F468438

General Info

Members Datasets Scaffolds Average Seq Length
605 392 1210 102

Family's Representative Sequence

Representative Sequence 3300005335|Ga0070666_11144327|Ga0070666_111443272
Length 117
Sequence MSAAPKKRRFGFGRKAVEQADIDPRHYDIITAPVITEKATMGSEFGQVTFRVPLTATKPQIKAAVEALFKVNVKAVNTLIAKGKTKRFKGLPGRRSDVKKAIVTLAAGQSIDVTTGV

Samples

Sample ID Description Type Environment
1 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
4 3300003158 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_3 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
11 3300003559 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
12 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
13 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
14 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
15 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
16 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
17 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
18 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
19 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
20 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
21 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
22 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
23 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
28 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
29 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
40 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
41 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
42 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
43 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
65 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
66 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
70 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
71 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
72 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
86 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
96 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
97 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
98 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
99 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
100 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
101 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
102 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
105 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
108 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
110 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
113 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
157 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
158 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
159 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
160 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
161 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
162 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
163 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
164 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
165 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
166 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
167 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
168 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
172 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
173 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
174 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
175 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
176 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
177 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
178 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
179 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
180 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
181 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
182 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
183 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
184 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
185 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
186 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
187 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
188 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
189 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
190 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
191 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
192 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
193 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
194 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
195 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
196 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
197 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
198 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
199 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
200 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
201 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
202 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
203 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
204 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
205 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
206 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
207 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
208 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
209 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
210 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
211 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
212 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
213 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
214 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
215 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
216 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
217 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
218 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
219 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
220 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
221 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
222 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
