443 Ga0395901_0032520 Ga0395901_0032520_4014_4991 306
7 3300050491 nmdc:mga00v17_38375_c1 nmdc:mga00v17_38375_c1_166_1266 306
8 3300021384 Ga0213876_10075294 Ga0213876_100752942 307
9 3300031251 Ga0265327_10013184 Ga0265327_100131844 307
10 3300046491 Ga0495584_0000429 Ga0495584_0000429_11325_12386 307
11 3300046648 Ga0495611_0000317 Ga0495611_0000317_20772_21833 307
12 3300049574 Ga0501038_0043569 Ga0501038_0043569_362_1336 307
13 3300049575 Ga0501039_0001909 Ga0501039_0001909_12062_13036 307
14 3300049579 Ga0501043_0114295 Ga0501043_0114295_449_1423 307
15 3300049580 Ga0501046_0123646 Ga0501046_0123646_354_1328 307
16 3300049587 Ga0501071_0023569 Ga0501071_0023569_470_1444 307
17 3300049591 Ga0501075_0000790 Ga0501075_0000790_11236_12210 307
18 3300049592 Ga0501076_0002082 Ga0501076_0002082_11303_12277 307
19 3300049592 Ga0501076_0108769 Ga0501076_0108769_1204_2178 307
20 3300049593 Ga0501077_0057987 Ga0501077_0057987_1424_2398 307
21 3300049742 Ga0501080_0003200 Ga0501080_0003200_10481_11455 307
22 3300049824 Ga0501045_0000135 Ga0501045_0000135_19644_20618 307
23 3300060353 Ga0501082_0006238 Ga0501082_0006238_8901_9875 307
24 iso_pu_bacteria 2857542790 2857543920 307
25 iso_pu_bacteria 2895511927 2895513901 307
26 3300003763 Ga0055529_1000873 Ga0055529_100087315 308
27 3300025292 Ga0209676_1014552 Ga0209676_10145522 308
28 3300025298 Ga0209050_1000904 Ga0209050_10009048 308
29 3300025303 Ga0209051_1042417 Ga0209051_10424172 308
30 3300035120 Ga0373957_0083000 Ga0373957_0083000_11_964 308
31 3300046500 Ga0495596_0025563 Ga0495596_0025563_1314_2375 308
32 3300046810 Ga0495660_0008267 Ga0495660_0008267_2242_3303 308
33 3300047472 Ga0495686_0000846 Ga0495686_0000846_4547_5608 308
34 3300048921 Ga0496118_0040114 Ga0496118_0040114_791_1912 308
35 3300048924 Ga0496121_0027758 Ga0496121_0027758_3670_4773 308
36 3300048928 Ga0496125_0029029 Ga0496125_0029029_1295_2416 308
37 3300049460 Ga0495682_0005681 Ga0495682_0005681_1747_2808 308
38 3300049822 Ga0501035_0074262 Ga0501035_0074262_867_1949 308
39 3300049823 Ga0501044_0001590 Ga0501044_0001590_12624_13703 308
40 3300037471 Ga0395905_0000844 Ga0395905_0000844_24806_25846 309
41 3300046453 Ga0495627_004706 Ga0495627_004706_573_1622 309
42 3300046457 Ga0495590_0000038 Ga0495590_0000038_116130_117191 309
43 3300046458 Ga0495591_000214 Ga0495591_000214_4518_5579 309
44 3300046492 Ga0495585_0003308 Ga0495585_0003308_3419_4480 309
45 3300046492 Ga0495585_0007112 Ga0495585_0007112_3141_4202 309
46 3300046500 Ga0495596_0026937 Ga0495596_0026937_924_1985 309
47 3300046501 Ga0495607_0002073 Ga0495607_0002073_12052_13113 309
48 3300046512 Ga0495610_0000481 Ga0495610_0000481_3757_4818 309
49 3300046518 Ga0495631_0000290 Ga0495631_0000290_11315_12376 309
50 3300046520 Ga0495637_0000003 Ga0495637_0000003_564347_565408 309
51 3300046523 Ga0495644_0005654 Ga0495644_0005654_2022_3083 309
52 3300046528 Ga0495642_0005355 Ga0495642_0005355_3091_4152 309
53 3300046528 Ga0495642_0048624 Ga0495642_0048624_471_1532 309
54 3300046558 Ga0495633_0003404 Ga0495633_0003404_3097_4158 309
55 3300046616 Ga0495668_0019173 Ga0495668_0019173_667_1728 309
56 3300046648 Ga0495611_0012445 Ga0495611_0012445_1028_2089 309
57 3300046665 Ga0495661_0001210 Ga0495661_0001210_3177_4238 309
58 3300046684 Ga0495669_0001079 Ga0495669_0001079_2585_3646 309
59 3300046691 Ga0495670_0051251 Ga0495670_0051251_672_1721 309
60 3300046810 Ga0495660_0013180 Ga0495660_0013180_3254_4315 309
61 3300047320 Ga0495672_0000613 Ga0495672_0000613_26997_28058 309
62 3300047445 Ga0495677_0000156 Ga0495677_0000156_22298_23359 309
63 3300047446 Ga0495679_013232 Ga0495679_013232_1485_2546 309
64 3300047470 Ga0495681_0001507 Ga0495681_0001507_10257_11312 309
65 3300047470 Ga0495681_0023570 Ga0495681_0023570_1057_2118 309
66 3300047472 Ga0495686_0011458 Ga0495686_0011458_1816_2877 309
67 3300048091 Ga0495626_0006746 Ga0495626_0006746_3177_4238 309
68 3300049459 Ga0495678_000652 Ga0495678_000652_30867_31928 309
69 iso_pu_bacteria 2738541280 2738738234 309
70 iso_pu_bacteria 2808606418 2809146025 309
71 iso_pu_bacteria 2904449895 2904454322 309
72 iso_pu_bacteria 2904456579 2904462682 309
73 iso_pu_bacteria 2945972063 2945977278 309
74 3300005262 Ga0065165_1001794 Ga0065165_100179413 310
75 3300005295 Ga0065707_10031107 Ga0065707_100311072 310
76 3300005937 Ga0081455_10006431 Ga0081455_100064317 310
77 3300006051 Ga0075364_10002138 Ga0075364_1000213812 310
78 3300025941 Ga0207711_10374355 Ga0207711_103743551 310
79 3300037471 Ga0395905_0255852 Ga0395905_0255852_278_1333 310
80 3300046457 Ga0495590_0003424 Ga0495590_0003424_536_1597 310
81 3300046463 Ga0495653_0125599 Ga0495653_0125599_289_1356 310
82 3300046499 Ga0495594_0001543 Ga0495594_0001543_9233_10282 310
83 3300046506 Ga0495583_0006913 Ga0495583_0006913_3831_4898 310
84 3300046507 Ga0495606_0024408 Ga0495606_0024408_1795_2850 310
85 3300046513 Ga0495616_0022574 Ga0495616_0022574_2166_3227 310
86 3300046518 Ga0495631_0001484 Ga0495631_0001484_9931_10992 310
87 3300046523 Ga0495644_0023665 Ga0495644_0023665_1068_2117 310
88 3300046526 Ga0495666_0025688 Ga0495666_0025688_1657_2706 310
89 3300046528 Ga0495642_0002404 Ga0495642_0002404_5585_6634 310
90 3300046536 Ga0495587_0060017 Ga0495587_0060017_43_1110 310
91 3300046616 Ga0495668_0000359 Ga0495668_0000359_35278_36339 310
92 3300046665 Ga0495661_0000819 Ga0495661_0000819_9971_11026 310
93 3300046694 Ga0495649_0025663 Ga0495649_0025663_1895_2950 310
94 3300047322 Ga0495680_0035899 Ga0495680_0035899_808_1863 310
95 3300047446 Ga0495679_001947 Ga0495679_001947_8890_9951 310
96 3300047447 Ga0495685_036197 Ga0495685_036197_172_1233 310
97 3300048091 Ga0495626_0035635 Ga0495626_0035635_1087_2136 310
98 3300048903 Ga0496100_0130637 Ga0496100_0130637_493_1548 310
99 3300048904 Ga0496101_0192711 Ga0496101_0192711_477_1532 310
100 3300049583 Ga0501067_0038157 Ga0501067_0038157_1121_2176 310
101 iso_pu_bacteria 2939669807 2939672384 310
102 3300005330 Ga0070690_100156202 Ga0070690_1001562022 311
103 3300005440 Ga0070705_100216425 Ga0070705_1002164252 311
104 3300005444 Ga0070694_100071945 Ga0070694_1000719453 311
105 3300005458 Ga0070681_10000135 Ga0070681_1000013536 311
106 3300005468 Ga0070707_100246947 Ga0070707_1002469472 311
107 3300005518 Ga0070699_100031058 Ga0070699_1000310583 311
108 3300005536 Ga0070697_100042484 Ga0070697_1000424843 311
109 3300005536 Ga0070697_100051073 Ga0070697_1000510732 311
110 3300005545 Ga0070695_100003131 Ga0070695_1000031318 311
111 3300005546 Ga0070696_100001158 Ga0070696_1000011584 311
112 3300005549 Ga0070704_100048851 Ga0070704_1000488513 311
113 3300005841 Ga0068863_100100760 Ga0068863_1001007603 311
114 3300006846 Ga0075430_100114290 Ga0075430_1001142902 311
115 3300006847 Ga0075431_100198555 Ga0075431_1001985552 311
116 3300006871 Ga0075434_100016362 Ga0075434_1000163624 311
117 3300006914 Ga0075436_100001674 Ga0075436_10000167410 311
118 3300006914 Ga0075436_100016677 Ga0075436_1000166774 311
119 3300006914 Ga0075436_100026284 Ga0075436_1000262843 311
120 3300006914 Ga0075436_100053577 Ga0075436_1000535773 311
121 3300006914 Ga0075436_100083408 Ga0075436_1000834083 311
122 3300025912 Ga0207707_10003043 Ga0207707_100030432 311
123 3300025936 Ga0207670_10077969 Ga0207670_100779693 311
124 3300032005 Ga0307411_10175380 Ga0307411_101753802 311
125 3300035111 Ga0373923_0011957 Ga0373923_0011957_19_993 311
126 3300035113 Ga0373936_0005039 Ga0373936_0005039_2404_3378 311
127 3300035115 Ga0373941_0002999 Ga0373941_0002999_803_1768 311
128 3300035117 Ga0373953_0001538 Ga0373953_0001538_2274_3248 311
129 3300035117 Ga0373953_0007451 Ga0373953_0007451_1563_2525 311
130 3300035118 Ga0373954_0007034 Ga0373954_0007034_3059_4033 311
131 3300035119 Ga0373956_0002840 Ga0373956_0002840_350_1324 311
132 3300035120 Ga0373957_0002859 Ga0373957_0002859_3684_4658 311
133 3300035121 Ga0373960_0017610 Ga0373960_0017610_277_1242 311
134 3300035171 Ga0373946_0015737 Ga0373946_0015737_477_1451 311
135 3300035172 Ga0373955_0005056 Ga0373955_0005056_1775_2749 311
136 3300035172 Ga0373955_0023387 Ga0373955_0023387_1841_2803 311
137 3300035172 Ga0373955_0054462 Ga0373955_0054462_591_1556 311
138 3300035207 Ga0373942_0008774 Ga0373942_0008774_1312_2277 311
139 3300035398 Ga0316574_0011680 Ga0316574_0011680_1784_2749 311
140 3300035410 Ga0373924_0000716 Ga0373924_0000716_2046_3020 311
141 3300035692 Ga0373935_0017278 Ga0373935_0017278_2164_3138 311
142 3300035724 Ga0373933_0012962 Ga0373933_0012962_350_1324 311
143 3300036401 Ga0373937_0093304 Ga0373937_0093304_1380_2345 311
144 3300036401 Ga0373937_0174297 Ga0373937_0174297_350_1324 311
145 3300037068 Ga0373925_0056004 Ga0373925_0056004_494_1468 311
146 3300046454 Ga0495592_0005407 Ga0495592_0005407_3403_4368 311
147 3300046454 Ga0495592_0016262 Ga0495592_0016262_3024_3998 311
148 3300046454 Ga0495592_0022559 Ga0495592_0022559_122_1096 311
149 3300046455 Ga0495603_0130308 Ga0495603_0130308_108_1082 311
150 3300046462 Ga0495651_0010533 Ga0495651_0010533_3196_4170 311
151 3300046463 Ga0495653_0012139 Ga0495653_0012139_2374_3348 311
152 3300046472 Ga0495580_0084661 Ga0495580_0084661_885_1859 311
153 3300046475 Ga0495639_0001353 Ga0495639_0001353_9452_10426 311
154 3300046476 Ga0495662_0000837 Ga0495662_0000837_5097_6062 311
155 3300046477 Ga0495664_0010041 Ga0495664_0010041_3879_4853 311
156 3300046499 Ga0495594_0033176 Ga0495594_0033176_1174_2148 311
157 3300046511 Ga0495608_0000439 Ga0495608_0000439_24803_25768 311
158 3300046511 Ga0495608_0019614 Ga0495608_0019614_3329_4303 311
159 3300046514 Ga0495618_0003523 Ga0495618_0003523_8400_9374 311
160 3300046514 Ga0495618_0005327 Ga0495618_0005327_6222_7187 311
161 3300046516 Ga0495628_0000681 Ga0495628_0000681_29115_30089 311
162 3300046516 Ga0495628_0001953 Ga0495628_0001953_504_1469 311
163 3300046516 Ga0495628_0014895 Ga0495628_0014895_5049_6023 311