223 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
224 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
225 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
226 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
227 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
228 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
229 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
230 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
231 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
232 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
233 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
234 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
235 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
236 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
237 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
238 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
239 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
240 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
241 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
242 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
243 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
244 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
245 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
246 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
247 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
248 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
249 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
250 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
251 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
252 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
253 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
254 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
255 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
256 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
257 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
258 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
259 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
260 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
261 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
262 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
263 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
264 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
265 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
266 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
267 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
268 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
269 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
270 3300049131 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
271 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
272 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
273 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
274 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
275 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
276 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
277 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
278 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
279 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
280 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
281 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
282 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
283 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
284 3300049545 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
285 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
286 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
288 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
296 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
297 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
298 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
299 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
301 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
302 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
303 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
304 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
305 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
306 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
307 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
308 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
309 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
310 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
311 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
312 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
313 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
314 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
315 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
316 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
317 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
318 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
319 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
320 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
321 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
322 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
323 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
324 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
325 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
326 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
327 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
328 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
329 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
330 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
331 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
332 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
333 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
334 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
335 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
336 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
337 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
338 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
339 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
340 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
341 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
342 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
343 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
344 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
345 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
346 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
347 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
348 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
349 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
350 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
351 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
352 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
353 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
354 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
355 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
356 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
357 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
358 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
359 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
360 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
361 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
362 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
363 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
364 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
365 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
366 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
367 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
368 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
369 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
370 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
371 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
372 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
373 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
374 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
375 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
376 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
377 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
378 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
379 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
380 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
381 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
382 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
383 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
384 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
385 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
386 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
387 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
388 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
389 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
390 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
391 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
392 8054002106 Azospirillum lipoferum 59b Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 84.3
Metatranscriptomes 14.71
Isolates 0.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.5
Nodule 0
Rhizoplane 3.14
Rhizosphere 69.26
Stem 0
Stem Tuber 0
Unclassified 0.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070666_11144327 3300005335 Bacteria 579
2 JGI24751J29686_10031233 3300002459 Bacteria 1105
3 JGI25159J45721_1005639 3300002987 Bacteria 3897
4 Ga0006760J45825_104920 3300003158 Bacteria 644
5 Ga0006759J45824_1069825 3300003163 Bacteria 736
6 Ga0006759J45824_1093412 3300003163 Bacteria 972
7 JGI25151J46595_10000624 3300003187 Bacteria 30772
8 JGI25153J46596_10020623 3300003215 Bacteria 2486
9 rootL2_10069702 3300003322 Bacteria 1371
10 rootL2_10134251 3300003322 Bacteria 1105
11 rootH1_10228499 3300003323 Bacteria 1411
12 JGI25160J50197_1004313 3300003354 Bacteria 6163
13 Ga0007427J51700_108029 3300003559 Bacteria 831
14 Ga0007429J51699_1025305 3300003579 Bacteria 934
15 Ga0032354_1009883 3300003693 Bacteria 2257
16 Ga0032354_1036765 3300003693 Bacteria 2457
17 Ga0055526_1026248 3300003771 Bacteria 1843
18 Ga0055537_1004503 3300003773 Bacteria 3972
19 Ga0055524_1037192 3300003775 Bacteria 1295
20 Ga0055524_1052374 3300003775 Bacteria 912
21 Ga0055534_1043029 3300003784 Bacteria 659
22 Ga0055528_1007701 3300003790 Bacteria 4722
23 Ga0055530_10053500 3300003791 Bacteria 927
24 Ga0055531_10023544 3300003794 Bacteria 2303
25 Ga0055531_10068005 3300003794 Bacteria 835
26 Ga0055543_1043964 3300004625 Bacteria 747
27 Ga0065165_1002762 3300005262 Bacteria 13954
28 Ga0065704_10007805 3300005289 Bacteria 2508
29 Ga0070658_10503281 3300005327 Bacteria 1046
30 Ga0070658_10737474 3300005327 Bacteria 855
31 Ga0070683_100461961 3300005329 Bacteria 1212
32 Ga0070670_100461539 3300005331 Bacteria 1126
33 Ga0068869_101085680 3300005334 Bacteria 700
34 Ga0070680_101335264 3300005336 Bacteria 621
35 Ga0070682_101299911 3300005337 Bacteria 618
36 Ga0068868_101014902 3300005338 Bacteria 760
37 Ga0070660_100775744 3300005339 Bacteria 806
38 Ga0070661_100418722 3300005344 Bacteria 1062
39 Ga0070668_100001882 3300005347 Bacteria 15339
40 Ga0070669_100050591 3300005353 Bacteria 3035
41 Ga0070671_100011171 3300005355 Bacteria 7211
42 Ga0070673_101556241 3300005364 Bacteria 624
43 Ga0070659_101321666 3300005366 Bacteria 640
44 Ga0070667_100021170 3300005367 Bacteria 5403
45 Ga0070667_100594634 3300005367 Bacteria 1019
46 Ga0070709_10402063 3300005434 Bacteria 1023
47 Ga0070714_100285187 3300005435 Bacteria 1535
48 Ga0070714_101687603 3300005435 Bacteria 619
49 Ga0070713_100107963 3300005436 Bacteria 2422
50 Ga0070710_10136161 3300005437 Bacteria 1502
51 Ga0070711_100557170 3300005439 Bacteria 952
52 Ga0070663_101215590 3300005455 Bacteria 663
53 Ga0070663_101589573 3300005455 Bacteria 583
54 Ga0070678_100463708 3300005456 Bacteria 1112
55 Ga0070685_10005750 3300005466 Bacteria 6302
56 Ga0070684_102023121 3300005535 Bacteria 544
57 Ga0070672_101379419 3300005543 Bacteria 630
58 Ga0070686_100505957 3300005544 Bacteria 938
59 Ga0070686_101397684 3300005544 Bacteria 587
60 Ga0070665_100349684 3300005548 Bacteria 1483
61 Ga0068855_100575861 3300005563 Bacteria 1216
62 Ga0068855_101677522 3300005563 Bacteria 648
63 Ga0070664_101039164 3300005564 Bacteria 771
64 Ga0070664_102350384 3300005564 Bacteria 506