164 3300046516 Ga0495628_0017207 Ga0495628_0017207_4594_5568 311
165 3300046517 Ga0495630_0003806 Ga0495630_0003806_7348_8322 311
166 3300046517 Ga0495630_0202332 Ga0495630_0202332_289_1254 311
167 3300046522 Ga0495643_0034379 Ga0495643_0034379_136_1185 311
168 3300046524 Ga0495648_0124826 Ga0495648_0124826_259_1320 311
169 3300046526 Ga0495666_0008954 Ga0495666_0008954_746_1720 311
170 3300046529 Ga0495652_0002007 Ga0495652_0002007_16229_17203 311
171 3300046533 Ga0495640_0003703 Ga0495640_0003703_5219_6184 311
172 3300046533 Ga0495640_0045620 Ga0495640_0045620_594_1568 311
173 3300046535 Ga0495586_0000894 Ga0495586_0000894_5239_6204 311
174 3300046535 Ga0495586_0016421 Ga0495586_0016421_350_1324 311
175 3300046536 Ga0495587_0006531 Ga0495587_0006531_1905_2870 311
176 3300046536 Ga0495587_0017253 Ga0495587_0017253_1835_2809 311
177 3300046536 Ga0495587_0175258 Ga0495587_0175258_158_1132 311
178 3300046542 Ga0495597_0000349 Ga0495597_0000349_30439_31506 311
179 3300046543 Ga0495645_0000366 Ga0495645_0000366_11708_12682 311
180 3300046559 Ga0495667_0000661 Ga0495667_0000661_308_1273 311
181 3300046559 Ga0495667_0016446 Ga0495667_0016446_1601_2575 311
182 3300046615 Ga0495656_0087622 Ga0495656_0087622_12_977 311
183 3300046616 Ga0495668_0000699 Ga0495668_0000699_11128_12189 311
184 3300046642 Ga0495634_0001760 Ga0495634_0001760_344_1309 311
185 3300046642 Ga0495634_0023506 Ga0495634_0023506_983_1957 311
186 3300046663 Ga0495635_0008699 Ga0495635_0008699_3448_4422 311
187 3300046663 Ga0495635_0174272 Ga0495635_0174272_291_1256 311
188 3300046675 Ga0495657_0007439 Ga0495657_0007439_3277_4251 311
189 3300046678 Ga0495599_0001911 Ga0495599_0001911_9109_10083 311
190 3300046678 Ga0495599_0043119 Ga0495599_0043119_1508_2482 311
191 3300046681 Ga0495647_0006405 Ga0495647_0006405_2392_3366 311
192 3300046683 Ga0495658_0007805 Ga0495658_0007805_1838_2812 311
193 3300046689 Ga0495613_0007324 Ga0495613_0007324_10_975 311
194 3300046689 Ga0495613_0031960 Ga0495613_0031960_1458_2432 311
195 3300046692 Ga0495671_0002860 Ga0495671_0002860_9708_10757 311
196 3300046809 Ga0495600_0028496 Ga0495600_0028496_2521_3486 311
197 3300046809 Ga0495600_0047634 Ga0495600_0047634_1473_2447 311
198 3300047317 Ga0495604_0018005 Ga0495604_0018005_4440_5405 311
199 3300047317 Ga0495604_0188260 Ga0495604_0188260_367_1332 311
200 3300047319 Ga0495674_0005349 Ga0495674_0005349_3001_3975 311
201 3300047322 Ga0495680_0002911 Ga0495680_0002911_15442_16407 311
202 3300047322 Ga0495680_0027038 Ga0495680_0027038_2274_3248 311
203 3300047444 Ga0495675_0027617 Ga0495675_0027617_1432_2406 311
204 3300047471 Ga0495684_0022750 Ga0495684_0022750_695_1669 311
205 3300047471 Ga0495684_0107191 Ga0495684_0107191_1116_2090 311
206 3300047472 Ga0495686_0000381 Ga0495686_0000381_49035_50099 311
207 3300048091 Ga0495626_0061992 Ga0495626_0061992_546_1589 311
208 3300048091 Ga0495626_0070416 Ga0495626_0070416_42_1103 311
209 3300048912 Ga0496109_0063874 Ga0496109_0063874_366_1409 311
210 3300048916 Ga0496113_0003150 Ga0496113_0003150_6317_7360 311
211 3300048926 Ga0496123_0000966 Ga0496123_0000966_35554_36597 311
212 3300048928 Ga0496125_0003065 Ga0496125_0003065_10631_11674 311
213 3300049459 Ga0495678_001446 Ga0495678_001446_9916_10953 311
214 3300049568 Ga0501031_0014068 Ga0501031_0014068_1049_2158 311
215 3300049569 Ga0501032_0056266 Ga0501032_0056266_1345_2454 311
216 3300049570 Ga0501033_0000919 Ga0501033_0000919_9164_10273 311
217 3300049570 Ga0501033_0050339 Ga0501033_0050339_286_1401 311
218 3300049571 Ga0501034_0015074 Ga0501034_0015074_5473_6582 311
219 3300049571 Ga0501034_0299001 Ga0501034_0299001_59_1174 311
220 3300049572 Ga0501036_0000418 Ga0501036_0000418_23257_24366 311
221 3300049573 Ga0501037_0002535 Ga0501037_0002535_1199_2308 311
222 3300049574 Ga0501038_0001437 Ga0501038_0001437_11456_12565 311
223 3300049574 Ga0501038_0058153 Ga0501038_0058153_1561_2526 311
224 3300049576 Ga0501040_0017391 Ga0501040_0017391_777_1739 311
225 3300049576 Ga0501040_0029406 Ga0501040_0029406_2145_3113 311
226 3300049577 Ga0501041_0048172 Ga0501041_0048172_958_1926 311
227 3300049579 Ga0501043_0000727 Ga0501043_0000727_17008_18117 311
228 3300049580 Ga0501046_0001315 Ga0501046_0001315_2410_3519 311
229 3300049580 Ga0501046_0025304 Ga0501046_0025304_3453_4421 311
230 3300049581 Ga0501047_0003680 Ga0501047_0003680_10437_11546 311
231 3300049587 Ga0501071_0009047 Ga0501071_0009047_630_1598 311
232 3300049591 Ga0501075_0000179 Ga0501075_0000179_5192_6160 311
233 3300049592 Ga0501076_0000575 Ga0501076_0000575_8691_9659 311
234 3300049741 Ga0501079_0001973 Ga0501079_0001973_3069_4037 311
235 3300049822 Ga0501035_0001123 Ga0501035_0001123_6581_7690 311
236 3300049823 Ga0501044_0016393 Ga0501044_0016393_4243_5352 311
237 3300049823 Ga0501044_0048025 Ga0501044_0048025_2291_3394 311
238 3300050491 nmdc:mga00v17_1834_c1 nmdc:mga00v17_1834_c1_1775_2893 311
239 3300050510 nmdc:mga06r32_66161_c1 nmdc:mga06r32_66161_c1_1449_2414 311
240 3300050512 nmdc:mga0n895_36967_c1 nmdc:mga0n895_36967_c1_549_1514 311
241 3300050514 nmdc:mga08x19_2600_c1 nmdc:mga08x19_2600_c1_1716_2681 311
242 3300050514 nmdc:mga08x19_96362_c1 nmdc:mga08x19_96362_c1_673_1647 311
243 3300050515 nmdc:mga0a205_24856_c1 nmdc:mga0a205_24856_c1_3522_4487 311
244 3300053077 Ga0495601_0001843 Ga0495601_0001843_2674_3648 311
245 3300053078 Ga0495612_0049481 Ga0495612_0049481_131_1105 311
246 3300053085 Ga0495619_0013961 Ga0495619_0013961_63_1037 311
247 3300060353 Ga0501082_0002807 Ga0501082_0002807_870_1838 311
248 3300003792 Ga0055540_1001304 Ga0055540_100130418 312
249 3300005289 Ga0065704_10088231 Ga0065704_100882312 312
250 3300005471 Ga0070698_100007456 Ga0070698_1000074567 312
251 3300005539 Ga0068853_100076273 Ga0068853_1000762732 312
252 3300005577 Ga0068857_100035419 Ga0068857_1000354194 312
253 3300006051 Ga0075364_10031646 Ga0075364_100316463 312
254 3300007265 Ga0099794_10092931 Ga0099794_100929312 312
255 3300013102 Ga0157371_10120043 Ga0157371_101200432 312
256 3300014497 Ga0182008_10000904 Ga0182008_1000090420 312
257 3300025242 Ga0209258_102610 Ga0209258_1026104 312
258 3300025272 Ga0209455_1000596 Ga0209455_10005967 312
259 3300025303 Ga0209051_1000298 Ga0209051_100029820 312
260 3300025922 Ga0207646_10262636 Ga0207646_102626362 312
261 3300026041 Ga0207639_10044923 Ga0207639_100449233 312
262 3300026116 Ga0207674_10285951 Ga0207674_102859512 312
263 3300031911 Ga0307412_10000106 Ga0307412_1000010658 312
264 3300037312 Ga0395899_0090907 Ga0395899_0090907_610_1749 312
265 3300037418 Ga0395900_0004688 Ga0395900_0004688_2730_3869 312
266 3300037418 Ga0395900_0005230 Ga0395900_0005230_1773_2750 312
267 3300037466 Ga0395898_0004767 Ga0395898_0004767_2588_3565 312
268 3300038443 Ga0395901_0010625 Ga0395901_0010625_6700_7677 312
269 3300038443 Ga0395901_0206101 Ga0395901_0206101_750_1841 312
270 3300042876 Ga0451577_0120917 Ga0451577_0120917_469_1560 312
271 3300044712 Ga0453684_0397811 Ga0453684_0397811_15_1106 312
272 3300046500 Ga0495596_0000918 Ga0495596_0000918_12692_13756 312
273 3300046501 Ga0495607_0000009 Ga0495607_0000009_6481_7611 312
274 3300046513 Ga0495616_0058908 Ga0495616_0058908_564_1628 312
275 3300046519 Ga0495632_0000403 Ga0495632_0000403_11172_12239 312
276 3300046684 Ga0495669_0011974 Ga0495669_0011974_1269_2333 312
277 3300048908 Ga0496105_0072416 Ga0496105_0072416_1447_2553 312
278 3300048921 Ga0496118_0022065 Ga0496118_0022065_217_1335 312
279 3300048922 Ga0496119_0005661 Ga0496119_0005661_2132_3250 312
280 3300048923 Ga0496120_0003037 Ga0496120_0003037_13585_14703 312
281 3300048924 Ga0496121_0000165 Ga0496121_0000165_98637_99755 312
282 3300048927 Ga0496124_0000007 Ga0496124_0000007_243359_244558 312
283 3300048928 Ga0496125_0000121 Ga0496125_0000121_109106_110224 312
284 3300050491 nmdc:mga00v17_15848_c1 nmdc:mga00v17_15848_c1_1085_2170 312
285 3300003187 JGI25151J46595_10002495 JGI25151J46595_100024957 313
286 3300005334 Ga0068869_100016408 Ga0068869_1000164082 313
287 3300005338 Ga0068868_100058218 Ga0068868_1000582181 313
288 3300005364 Ga0070673_100115740 Ga0070673_1001157403 313
289 3300005548 Ga0070665_100037212 Ga0070665_1000372125 313
290 3300005617 Ga0068859_100192221 Ga0068859_1001922213 313
291 3300005618 Ga0068864_100023782 Ga0068864_1000237824 313
292 3300005841 Ga0068863_100042981 Ga0068863_1000429813 313
293 3300005842 Ga0068858_100145324 Ga0068858_1001453242 313
294 3300005843 Ga0068860_100099911 Ga0068860_1000999112 313
295 3300006358 Ga0068871_100154129 Ga0068871_1001541292 313
296 3300006931 Ga0097620_100192205 Ga0097620_1001922053 313
297 3300009098 Ga0105245_10090380 Ga0105245_100903802 313
298 3300009101 Ga0105247_10059608 Ga0105247_100596081 313
299 3300013306 Ga0163162_10162512 Ga0163162_101625121 313
300 3300014969 Ga0157376_10436625 Ga0157376_104366251 313
301 3300025294 Ga0209025_1000039 Ga0209025_1000039159 313
302 3300025941 Ga0207711_10022078 Ga0207711_100220785 313
303 3300025942 Ga0207689_10011395 Ga0207689_100113953 313
304 3300025986 Ga0207658_10124743 Ga0207658_101247432 313
305 3300026023 Ga0207677_10296601 Ga0207677_102966011 313
306 3300026088 Ga0207641_10064491 Ga0207641_100644912 313
307 3300026095 Ga0207676_10173238 Ga0207676_101732381 313
308 3300027717 Ga0209998_10030928 Ga0209998_100309281 313
309 3300046491 Ga0495584_0001438 Ga0495584_0001438_6859_8013 313
310 3300049822 Ga0501035_0051757 Ga0501035_0051757_1092_2192 313
311 3300049823 Ga0501044_0002136 Ga0501044_0002136_1233_2339 313
312 3300053161 Ga0500634_0037184 Ga0500634_0037184_330_1466 313
313 3300005444 Ga0070694_100002229 Ga0070694_10000222913 314
314 3300005545 Ga0070695_100007668 Ga0070695_1000076689 314
315 3300005547 Ga0070693_100051317 Ga0070693_1000513171 314
316 3300005617 Ga0068859_100116479 Ga0068859_1001164792 314