65 Ga0068856_100134295 3300005614 Bacteria 2480
66 Ga0068856_100694970 3300005614 Bacteria 1037
67 Ga0068852_101458078 3300005616 Bacteria 707
68 Ga0068864_100030863 3300005618 Bacteria 4544
69 Ga0068861_102704965 3300005719 Bacteria 500
70 Ga0068863_100080807 3300005841 Bacteria 3079
71 Ga0068863_100182679 3300005841 Bacteria 2013
72 Ga0068858_100000261 3300005842 Bacteria 56197
73 Ga0068860_100000042 3300005843 Bacteria 227404
74 Ga0068862_100003686 3300005844 Bacteria 13105
75 Ga0068862_102162301 3300005844 Bacteria 568
76 Ga0081455_10058498 3300005937 Bacteria 3261
77 Ga0081540_1017843 3300005983 Bacteria 4377
78 Ga0070717_10294886 3300006028 Bacteria 1441
79 Ga0075365_10444201 3300006038 Bacteria 916
80 Ga0075363_100292289 3300006048 Bacteria 944
81 Ga0075364_10327156 3300006051 Bacteria 1044
82 Ga0070716_100158507 3300006173 Bacteria 1464
83 Ga0070712_100227825 3300006175 Bacteria 1479
84 Ga0075362_10306772 3300006177 Bacteria 788
85 Ga0075362_10559589 3300006177 Bacteria 588
86 Ga0075367_10767659 3300006178 Bacteria 614
87 Ga0075369_10010071 3300006186 Bacteria 3692
88 Ga0075366_10031500 3300006195 Bacteria 3121
89 Ga0097621_100328028 3300006237 Bacteria 1357
90 Ga0075370_10363622 3300006353 Bacteria 865
91 Ga0075370_10855728 3300006353 Bacteria 555
92 Ga0075430_100652120 3300006846 Bacteria 868
93 Ga0105240_10022560 3300009093 Bacteria 8342
94 Ga0105240_10058879 3300009093 Bacteria 4795
95 Ga0105240_10255649 3300009093 Bacteria 2023
96 Ga0105240_10413825 3300009093 Bacteria 1516
97 Ga0105240_12393746 3300009093 Bacteria 547
98 Ga0105245_11808632 3300009098 Bacteria 664
99 Ga0105241_10326042 3300009174 Bacteria 1326
100 Ga0105241_11546966 3300009174 Bacteria 640
101 Ga0105242_10461280 3300009176 Bacteria 1200
102 Ga0105248_10440021 3300009177 Bacteria 1469
103 Ga0105248_12360574 3300009177 Bacteria 606
104 Ga0105237_10224191 3300009545 Bacteria 1880
105 Ga0105237_10433354 3300009545 Bacteria 1320
106 Ga0105237_12630793 3300009545 Bacteria 514
107 Ga0105238_10196243 3300009551 Bacteria 1994
108 Ga0105238_10326749 3300009551 Bacteria 1520
109 Ga0105238_10724768 3300009551 Bacteria 1007
110 Ga0105238_10829427 3300009551 Bacteria 941
111 Ga0105238_10859111 3300009551 Bacteria 925
112 Ga0105033_104982 3300009986 Bacteria 1137
113 Ga0105239_10905051 3300010375 Bacteria 1013
114 Ga0105239_11856159 3300010375 Bacteria 699
115 Ga0157347_1011264 3300012502 Bacteria 948
116 Ga0157327_1004697 3300012512 Bacteria 1072
117 Ga0157373_10348597 3300013100 Bacteria 1056
118 Ga0157370_10483229 3300013104 Bacteria 1138
119 Ga0157378_12825693 3300013297 Bacteria 538
120 Ga0163162_11460712 3300013306 Bacteria 778
121 Ga0157372_10364270 3300013307 Bacteria 1684
122 Ga0163163_10269543 3300014325 Bacteria 1754
123 Ga0163163_11528902 3300014325 Bacteria 729
124 Ga0157379_10238620 3300014968 Bacteria 1649
125 Ga0163161_10878043 3300017792 Bacteria 758
126 Ga0213873_10031217 3300021358 Bacteria 1324
127 Ga0213872_10039932 3300021361 Bacteria 2142
128 Ga0213874_10161379 3300021377 Bacteria 788
129 Ga0213876_10008440 3300021384 Bacteria 5577
130 Ga0213875_10058981 3300021388 Bacteria 1796
131 Ga0213871_10012207 3300021441 Bacteria 1990
132 Ga0213871_10111587 3300021441 Bacteria 809
133 Ga0209233_1017172 3300025261 Bacteria 1977
134 Ga0209565_1000925 3300025263 Bacteria 15538
135 Ga0209673_1001876 3300025273 Bacteria 16959
136 Ga0209130_1000706 3300025284 Bacteria 29893
137 Ga0209675_1002644 3300025291 Bacteria 9054
138 Ga0209675_1038255 3300025291 Bacteria 1070
139 Ga0209676_1022325 3300025292 Bacteria 2100
140 Ga0209025_1000750 3300025294 Bacteria 54523
141 Ga0209564_1007568 3300025295 Bacteria 5584
142 Ga0209564_1015779 3300025295 Bacteria 3053
143 Ga0209758_1023594 3300025297 Bacteria 2776
144 Ga0209050_1019693 3300025298 Bacteria 2548
145 Ga0209256_1003893 3300025299 Bacteria 9891
146 Ga0209256_1020366 3300025299 Bacteria 2072
147 Ga0207426_1000336 3300025302 Bacteria 88370
148 Ga0209051_1000877 3300025303 Bacteria 30359
149 Ga0209257_1000976 3300025304 Bacteria 38920
150 Ga0209257_1008377 3300025304 Bacteria 5898
151 Ga0207692_10089803 3300025898 Bacteria 1664
152 Ga0207647_10645457 3300025904 Bacteria 581
153 Ga0207645_10029047 3300025907 Bacteria 3565
154 Ga0207705_10672397 3300025909 Bacteria 805
155 Ga0207707_11353605 3300025912 Bacteria 570
156 Ga0207695_10049522 3300025913 Bacteria 4427
157 Ga0207695_10076710 3300025913 Bacteria 3397
158 Ga0207671_10258019 3300025914 Bacteria 1371
159 Ga0207671_10790721 3300025914 Bacteria 753
160 Ga0207657_10493531 3300025919 Bacteria 959
161 Ga0207649_10214678 3300025920 Bacteria 1367
162 Ga0207652_10439885 3300025921 Bacteria 1176
163 Ga0207681_10452633 3300025923 Bacteria 1045
164 Ga0207694_10027541 3300025924 Bacteria 4329
165 Ga0207694_10211628 3300025924 Bacteria 1579
166 Ga0207694_10677710 3300025924 Bacteria 869
167 Ga0207694_10748388 3300025924 Bacteria 825
168 Ga0207650_11485020 3300025925 Bacteria 576
169 Ga0207659_11811051 3300025926 Bacteria 518
170 Ga0207700_10111800 3300025928 Bacteria 2199
171 Ga0207664_10019250 3300025929 Bacteria 5041
172 Ga0207664_11891233 3300025929 Bacteria 519
173 Ga0207644_10018207 3300025931 Bacteria 4749
174 Ga0207690_10870636 3300025932 Bacteria 746
175 Ga0207706_11091972 3300025933 Bacteria 667
176 Ga0207686_11529165 3300025934 Bacteria 550
177 Ga0207665_10064425 3300025939 Bacteria 2490
178 Ga0207691_11556722 3300025940 Bacteria 539
179 Ga0207711_11898226 3300025941 Bacteria 538
180 Ga0207711_12094047 3300025941 Bacteria 508
181 Ga0207661_11079713 3300025944 Bacteria 739
182 Ga0207679_11297557 3300025945 Bacteria 668
183 Ga0207667_10014133 3300025949 Bacteria 9112
184 Ga0207667_10434857 3300025949 Bacteria 1334
185 Ga0207667_12015332 3300025949 Bacteria 537
186 Ga0207651_11387531 3300025960 Bacteria 632
187 Ga0207658_10000002 3300025986 Bacteria 1364188
188 Ga0207703_10000253 3300026035 Bacteria 60255
189 Ga0207703_11582981 3300026035 Bacteria 630
190 Ga0207678_11114722 3300026067 Bacteria 699
191 Ga0207678_11369025 3300026067 Bacteria 626
192 Ga0207702_10683874 3300026078 Bacteria 1010
193 Ga0207702_11087444 3300026078 Bacteria 793
194 Ga0207641_10001025 3300026088 Bacteria 28336
195 Ga0207641_10101679 3300026088 Bacteria 2533
196 Ga0207648_11040737 3300026089 Bacteria 767
197 Ga0207676_10173154 3300026095 Bacteria 1882
198 Ga0207674_10434651 3300026116 Bacteria 1268
199 Ga0207698_11282310 3300026142 Bacteria 747
200 Ga0209970_1062345 3300027614 Bacteria 685
201 Ga0209974_10065831 3300027876 Bacteria 1231
202 Ga0268266_10005155 3300028379 Bacteria 12306
203 Ga0268266_12119386 3300028379 Bacteria 535
204 Ga0268265_10000582 3300028380 Bacteria 36910
205 Ga0268264_10000001 3300028381 Bacteria 1221000
206 Ga0268264_11979525 3300028381 Bacteria 592
207 Ga0307517_10130623 3300028786 Bacteria 1810
208 Ga0307515_10072026 3300028794 Bacteria 4673
209 Ga0307515_10486084 3300028794 Bacteria 846
210 Ga0307512_10169625 3300030522 Bacteria 1255
211 Ga0265332_10232294 3300031238 Bacteria 764
212 Ga0265331_10156725 3300031250 Bacteria 1033
213 Ga0265331_10463231 3300031250 Bacteria 570
214 Ga0265327_10007046 3300031251 Bacteria 8808
215 Ga0265327_10042561 3300031251 Bacteria 2437
216 Ga0307513_10010515 3300031456 Bacteria 11583
217 Ga0265314_10053314 3300031711 Bacteria 2806
218 Ga0265314_10083091 3300031711 Bacteria 2106
219 Ga0265342_10180916 3300031712 Bacteria 1155
220 Ga0316578_10158531 3300031728 Bacteria 1364
221 Ga0307405_10467527 3300031731 Bacteria 1004
222 Ga0307413_10177034 3300031824 Bacteria 1516
223 Ga0316593_10007944 3300032168 Bacteria 2937
224 Ga0316593_10008633 3300032168 Bacteria 2848
225 Ga0316593_10020888 3300032168 Bacteria 2042
226 Ga0316593_10078785 3300032168 Bacteria 1148
227 Ga0316593_10176011 3300032168 Bacteria 785
228 Ga0316586_1081233 3300033527 Bacteria 605
229 Ga0316596_1008470 3300033541 Bacteria 2451
230 Ga0373944_0256524 3300035089 Bacteria 647
231 Ga0373935_0019032 3300035692 Bacteria 4187
232 Ga0373927_1030299 3300035695 Bacteria 543
233 Ga0373933_0445506 3300035724 Bacteria 847
234 Ga0373933_0498110 3300035724 Bacteria 798
235 Ga0373947_0044569 3300035725 Bacteria 2652
236 Ga0373937_0125512 3300036401 Bacteria 2394
237 Ga0373937_0257814 3300036401 Bacteria 1644
238 Ga0316584_0571924 3300036712 Bacteria 787
239 Ga0373925_0543580 3300037068 Bacteria 955
240 Ga0395899_0000105 3300037312 Bacteria 146163
241 Ga0395899_0128160 3300037312 Bacteria 1814
242 Ga0395900_0060003 3300037418 Bacteria 3915
243 Ga0395900_0776233 3300037418 Bacteria 887
244 Ga0395898_0320867 3300037466 Bacteria 1478
245 Ga0395898_0361499 3300037466 Bacteria 1384
246 Ga0395905_0015820 3300037471 Bacteria 7166
247 Ga0395905_0096583 3300037471 Bacteria 2774
248 Ga0436364_0743164 3300037853 Bacteria 9802
249 Ga0436364_0866406 3300037853 Bacteria 4069
250 Ga0436364_1037710 3300037853 Bacteria 1007
251 Ga0395901_0058183 3300038443 Bacteria 4021
252 Ga0395901_0140376 3300038443 Bacteria 2539
253 Ga0400483_014056 3300039062 Bacteria 3378
254 Ga0400483_046766 3300039062 Bacteria 1297
255 Ga0400483_154328 3300039062 Bacteria 1159
256 Ga0400483_154910 3300039062 Bacteria 1953
257 Ga0400483_187305 3300039062 Bacteria 5029
258 Ga0237816_01805 3300039145 Bacteria 1710
259 Ga0436365_0637755 3300039437 Bacteria 882
260 Ga0436365_1136540 3300039437 Bacteria 40433
261 Ga0436365_1763809 3300039437 Bacteria 1750
262 Ga0436360_0452772 3300039438 Bacteria 2288
263 Ga0436360_1093457 3300039438 Bacteria 642
264 Ga0436361_0328563 3300039447 Bacteria 616
265 Ga0436361_0464948 3300039447 Bacteria 1268
266 Ga0436361_0479485 3300039447 Bacteria 1534
267 Ga0436361_0491418 3300039447 Bacteria 1175
268 Ga0436361_0533438 3300039447 Bacteria 1363
269 Ga0436361_1159961 3300039447 Bacteria 634
270 Ga0436363_0154863 3300039450 Bacteria 868
271 Ga0436363_0409180 3300039450 Bacteria 1522
272 Ga0436363_0899406 3300039450 Bacteria 4002
273 Ga0436362_0010396 3300039453 Bacteria 795
274 Ga0436362_0941954 3300039453 Bacteria 553
275 Ga0436362_0976116 3300039453 Bacteria 8152
276 Ga0436362_1086879 3300039453 Bacteria 807
277 Ga0439465_0225540 3300041413 Bacteria 688
278 Ga0451789_0212428 3300041443 Bacteria 779
279 Ga0451789_1030109 3300041443 Bacteria 593
280 Ga0451793_0901979 3300041452 Bacteria 542
281 Ga0451797_0917049 3300041453 Bacteria 599
282 Ga0451841_1373453 3300041498 Bacteria 777
283 Ga0451846_09700 3300041502 Bacteria 708
284 Ga0451843_0711516 3300041509 Bacteria 508
285 Ga0451853_1947268 3300041512 Bacteria 523
286 Ga0451853_3695048 3300041512 Bacteria 639
287 Ga0439437_004749 3300042000 Bacteria 1487
288 Ga0439441_036985 3300042001 Bacteria 966
289 Ga0439445_0007571 3300042004 Bacteria 2523
290 Ga0439445_0092836 3300042004 Bacteria 851
291 Ga0450891_015951 3300042129 Bacteria 715
292 Ga0450907_028084 3300042146 Bacteria 954
293 Ga0439435_0256023 3300042436 Bacteria 590
294 Ga0439459_0000576 3300042438 Bacteria 4885
295 Ga0450916_000234 3300042530 Bacteria 4330
296 Ga0466969_0016678 3300044656 Bacteria 3841
297 Ga0466969_0096092 3300044656 Bacteria 1399
298 Ga0466966_0001452 3300044684 Bacteria 15233
299 Ga0466966_0116263 3300044684 Bacteria 1646
300 Ga0466961_0000659 3300044693 Bacteria 21720
301 Ga0466961_0237441 3300044693 Bacteria 1121
302 Ga0466963_0248354 3300044694 Bacteria 1248
303 Ga0466971_0010445 3300044719 Bacteria 4057
304 Ga0466970_0024323 3300044765 Bacteria 3166
305 Ga0466957_0095470 3300044842 Bacteria 1867
306 Ga0466957_0642690 3300044842 Bacteria 745
307 Ga0466959_0000162 3300045049 Bacteria 44052
308 Ga0466959_0093014 3300045049 Bacteria 2164
309 Ga0451576_0003979 3300045051 Bacteria 19673
310 Ga0451576_0043660 3300045051 Bacteria 4729
311 Ga0466958_0004660 3300045836 Bacteria 7274
312 Ga0466958_0739905 3300045836 Bacteria 641
313 Ga0466967_0468759 3300045976 Bacteria 1233
314 Ga0495627_000399 3300046453 Bacteria 38947
315 Ga0495590_0000851 3300046457 Bacteria 13774
316 Ga0495590_0253139 3300046457 Bacteria 656
317 Ga0495590_0322944 3300046457 Bacteria 583
318 Ga0495638_0087536 3300046460 Bacteria 1881
319 Ga0495638_0149164 3300046460 Bacteria 1357
320 Ga0495638_0603644 3300046460 Bacteria 538
321 Ga0495650_0001571 3300046471 Bacteria 21474
322 Ga0495585_0057569 3300046492 Bacteria 2145
323 Ga0495583_0000650 3300046506 Bacteria 45814
324 Ga0495606_0013477 3300046507 Bacteria 6451
325 Ga0495606_0151705 3300046507 Bacteria 1359
326 Ga0495610_0026700 3300046512 Bacteria 3079
327 Ga0495610_0059087 3300046512 Bacteria 1831
328 Ga0495616_0069112 3300046513 Bacteria 1713
329 Ga0495620_0125080 3300046515 Bacteria 1011
330 Ga0495631_0019391 3300046518 Bacteria 3189
331 Ga0495632_0004552 3300046519 Bacteria 9398
332 Ga0495632_0140724 3300046519 Bacteria 1119