317 3300006931 Ga0097620_100116483 Ga0097620_1001164833 314
318 3300009098 Ga0105245_10136158 Ga0105245_101361583 314
319 3300025922 Ga0207646_10339755 Ga0207646_103397552 314
320 3300035092 Ga0373952_0020941 Ga0373952_0020941_337_1311 314
321 3300035695 Ga0373927_0120036 Ga0373927_0120036_222_1196 314
322 3300041511 Ga0451855_0606830 Ga0451855_0606830_201_1217 314
323 3300049822 Ga0501035_0075583 Ga0501035_0075583_606_1694 314
324 3300049823 Ga0501044_0014614 Ga0501044_0014614_2998_4086 314
325 3300053730 Ga0500645_013205 Ga0500645_013205_102_1079 314
326 3300003320 rootH2_10004886 rootH2_1000488613 315
327 3300004801 Ga0058860_12046738 Ga0058860_120467381 315
328 3300005289 Ga0065704_10181853 Ga0065704_101818531 315
329 3300005328 Ga0070676_10009267 Ga0070676_100092674 315
330 3300005329 Ga0070683_100148696 Ga0070683_1001486963 315
331 3300005330 Ga0070690_100000252 Ga0070690_10000025227 315
332 3300005330 Ga0070690_100020259 Ga0070690_1000202592 315
333 3300005334 Ga0068869_100000052 Ga0068869_10000005212 315
334 3300005334 Ga0068869_100032253 Ga0068869_1000322533 315
335 3300005337 Ga0070682_100040454 Ga0070682_1000404543 315
336 3300005338 Ga0068868_100001208 Ga0068868_1000012083 315
337 3300005340 Ga0070689_100000389 Ga0070689_1000003895 315
338 3300005340 Ga0070689_100039635 Ga0070689_1000396353 315
339 3300005341 Ga0070691_10000617 Ga0070691_1000061717 315
340 3300005343 Ga0070687_100000053 Ga0070687_10000005317 315
341 3300005343 Ga0070687_100057855 Ga0070687_1000578552 315
342 3300005345 Ga0070692_10139037 Ga0070692_101390371 315
343 3300005347 Ga0070668_100028602 Ga0070668_1000286023 315
344 3300005355 Ga0070671_100324233 Ga0070671_1003242332 315
345 3300005365 Ga0070688_100029277 Ga0070688_1000292773 315
346 3300005438 Ga0070701_10000715 Ga0070701_100007152 315
347 3300005440 Ga0070705_100000253 Ga0070705_10000025324 315
348 3300005441 Ga0070700_100000315 Ga0070700_1000003153 315
349 3300005444 Ga0070694_100000058 Ga0070694_10000005829 315
350 3300005459 Ga0068867_100000138 Ga0068867_10000013811 315
351 3300005459 Ga0068867_100000606 Ga0068867_10000060610 315
352 3300005467 Ga0070706_100271404 Ga0070706_1002714041 315
353 3300005530 Ga0070679_100003288 Ga0070679_10000328812 315
354 3300005536 Ga0070697_100051687 Ga0070697_1000516872 315
355 3300005543 Ga0070672_100126507 Ga0070672_1001265072 315
356 3300005544 Ga0070686_100000132 Ga0070686_1000001327 315
357 3300005544 Ga0070686_100209737 Ga0070686_1002097371 315
358 3300005545 Ga0070695_100066871 Ga0070695_1000668712 315
359 3300005546 Ga0070696_100000008 Ga0070696_10000000838 315
360 3300005546 Ga0070696_100005606 Ga0070696_1000056066 315
361 3300005547 Ga0070693_100000008 Ga0070693_10000000839 315
362 3300005549 Ga0070704_100000044 Ga0070704_10000004428 315
363 3300005549 Ga0070704_100005086 Ga0070704_1000050869 315
364 3300005549 Ga0070704_100111318 Ga0070704_1001113182 315
365 3300005563 Ga0068855_100000880 Ga0068855_10000088028 315
366 3300005578 Ga0068854_100020104 Ga0068854_1000201042 315
367 3300005614 Ga0068856_100023595 Ga0068856_1000235953 315
368 3300005615 Ga0070702_100001364 Ga0070702_1000013647 315
369 3300005617 Ga0068859_100000906 Ga0068859_10000090610 315
370 3300005618 Ga0068864_100023385 Ga0068864_1000233856 315
371 3300005718 Ga0068866_10000228 Ga0068866_1000022823 315
372 3300005840 Ga0068870_10153187 Ga0068870_101531872 315
373 3300005842 Ga0068858_100001268 Ga0068858_10000126817 315
374 3300005842 Ga0068858_100028208 Ga0068858_1000282082 315
375 3300005843 Ga0068860_100000634 Ga0068860_10000063422 315
376 3300005844 Ga0068862_100013191 Ga0068862_1000131913 315
377 3300005981 Ga0081538_10054631 Ga0081538_100546311 315
378 3300005985 Ga0081539_10001863 Ga0081539_1000186323 315
379 3300006237 Ga0097621_100001432 Ga0097621_10000143220 315
380 3300006237 Ga0097621_100005388 Ga0097621_1000053885 315
381 3300006358 Ga0068871_100001506 Ga0068871_1000015067 315
382 3300006358 Ga0068871_100001528 Ga0068871_1000015282 315
383 3300006844 Ga0075428_100002230 Ga0075428_1000022306 315
384 3300006844 Ga0075428_100173639 Ga0075428_1001736393 315
385 3300006846 Ga0075430_100013776 Ga0075430_1000137766 315
386 3300006846 Ga0075430_100024254 Ga0075430_1000242545 315
387 3300006847 Ga0075431_100006205 Ga0075431_10000620511 315
388 3300006852 Ga0075433_10001672 Ga0075433_1000167214 315
389 3300006852 Ga0075433_10199199 Ga0075433_101991992 315
390 3300006871 Ga0075434_100000002 Ga0075434_10000000281 315
391 3300006871 Ga0075434_100007238 Ga0075434_1000072389 315
392 3300006871 Ga0075434_100631694 Ga0075434_1006316941 315
393 3300006880 Ga0075429_100000150 Ga0075429_10000015045 315
394 3300006881 Ga0068865_100000276 Ga0068865_10000027630 315
395 3300006881 Ga0068865_100003876 Ga0068865_1000038766 315
396 3300006914 Ga0075436_100000603 Ga0075436_1000006039 315
397 3300006914 Ga0075436_100004083 Ga0075436_1000040838 315
398 3300006931 Ga0097620_100000906 Ga0097620_10000090610 315
399 3300007076 Ga0075435_100000089 Ga0075435_10000008933 315
400 3300007076 Ga0075435_100010608 Ga0075435_1000106082 315
401 3300007265 Ga0099794_10078305 Ga0099794_100783052 315
402 3300009094 Ga0111539_10013589 Ga0111539_100135896 315
403 3300009094 Ga0111539_10130762 Ga0111539_101307623 315
404 3300009098 Ga0105245_10000221 Ga0105245_100002219 315
405 3300009147 Ga0114129_10003624 Ga0114129_1000362425 315
406 3300009147 Ga0114129_10028894 Ga0114129_100288947 315
407 3300009147 Ga0114129_10714052 Ga0114129_107140522 315
408 3300009147 Ga0114129_10888562 Ga0114129_108885622 315
409 3300009148 Ga0105243_10000288 Ga0105243_100002889 315
410 3300009148 Ga0105243_10012184 Ga0105243_100121843 315
411 3300009174 Ga0105241_10039260 Ga0105241_100392602 315
412 3300009176 Ga0105242_10001306 Ga0105242_1000130620 315
413 3300009177 Ga0105248_10459174 Ga0105248_104591742 315
414 3300009553 Ga0105249_10001638 Ga0105249_1000163817 315
415 3300013297 Ga0157378_10010643 Ga0157378_1001064310 315
416 3300013306 Ga0163162_10443289 Ga0163162_104432891 315
417 3300013308 Ga0157375_10064022 Ga0157375_100640224 315
418 3300014326 Ga0157380_10107610 Ga0157380_101076103 315
419 3300014969 Ga0157376_10001746 Ga0157376_1000174620 315
420 3300025899 Ga0207642_10000528 Ga0207642_100005287 315
421 3300025899 Ga0207642_10031133 Ga0207642_100311332 315
422 3300025904 Ga0207647_10023637 Ga0207647_100236373 315
423 3300025907 Ga0207645_10102625 Ga0207645_101026252 315
424 3300025908 Ga0207643_10147756 Ga0207643_101477562 315
425 3300025912 Ga0207707_10248103 Ga0207707_102481032 315
426 3300025917 Ga0207660_10000702 Ga0207660_1000070221 315
427 3300025918 Ga0207662_10000147 Ga0207662_1000014726 315
428 3300025918 Ga0207662_10140377 Ga0207662_101403772 315
429 3300025921 Ga0207652_10004183 Ga0207652_100041839 315
430 3300025921 Ga0207652_10272803 Ga0207652_102728032 315
431 3300025927 Ga0207687_10000574 Ga0207687_1000057421 315
432 3300025933 Ga0207706_10136762 Ga0207706_101367622 315
433 3300025934 Ga0207686_10000769 Ga0207686_1000076920 315
434 3300025935 Ga0207709_10000618 Ga0207709_1000061832 315
435 3300025935 Ga0207709_10001207 Ga0207709_1000120723 315
436 3300025936 Ga0207670_10001822 Ga0207670_100018227 315
437 3300025937 Ga0207669_10246608 Ga0207669_102466082 315
438 3300025938 Ga0207704_10021117 Ga0207704_100211172 315
439 3300025939 Ga0207665_10113969 Ga0207665_101139693 315
440 3300025941 Ga0207711_10265098 Ga0207711_102650981 315
441 3300025942 Ga0207689_10002968 Ga0207689_1000296810 315
442 3300025942 Ga0207689_10032534 Ga0207689_100325342 315
443 3300025949 Ga0207667_10023997 Ga0207667_100239972 315
444 3300025949 Ga0207667_10084574 Ga0207667_100845744 315
445 3300025961 Ga0207712_10004541 Ga0207712_100045416 315
446 3300025972 Ga0207668_10018884 Ga0207668_100188843 315
447 3300025981 Ga0207640_10168022 Ga0207640_101680222 315
448 3300026023 Ga0207677_10001629 Ga0207677_100016295 315
449 3300026035 Ga0207703_10005322 Ga0207703_100053227 315
450 3300026041 Ga0207639_10085964 Ga0207639_100859642 315
451 3300026075 Ga0207708_10005166 Ga0207708_100051666 315
452 3300026078 Ga0207702_10034743 Ga0207702_100347435 315
453 3300026089 Ga0207648_10000362 Ga0207648_1000036228 315
454 3300026089 Ga0207648_10001117 Ga0207648_1000111728 315
455 3300026095 Ga0207676_10045719 Ga0207676_100457193 315
456 3300026116 Ga0207674_10100541 Ga0207674_101005413 315
457 3300026118 Ga0207675_100000880 Ga0207675_10000088010 315
458 3300027364 Ga0209967_1001323 Ga0209967_10013232 315
459 3300027364 Ga0209967_1001973 Ga0209967_10019732 315
460 3300027395 Ga0209996_1001443 Ga0209996_10014433 315
461 3300027395 Ga0209996_1004511 Ga0209996_10045112 315
462 3300027526 Ga0209968_1003523 Ga0209968_10035232 315
463 3300027543 Ga0209999_1002842 Ga0209999_10028423 315
464 3300027665 Ga0209983_1006167 Ga0209983_10061673 315
465 3300027682 Ga0209971_1003725 Ga0209971_10037252 315
466 3300027907 Ga0207428_10002058 Ga0207428_1000205819 315
467 3300027907 Ga0207428_10019470 Ga0207428_100194705 315
468 3300027907 Ga0207428_10058881 Ga0207428_100588813 315
469 3300028380 Ga0268265_10000457 Ga0268265_1000045750 315
470 3300028381 Ga0268264_10001149 Ga0268264_1000114927 315
471 3300028573 Ga0265334_10017155 Ga0265334_100171553 315
472 3300031665 Ga0316575_10004408 Ga0316575_100044084 315
473 3300031665 Ga0316575_10006319 Ga0316575_100063195 315
474 3300031852 Ga0307410_10081913 Ga0307410_100819131 315
475 3300032002 Ga0307416_100330189 Ga0307416_1003301892 315
476 3300035086 Ga0373934_0000470 Ga0373934_0000470_9286_10302 315
477 3300035112 Ga0373932_0027097 Ga0373932_0027097_537_1517 315
478 3300035118 Ga0373954_0000052 Ga0373954_0000052_9137_10117 315
479 3300035118 Ga0373954_0000859 Ga0373954_0000859_7631_8734 315
480 3300035118 Ga0373954_0001173 Ga0373954_0001173_6120_7172 315
481 3300035119 Ga0373956_0000019 Ga0373956_0000019_47418_48434 315