333 Ga0495637_0016956 3300046520 Bacteria 3401
334 Ga0495637_0091939 3300046520 Bacteria 1195
335 Ga0495643_0094121 3300046522 Bacteria 1542
336 Ga0495643_0167407 3300046522 Bacteria 1077
337 Ga0495648_0002288 3300046524 Bacteria 17871
338 Ga0495648_0445616 3300046524 Bacteria 567
339 Ga0495652_0464478 3300046529 Bacteria 884
340 Ga0495654_0006712 3300046530 Bacteria 6511
341 Ga0495609_0030354 3300046538 Bacteria 2460
342 Ga0495597_0033708 3300046542 Bacteria 2317
343 Ga0495597_0043806 3300046542 Bacteria 1991
344 Ga0495633_0080184 3300046558 Bacteria 1519
345 Ga0495668_0001818 3300046616 Bacteria 19364
346 Ga0495668_0019185 3300046616 Bacteria 3945
347 Ga0495668_0421880 3300046616 Bacteria 733
348 Ga0495625_0001925 3300046660 Bacteria 23466
349 Ga0495625_0058314 3300046660 Bacteria 2743
350 Ga0495625_0232434 3300046660 Bacteria 1203
351 Ga0495625_0430583 3300046660 Bacteria 818
352 Ga0495659_0002869 3300046664 Bacteria 5535
353 Ga0495661_0138934 3300046665 Bacteria 1324
354 Ga0495669_0358366 3300046684 Bacteria 705
355 Ga0495613_0000576 3300046689 Bacteria 29823
356 Ga0495670_0168018 3300046691 Bacteria 1154
357 Ga0495670_0516710 3300046691 Bacteria 649
358 Ga0495671_0285026 3300046692 Bacteria 795
359 Ga0495649_0000981 3300046694 Bacteria 22495
360 Ga0495649_0131040 3300046694 Bacteria 1323
361 Ga0495589_0034715 3300046794 Bacteria 2530
362 Ga0495589_0454372 3300046794 Bacteria 586
363 Ga0495660_0214314 3300046810 Bacteria 911
364 Ga0495660_0338009 3300046810 Bacteria 672
365 Ga0495672_0000439 3300047320 Bacteria 49666
366 Ga0495672_0079376 3300047320 Bacteria 1833
367 Ga0495672_0140450 3300047320 Bacteria 1262
368 Ga0495683_0011199 3300047323 Bacteria 4727
369 Ga0495679_006048 3300047446 Bacteria 5288
370 Ga0495673_0000189 3300047469 Bacteria 99018
371 Ga0495673_0017740 3300047469 Bacteria 3604
372 Ga0495673_0132665 3300047469 Bacteria 978
373 Ga0495681_0064653 3300047470 Bacteria 1674
374 Ga0495686_0026646 3300047472 Bacteria 3781
375 Ga0495686_0072995 3300047472 Bacteria 2108
376 Ga0495686_0079603 3300047472 Bacteria 2003
377 Ga0495686_0117797 3300047472 Bacteria 1586
378 Ga0496100_0545255 3300048903 Bacteria 897
379 Ga0496106_0006912 3300048909 Bacteria 8394
380 Ga0496106_0180175 3300048909 Bacteria 1677
381 Ga0496107_0000073 3300048910 Bacteria 48489
382 Ga0496107_0146752 3300048910 Bacteria 1745
383 Ga0496108_0694872 3300048911 Bacteria 882
384 Ga0496111_0272869 3300048914 Bacteria 1255
385 Ga0496113_0258424 3300048916 Bacteria 1391
386 Ga0496113_0699668 3300048916 Bacteria 809
387 Ga0496114_0000033 3300048917 Bacteria 166897
388 Ga0496114_0245251 3300048917 Bacteria 1576
389 Ga0496114_1642310 3300048917 Bacteria 531
390 Ga0496115_0021048 3300048918 Bacteria 5033
391 Ga0496115_0028924 3300048918 Bacteria 4347
392 Ga0496115_1264471 3300048918 Bacteria 551
393 Ga0496121_0025980 3300048924 Bacteria 5537
394 Ga0496121_0242092 3300048924 Bacteria 1256
395 Ga0496121_0246123 3300048924 Bacteria 1243
396 Ga0496122_0077737 3300048925 Bacteria 2328
397 Ga0496122_0258233 3300048925 Bacteria 969
398 Ga0496122_0549897 3300048925 Bacteria 550
399 Ga0496123_0088232 3300048926 Bacteria 1853
400 Ga0496123_0211923 3300048926 Bacteria 984
401 Ga0496124_0158136 3300048927 Bacteria 1770
402 Ga0496124_0346068 3300048927 Bacteria 1053
403 Ga0496124_0775296 3300048927 Bacteria 597
404 Ga0496125_0153392 3300048928 Bacteria 1578
405 Ga0496126_0049088 3300048929 Bacteria 3854
406 Ga0501341_02239 3300049131 Bacteria 1031
407 Ga0501304_018737 3300049160 Bacteria 671
408 Ga0495678_001705 3300049459 Bacteria 16503
409 Ga0501311_009757 3300049527 Bacteria 1152
410 Ga0501312_032631 3300049528 Bacteria 823
411 Ga0501314_000774 3300049530 Bacteria 2110
412 Ga0501315_004075 3300049531 Bacteria 1505
413 Ga0501315_031740 3300049531 Bacteria 764
414 Ga0501317_006835 3300049533 Bacteria 1269
415 Ga0501317_009026 3300049533 Bacteria 1162
416 Ga0501318_029083 3300049534 Bacteria 743
417 Ga0501319_000756 3300049535 Bacteria 1660
418 Ga0501320_038537 3300049536 Bacteria 619
419 Ga0501323_002237 3300049539 Bacteria 1852
420 Ga0501323_085480 3300049539 Bacteria 520
421 Ga0501324_002768 3300049540 Bacteria 1297
422 Ga0501325_052579 3300049541 Bacteria 521
423 Ga0501329_05361 3300049545 Bacteria 708
424 Ga0501337_019681 3300049553 Bacteria 544
425 Ga0501031_0017521 3300049568 Bacteria 4656
426 Ga0501033_0247888 3300049570 Bacteria 1263
427 Ga0501033_0401378 3300049570 Unclassified 956
428 Ga0501033_0439003 3300049570 Bacteria 908
429 Ga0501033_0648912 3300049570 Bacteria 721
430 Ga0501034_0000482 3300049571 Bacteria 65380
431 Ga0501034_0050358 3300049571 Bacteria 4201
432 Ga0501034_0084731 3300049571 Bacteria 3171
433 Ga0501034_0114101 3300049571 Bacteria 2691
434 Ga0501034_0169117 3300049571 Bacteria 2154
435 Ga0501034_0496951 3300049571 Bacteria 1134
436 Ga0501034_0553111 3300049571 Bacteria 1060
437 Ga0501034_0699995 3300049571 Bacteria 912
438 Ga0501034_0853449 3300049571 Bacteria 801
439 Ga0501034_1568104 3300049571 Bacteria 532
440 Ga0501036_1137566 3300049572 Bacteria 637
441 Ga0501037_0008751 3300049573 Bacteria 7418
442 Ga0501037_0614373 3300049573 Bacteria 729
443 Ga0501038_0001299 3300049574 Bacteria 22755
444 Ga0501038_0277617 3300049574 Bacteria 1320
445 Ga0501039_0241277 3300049575 Bacteria 1421
446 Ga0501039_1180565 3300049575 Unclassified 592
447 Ga0501043_0201620 3300049579 Bacteria 1544
448 Ga0501043_1193160 3300049579 Bacteria 535
449 Ga0501047_0026121 3300049581 Bacteria 5617
450 Ga0501047_0176818 3300049581 Bacteria 2002
451 Ga0501047_0199368 3300049581 Bacteria 1863
452 Ga0501047_0419998 3300049581 Bacteria 1169
453 Ga0501047_0481136 3300049581 Bacteria 1069
454 Ga0501047_0575858 3300049581 Bacteria 949
455 Ga0501068_0922849 3300049584 Bacteria 575
456 Ga0501069_0543334 3300049585 Bacteria 695
457 Ga0501072_1376532 3300049588 Bacteria 546
458 Ga0501238_000524 3300049671 Bacteria 4389
459 Ga0501238_038222 3300049671 Bacteria 703
460 Ga0501035_0281576 3300049822 Bacteria 1405
461 Ga0501035_0430157 3300049822 Bacteria 1095
462 Ga0501035_1518929 3300049822 Bacteria 510
463 Ga0501044_0038551 3300049823 Bacteria 4990
464 Ga0501044_0306578 3300049823 Bacteria 1515
465 Ga0501044_0622533 3300049823 Bacteria 971
466 Ga0501044_0659725 3300049823 Bacteria 934
467 nmdc:mga03683_381207_c1 3300050489 Bacteria 671