482 3300035120 Ga0373957_0000663 Ga0373957_0000663_954_1970 315
483 3300035121 Ga0373960_0031304 Ga0373960_0031304_54_1034 315
484 3300035241 Ga0373961_0013889 Ga0373961_0013889_25_1017 315
485 3300035242 Ga0373962_0026850 Ga0373962_0026850_19_999 315
486 3300035398 Ga0316574_0222548 Ga0316574_0222548_62_1042 315
487 3300035691 Ga0373931_0000307 Ga0373931_0000307_19166_20146 315
488 3300035724 Ga0373933_0019539 Ga0373933_0019539_2244_3260 315
489 3300035725 Ga0373947_0028426 Ga0373947_0028426_134_1114 315
490 3300036401 Ga0373937_0000645 Ga0373937_0000645_2340_3320 315
491 3300036401 Ga0373937_0000781 Ga0373937_0000781_22922_23938 315
492 3300037418 Ga0395900_0004673 Ga0395900_0004673_10756_11862 315
493 3300042001 Ga0439441_000508 Ga0439441_000508_525_1520 315
494 3300042436 Ga0439435_0017748 Ga0439435_0017748_176_1171 315
495 3300042461 Ga0439460_0000008 Ga0439460_0000008_22616_23596 315
496 3300042876 Ga0451577_0002438 Ga0451577_0002438_9777_10913 315
497 3300042876 Ga0451577_0005329 Ga0451577_0005329_5475_6596 315
498 3300044712 Ga0453684_0198717 Ga0453684_0198717_523_1623 315
499 3300045051 Ga0451576_0001013 Ga0451576_0001013_6784_7764 315
500 3300045051 Ga0451576_0002279 Ga0451576_0002279_14901_16022 315
501 3300045051 Ga0451576_0016576 Ga0451576_0016576_6509_7489 315
502 3300045976 Ga0466967_0011832 Ga0466967_0011832_4202_5182 315
503 3300046454 Ga0495592_0019515 Ga0495592_0019515_1051_2154 315
504 3300046455 Ga0495603_0056677 Ga0495603_0056677_11_991 315
505 3300046462 Ga0495651_0064189 Ga0495651_0064189_441_1457 315
506 3300046475 Ga0495639_0050190 Ga0495639_0050190_199_1182 315
507 3300046517 Ga0495630_0133784 Ga0495630_0133784_629_1618 315
508 3300046523 Ga0495644_0044660 Ga0495644_0044660_82_1062 315
509 3300046535 Ga0495586_0033127 Ga0495586_0033127_1514_2494 315
510 3300046537 Ga0495598_0009521 Ga0495598_0009521_99_1079 315
511 3300046664 Ga0495659_0044460 Ga0495659_0044460_554_1534 315
512 3300046681 Ga0495647_0006529 Ga0495647_0006529_1777_2757 315
513 3300046684 Ga0495669_0099213 Ga0495669_0099213_172_1152 315
514 3300047318 Ga0495636_0036912 Ga0495636_0036912_705_1703 315
515 3300047321 Ga0495676_0007493 Ga0495676_0007493_1092_2072 315
516 3300047322 Ga0495680_0040245 Ga0495680_0040245_833_1849 315
517 3300049570 Ga0501033_0008890 Ga0501033_0008890_212_1192 315
518 3300049572 Ga0501036_0000974 Ga0501036_0000974_15266_16246 315
519 3300049573 Ga0501037_0015192 Ga0501037_0015192_4491_5468 315
520 3300049574 Ga0501038_0000189 Ga0501038_0000189_30608_31588 315
521 3300049575 Ga0501039_0000247 Ga0501039_0000247_16957_17937 315
522 3300049576 Ga0501040_0040415 Ga0501040_0040415_806_1786 315
523 3300049576 Ga0501040_0066095 Ga0501040_0066095_1361_2341 315
524 3300049577 Ga0501041_0000032 Ga0501041_0000032_32051_33031 315
525 3300049580 Ga0501046_0000156 Ga0501046_0000156_36376_37356 315
526 3300049580 Ga0501046_0140667 Ga0501046_0140667_412_1389 315
527 3300049581 Ga0501047_0130282 Ga0501047_0130282_607_1701 315
528 3300049586 Ga0501070_0016624 Ga0501070_0016624_43_1023 315
529 3300049587 Ga0501071_0004130 Ga0501071_0004130_2867_3847 315
530 3300049588 Ga0501072_0002789 Ga0501072_0002789_9859_10839 315
531 3300049588 Ga0501072_0033056 Ga0501072_0033056_965_1942 315
532 3300049591 Ga0501075_0000053 Ga0501075_0000053_33031_34011 315
533 3300049592 Ga0501076_0000683 Ga0501076_0000683_12857_13837 315
534 3300049593 Ga0501077_0003937 Ga0501077_0003937_2638_3618 315
535 3300049741 Ga0501079_0008097 Ga0501079_0008097_6447_7427 315
536 3300049742 Ga0501080_0027030 Ga0501080_0027030_230_1207 315
537 3300049742 Ga0501080_0161465 Ga0501080_0161465_228_1208 315
538 3300049743 Ga0501081_0000127 Ga0501081_0000127_27124_28104 315
539 3300049822 Ga0501035_0016865 Ga0501035_0016865_4870_5850 315
540 3300049824 Ga0501045_0000372 Ga0501045_0000372_7549_8529 315
541 3300049824 Ga0501045_0061022 Ga0501045_0061022_701_1684 315
542 3300050507 nmdc:mga05p37_1475_c1 nmdc:mga05p37_1475_c1_3068_4048 315
543 3300050507 nmdc:mga05p37_34342_c1 nmdc:mga05p37_34342_c1_448_1443 315
544 3300050508 nmdc:mga09592_49624_c1 nmdc:mga09592_49624_c1_1639_2634 315
545 3300050508 nmdc:mga09592_8451_c1 nmdc:mga09592_8451_c1_5213_6193 315
546 3300050510 nmdc:mga06r32_48118_c1 nmdc:mga06r32_48118_c1_1435_2430 315
547 3300050511 nmdc:mga08y16_17429_c1 nmdc:mga08y16_17429_c1_5188_6168 315
548 3300050511 nmdc:mga08y16_7366_c1 nmdc:mga08y16_7366_c1_4570_5550 315
549 3300050511 nmdc:mga08y16_79454_c1 nmdc:mga08y16_79454_c1_753_1733 315
550 3300050511 nmdc:mga08y16_8395_c1 nmdc:mga08y16_8395_c1_2984_3964 315
551 3300050512 nmdc:mga0n895_1409_c1 nmdc:mga0n895_1409_c1_9937_10917 315
552 3300050512 nmdc:mga0n895_3845_c1 nmdc:mga0n895_3845_c1_524_1513 315
553 3300050513 nmdc:mga0rr50_128_c1 nmdc:mga0rr50_128_c1_23103_24083 315
554 3300050513 nmdc:mga0rr50_268168_c1 nmdc:mga0rr50_268168_c1_100_1098 315
555 3300050513 nmdc:mga0rr50_300936_c1 nmdc:mga0rr50_300936_c1_134_1114 315