468 nmdc:mga03n38_445242_c1 3300050490 Bacteria 720
469 nmdc:mga00v17_937061_c1 3300050491 Bacteria 547
470 nmdc:mga0yw44_618422_c1 3300050492 Bacteria 736
471 nmdc:mga0k408_364897_c1 3300050493 Bacteria 861
472 nmdc:mga07m45_45178_c1 3300050496 Bacteria 2473
473 nmdc:mga0qj67_738371_c1 3300050509 Bacteria 782
474 nmdc:mga0sz30_61499_c1 3300050516 Bacteria 1605
475 Ga0500578_0000459 3300053086 Bacteria 49572
476 Ga0500578_0333499 3300053086 Bacteria 891
477 Ga0500578_0443331 3300053086 Bacteria 740
478 Ga0500643_013573 3300053087 Bacteria 2871
479 Ga0500643_013812 3300053087 Bacteria 2832
480 Ga0500644_0000193 3300053088 Bacteria 37831
481 Ga0500646_0385284 3300053090 Bacteria 516
482 Ga0500647_0049633 3300053091 Bacteria 2018
483 Ga0500647_0107844 3300053091 Bacteria 1326
484 Ga0500651_0346445 3300053093 Bacteria 844
485 Ga0500566_0249094 3300053094 Bacteria 865
486 Ga0500641_0002284 3300053096 Bacteria 6803
487 Ga0500641_0046486 3300053096 Bacteria 1772
488 Ga0500650_0035877 3300053098 Bacteria 2274
489 Ga0500650_0171820 3300053098 Bacteria 996
490 Ga0500554_000324 3300053102 Bacteria 10286
491 Ga0500556_0001068 3300053104 Bacteria 14047
492 Ga0500556_0044275 3300053104 Bacteria 1583
493 Ga0500556_0083999 3300053104 Bacteria 1207
494 Ga0500562_003596 3300053108 Bacteria 3890
495 Ga0500562_004084 3300053108 Bacteria 3679
496 Ga0500572_028551 3300053111 Bacteria 1536
497 Ga0500594_0000153 3300053118 Bacteria 18197
498 Ga0500595_016759 3300053119 Bacteria 2723
499 Ga0500595_184394 3300053119 Bacteria 578
500 Ga0500597_224954 3300053120 Bacteria 778
501 Ga0500608_000165 3300053122 Bacteria 27378
502 Ga0500608_117892 3300053122 Bacteria 1208
503 Ga0500614_054013 3300053123 Bacteria 1063
504 Ga0500614_061429 3300053123 Bacteria 1011
505 Ga0500618_000703 3300053125 Bacteria 19670
506 Ga0500642_0239264 3300053130 Bacteria 837
507 Ga0500655_015206 3300053133 Bacteria 1411
508 Ga0500658_0001787 3300053134 Bacteria 8487
509 Ga0500559_0000113 3300053136 Bacteria 63512
510 Ga0500559_0001398 3300053136 Bacteria 13721
511 Ga0500559_0016148 3300053136 Bacteria 3152
512 Ga0500559_0365135 3300053136 Bacteria 674
513 Ga0500564_000145 3300053138 Bacteria 18335
514 Ga0500568_0044246 3300053139 Bacteria 1777
515 Ga0500568_0080837 3300053139 Bacteria 1234
516 Ga0500573_0144994 3300053140 Bacteria 1304
517 Ga0500577_0027599 3300053142 Bacteria 1946
518 Ga0500588_0023345 3300053146 Bacteria 1694
519 Ga0500589_208111 3300053147 Bacteria 746
520 Ga0500590_172269 3300053148 Bacteria 950
521 Ga0500616_0088560 3300053153 Bacteria 1538
522 Ga0500616_0163696 3300053153 Bacteria 1017
523 Ga0500619_053637 3300053154 Bacteria 1311
524 Ga0500622_0000771 3300053156 Bacteria 27846
525 Ga0500622_0003985 3300053156 Bacteria 9528
526 Ga0500622_0036800 3300053156 Bacteria 2557
527 Ga0500622_0314243 3300053156 Bacteria 662
528 Ga0500622_0350024 3300053156 Bacteria 613
529 Ga0500627_0046520 3300053158 Bacteria 1880
530 Ga0500633_0042334 3300053160 Bacteria 1536
531 Ga0500634_0171596 3300053161 Bacteria 987
532 Ga0500638_179831 3300053162 Bacteria 914
533 Ga0500639_129768 3300053163 Bacteria 1196
534 Ga0500636_0106904 3300053177 Bacteria 1585
535 Ga0500570_140607 3300053724 Bacteria 889
536 Ga0500611_011461 3300053727 Bacteria 1467
537 Ga0500645_009863 3300053730 Bacteria 3189
538 Ga0500645_030083 3300053730 Bacteria 1636
539 Ga0500645_038787 3300053730 Bacteria 1412
540 Ga0500609_000093 3300053731 Bacteria 11592
541 Ga0500609_014359 3300053731 Bacteria 1073
542 Ga0500661_055671 3300055283 Bacteria 710
543 Ga0587084_001790 3300059477 Bacteria 2107
544 Ga0587084_041670 3300059477 Bacteria 782
545 Ga0587084_049791 3300059477 Bacteria 738
546 Ga0587093_018561 3300059478 Bacteria 907
547 Ga0587093_040621 3300059478 Bacteria 704
548 Ga0587093_060739 3300059478 Bacteria 616
549 Ga0587066_021865 3300059490 Bacteria 1065
550 Ga0587066_086518 3300059490 Bacteria 688
551 Ga0587070_023885 3300059491 Bacteria 1054
552 Ga0587073_0095231 3300059492 Bacteria 764
553 Ga0587073_0190089 3300059492 Bacteria 609
554 Ga0587077_000161 3300059493 Bacteria 4481
555 Ga0587077_007264 3300059493 Bacteria 1606
556 Ga0587080_135711 3300059503 Bacteria 558
557 Ga0587083_0138225 3300059505 Bacteria 646
558 Ga0587085_105957 3300059506 Bacteria 600
559 Ga0587086_014512 3300059507 Bacteria 1006
560 Ga0587086_014966 3300059507 Bacteria 996
561 Ga0587086_016563 3300059507 Bacteria 964
562 Ga0587086_028377 3300059507 Bacteria 809
563 Ga0587088_031808 3300059508 Bacteria 947
564 Ga0587088_063117 3300059508 Bacteria 755
565 Ga0587089_050042 3300059509 Bacteria 668
566 Ga0587090_001474 3300059510 Bacteria 2393
567 Ga0587090_007980 3300059510 Bacteria 1407
568 Ga0587091_236636 3300059511 Bacteria 506
569 Ga0587092_032868 3300059512 Bacteria 867
570 Ga0587094_009396 3300059513 Bacteria 1247
571 Ga0587101_001189 3300059623 Bacteria 2164
572 Ga0587109_036454 3300059624 Bacteria 957
573 Ga0587109_197567 3300059624 Bacteria 522
574 Ga0587117_012260 3300059627 Bacteria 1079
575 Ga0587117_072891 3300059627 Bacteria 612
576 Ga0587117_083346 3300059627 Bacteria 586
577 Ga0587062_006587 3300059639 Bacteria 1326
578 Ga0587062_048719 3300059639 Bacteria 711
579 Ga0587068_004838 3300059641 Bacteria 1804
580 Ga0587068_016860 3300059641 Bacteria 1161
581 Ga0587069_041394 3300059642 Bacteria 787
582 Ga0587072_096434 3300059643 Bacteria 658
583 Ga0587075_015780 3300059644 Bacteria 1066
584 Ga0587076_000787 3300059645 Bacteria 2870
585 Ga0587078_000144 3300059646 Bacteria 4156
586 Ga0587078_028975 3300059646 Bacteria 738
587 Ga0587100_008302 3300059648 Bacteria 837
588 Ga0587102_030071 3300059649 Bacteria 659
589 Ga0587107_084058 3300059652 Bacteria 603
590 Ga0587110_003821 3300059654 Bacteria 1280
591 Ga0587124_009577 3300059660 Bacteria 851
592 Ga0587124_016159 3300059660 Bacteria 724
593 Ga0587071_063564 3300060344 Bacteria 789
594 Ga0587111_0000079 3300060346 Bacteria 5946
595 Ga0587111_0000967 3300060346 Bacteria 3179
596 Ga0587111_0037802 3300060346 Bacteria 1016
597 Ga0587111_0126633 3300060346 Bacteria 663
598 Ga0587111_0135908 3300060346 Bacteria 647
599 Ga0466962_0003721 3300061719 Bacteria 7277
600 2512032375 2511231221 Bacteria 6846400
601 2599105609 2597490356 Bacteria 7030811
602 2844534359 2844533157 Bacteria 7517899
603 2846954705 2846952575 Bacteria 6587527