556 3300050513 nmdc:mga0rr50_7448_c1 nmdc:mga0rr50_7448_c1_653_1642 315
557 3300050514 nmdc:mga08x19_10877_c1 nmdc:mga08x19_10877_c1_1788_2768 315
558 3300050514 nmdc:mga08x19_159004_c1 nmdc:mga08x19_159004_c1_144_1133 315
559 3300050514 nmdc:mga08x19_191358_c1 nmdc:mga08x19_191358_c1_362_1342 315
560 3300050514 nmdc:mga08x19_434_c1 nmdc:mga08x19_434_c1_17398_18378 315
561 3300050514 nmdc:mga08x19_61650_c1 nmdc:mga08x19_61650_c1_1398_2411 315
562 3300050515 nmdc:mga0a205_160_c1 nmdc:mga0a205_160_c1_31839_32819 315
563 3300053077 Ga0495601_0220306 Ga0495601_0220306_35_1138 315
564 3300053084 Ga0495595_0048224 Ga0495595_0048224_656_1672 315
565 3300054114 Ga0501084_0016187 Ga0501084_0016187_2337_3317 315
566 3300061734 Ga0530510_0000115 Ga0530510_0000115_33629_34609 315
567 3300061734 Ga0530510_0000160 Ga0530510_0000160_30467_31450 315
568 iso_pu_bacteria 2599185292 2599904342 315
569 iso_pu_bacteria 2643221569 2643863713 315
570 iso_pu_bacteria 2643221594 2643982915 315
571 iso_pu_bacteria 2643221621 2644123242 315
572 iso_pu_bacteria 2739367655 2739611583 315
573 iso_pu_bacteria 2808606395 2809033505 315
574 iso_pu_bacteria 2855730933 2855735420 315
575 iso_pu_bacteria 2855767633 2855771203 315
576 iso_pu_bacteria 2857537821 2857537995 315
577 iso_pu_bacteria 2857576091 2857577963 315
578 iso_pu_bacteria 2858950400 2858954244 315
579 iso_pu_bacteria 2881412998 2881416922 315
580 iso_pu_bacteria 2881927736 2881929108 315
581 iso_pu_bacteria 2887375801 2887376068 315
582 iso_pu_bacteria 2941479691 2941484236 315
583 iso_pu_bacteria 8002392321 8002392737 315
584 iso_pu_bacteria 8048746797 8048747209 315
585 iso_pu_bacteria 8055225921 8055226415 315
586 3300001990 JGI24737J22298_10068727 JGI24737J22298_100687271 316
587 3300002067 JGI24735J21928_10054142 JGI24735J21928_100541421 316
588 3300005329 Ga0070683_100123728 Ga0070683_1001237282 316
589 3300005339 Ga0070660_100194991 Ga0070660_1001949912 316
590 3300005344 Ga0070661_100060352 Ga0070661_1000603522 316
591 3300005535 Ga0070684_100114077 Ga0070684_1001140772 316
592 3300005616 Ga0068852_100043798 Ga0068852_1000437982 316
593 3300009551 Ga0105238_10120296 Ga0105238_101202961 316
594 3300010375 Ga0105239_10281374 Ga0105239_102813742 316
595 3300013102 Ga0157371_10087470 Ga0157371_100874702 316
596 3300013307 Ga0157372_10124018 Ga0157372_101240182 316
597 3300025904 Ga0207647_10076420 Ga0207647_100764202 316
598 3300025913 Ga0207695_10210929 Ga0207695_102109292 316
599 3300025914 Ga0207671_10169483 Ga0207671_101694832 316
600 3300025919 Ga0207657_10083678 Ga0207657_100836784 316
601 3300025944 Ga0207661_10388722 Ga0207661_103887222 316
602 3300026078 Ga0207702_10210539 Ga0207702_102105392 316
603 3300026142 Ga0207698_10035418 Ga0207698_100354182 316
604 3300037418 Ga0395900_0001711 Ga0395900_0001711_10943_11908 316

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02492

cobW

CobW/HypB/UreG, nucleotide-binding domain

8

189

0.96

PF07683

CobW_C

Cobalamin synthesis protein cobW C-terminal domain

287

381

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2wsm-assembly1.cif.gz_A crystal structure of hydrogenase maturation factor hypb from archaeoglobus fulgidus 0.7538 5 184
4ixn-assembly1.cif.gz_A crystal structure of zn(ii)-bound e37a,c66a,c67a triple mutant yjia gtpase 0.7479 3 314
4ixn-assembly1.cif.gz_A crystal structure of zn(ii)-bound e37a,c66a,c67a triple mutant yjia gtpase 0.7415 3 314
4hz5-assembly1.cif.gz_A pyrrolopyrimidine inhibitors of dna gyrase b and topoisomerase iv, part i: structure guided discovery and optimization of dual targeting agents with potent, broad-spectrum enzymatic activity 0.7221 247 299
4ixm-assembly1.cif.gz_A crystal structure of zn(ii)-bound yjia gtpase from e. coli 0.7163 3 314
ID Description Score Start End Superfamily
af_A0A0R0I7G4_81_290_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9204 5 194 3.40.50.300
af_Q2G0W4_1_229_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8969 3 200 3.40.50.300
af_Q2G0B0_6_202_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8779 4 192 3.40.50.300
af_Q9M8L6_331_443_3.30.1220.10 Alpha Beta;2-Layer Sandwich;Hypothetical Protein Yjia; Chain: A;domain 2;CobW-like, C-terminal domain 0.8706 207 313 3.30.1220.10
af_Q2G0W4_241_375_3.30.1220.10 Alpha Beta;2-Layer Sandwich;Hypothetical Protein Yjia; Chain: A;domain 2;CobW-like, C-terminal domain 0.8698 218 313 3.30.1220.10
ID Description Score Start End GO Terms
AF-A0A258C7H6-F1-model_v4 deleted 0.9843 222 314
AF-A0A645I1T3-F1-model_v4 Putative GTP-binding protein YjiA 0.983 222 314 GO:0005737
AF-A0A4V1TZ45-F1-model_v4 deleted 0.9806 217 314
AF-X1F0I2-F1-model_v4 CobW C-terminal domain-containing protein 0.9803 221 314
AF-A0A7R9VUA8-F1-model_v4 CobW C-terminal domain-containing protein 0.9752 228 314 GO:0005737

Feature Viewer

pLDDT pTM Quality
80.98 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map