604 2848859028 2848858292 Bacteria 7391279
605 8054005923 8054002106 Bacteria 7987183
606 Ga0070666_11144327
607 JGI24751J29686_10031233
608 JGI25159J45721_1005639
609 Ga0006760J45825_104920
610 Ga0006759J45824_1069825
611 Ga0006759J45824_1093412
612 JGI25151J46595_10000624
613 JGI25153J46596_10020623
614 rootL2_10069702
615 rootL2_10134251
616 rootH1_10228499
617 JGI25160J50197_1004313
618 Ga0007427J51700_108029
619 Ga0007429J51699_1025305
620 Ga0032354_1009883
621 Ga0032354_1036765
622 Ga0055526_1026248
623 Ga0055537_1004503
624 Ga0055524_1037192
625 Ga0055524_1052374
626 Ga0055534_1043029
627 Ga0055528_1007701
628 Ga0055530_10053500
629 Ga0055531_10023544
630 Ga0055531_10068005
631 Ga0055543_1043964
632 Ga0065165_1002762
633 Ga0065704_10007805
634 Ga0070658_10503281
635 Ga0070658_10737474
636 Ga0070683_100461961
637 Ga0070670_100461539
638 Ga0068869_101085680
639 Ga0070680_101335264
640 Ga0070682_101299911
641 Ga0068868_101014902
642 Ga0070660_100775744
643 Ga0070661_100418722
644 Ga0070668_100001882
645 Ga0070669_100050591
646 Ga0070671_100011171
647 Ga0070673_101556241
648 Ga0070659_101321666
649 Ga0070667_100021170
650 Ga0070667_100594634
651 Ga0070709_10402063
652 Ga0070714_100285187
653 Ga0070714_101687603
654 Ga0070713_100107963
655 Ga0070710_10136161
656 Ga0070711_100557170
657 Ga0070663_101215590
658 Ga0070663_101589573
659 Ga0070678_100463708
660 Ga0070685_10005750
661 Ga0070684_102023121
662 Ga0070672_101379419
663 Ga0070686_100505957
664 Ga0070686_101397684
665 Ga0070665_100349684
666 Ga0068855_100575861
667 Ga0068855_101677522
668 Ga0070664_101039164
669 Ga0070664_102350384
670 Ga0068856_100134295
671 Ga0068856_100694970
672 Ga0068852_101458078
673 Ga0068864_100030863
674 Ga0068861_102704965
675 Ga0068863_100080807
676 Ga0068863_100182679
677 Ga0068858_100000261
678 Ga0068860_100000042
679 Ga0068862_100003686
680 Ga0068862_102162301
681 Ga0081455_10058498
682 Ga0081540_1017843
683 Ga0070717_10294886
684 Ga0075365_10444201
685 Ga0075363_100292289
686 Ga0075364_10327156
687 Ga0070716_100158507
688 Ga0070712_100227825
689 Ga0075362_10306772
690 Ga0075362_10559589
691 Ga0075367_10767659
692 Ga0075369_10010071
693 Ga0075366_10031500
694 Ga0097621_100328028
695 Ga0075370_10363622
696 Ga0075370_10855728
697 Ga0075430_100652120
698 Ga0105240_10022560
699 Ga0105240_10058879
700 Ga0105240_10255649
701 Ga0105240_10413825
702 Ga0105240_12393746
703 Ga0105245_11808632
704 Ga0105241_10326042
705 Ga0105241_11546966
706 Ga0105242_10461280
707 Ga0105248_10440021
708 Ga0105248_12360574
709 Ga0105237_10224191
710 Ga0105237_10433354
711 Ga0105237_12630793
712 Ga0105238_10196243
713 Ga0105238_10326749
714 Ga0105238_10724768
715 Ga0105238_10829427
716 Ga0105238_10859111
717 Ga0105033_104982
718 Ga0105239_10905051
719 Ga0105239_11856159
720 Ga0157347_1011264
721 Ga0157327_1004697
722 Ga0157373_10348597
723 Ga0157370_10483229
724 Ga0157378_12825693
725 Ga0163162_11460712
726 Ga0157372_10364270
727 Ga0163163_10269543
728 Ga0163163_11528902
729 Ga0157379_10238620
730 Ga0163161_10878043
731 Ga0213873_10031217
732 Ga0213872_10039932
733 Ga0213874_10161379
734 Ga0213876_10008440
735 Ga0213875_10058981
736 Ga0213871_10012207
737 Ga0213871_10111587
738 Ga0209233_1017172
739 Ga0209565_1000925
740 Ga0209673_1001876
741 Ga0209130_1000706
742 Ga0209675_1002644
743 Ga0209675_1038255
744 Ga0209676_1022325
745 Ga0209025_1000750
746 Ga0209564_1007568
747 Ga0209564_1015779
748 Ga0209758_1023594
749 Ga0209050_1019693
750 Ga0209256_1003893
751 Ga0209256_1020366
752 Ga0207426_1000336
753 Ga0209051_1000877
754 Ga0209257_1000976
755 Ga0209257_1008377
756 Ga0207692_10089803
757 Ga0207647_10645457
758 Ga0207645_10029047
759 Ga0207705_10672397
760 Ga0207707_11353605
761 Ga0207695_10049522
762 Ga0207695_10076710
763 Ga0207671_10258019
764 Ga0207671_10790721
765 Ga0207657_10493531
766 Ga0207649_10214678
767 Ga0207652_10439885
768 Ga0207681_10452633
769 Ga0207694_10027541
770 Ga0207694_10211628
771 Ga0207694_10677710
772 Ga0207694_10748388
773 Ga0207650_11485020
774 Ga0207659_11811051
775 Ga0207700_10111800
776 Ga0207664_10019250
777 Ga0207664_11891233
778 Ga0207644_10018207
779 Ga0207690_10870636
780 Ga0207706_11091972
781 Ga0207686_11529165
782 Ga0207665_10064425
783 Ga0207691_11556722
784 Ga0207711_11898226
785 Ga0207711_12094047
786 Ga0207661_11079713
787 Ga0207679_11297557
788 Ga0207667_10014133
789 Ga0207667_10434857
790 Ga0207667_12015332
791 Ga0207651_11387531
792 Ga0207658_10000002
793 Ga0207703_10000253
794 Ga0207703_11582981
795 Ga0207678_11114722
796 Ga0207678_11369025
797 Ga0207702_10683874
798 Ga0207702_11087444
799 Ga0207641_10001025
800 Ga0207641_10101679
801 Ga0207648_11040737
802 Ga0207676_10173154
803 Ga0207674_10434651
804 Ga0207698_11282310
805 Ga0209970_1062345
806 Ga0209974_10065831
807 Ga0268266_10005155
808 Ga0268266_12119386
809 Ga0268265_10000582
810 Ga0268264_10000001
811 Ga0268264_11979525
812 Ga0307517_10130623
813 Ga0307515_10072026
814 Ga0307515_10486084
815 Ga0307512_10169625
816 Ga0265332_10232294
817 Ga0265331_10156725
818 Ga0265331_10463231
819 Ga0265327_10007046
820 Ga0265327_10042561
821 Ga0307513_10010515
822 Ga0265314_10053314
823 Ga0265314_10083091
824 Ga0265342_10180916
825 Ga0316578_10158531
826 Ga0307405_10467527
827 Ga0307413_10177034
828 Ga0316593_10007944
829 Ga0316593_10008633
830 Ga0316593_10020888
831 Ga0316593_10078785
832 Ga0316593_10176011
833 Ga0316586_1081233
834 Ga0316596_1008470
835 Ga0373944_0256524
836 Ga0373935_0019032
837 Ga0373927_1030299
838 Ga0373933_0445506
839 Ga0373933_0498110
840 Ga0373947_0044569
841 Ga0373937_0125512
842 Ga0373937_0257814
843 Ga0316584_0571924
844 Ga0373925_0543580
845 Ga0395899_0000105
846 Ga0395899_0128160
847 Ga0395900_0060003
848 Ga0395900_0776233
849 Ga0395898_0320867
850 Ga0395898_0361499
851 Ga0395905_0015820
852 Ga0395905_0096583
853 Ga0436364_0743164
854 Ga0436364_0866406
855 Ga0436364_1037710
856 Ga0395901_0058183
857 Ga0395901_0140376
858 Ga0400483_014056
859 Ga0400483_046766
860 Ga0400483_154328
861 Ga0400483_154910
862 Ga0400483_187305
863 Ga0237816_01805
864 Ga0436365_0637755
865 Ga0436365_1136540
866 Ga0436365_1763809
867 Ga0436360_0452772
868 Ga0436360_1093457
869 Ga0436361_0328563
870 Ga0436361_0464948
871 Ga0436361_0479485
872 Ga0436361_0491418
873 Ga0436361_0533438
874 Ga0436361_1159961
875 Ga0436363_0154863
876 Ga0436363_0409180
877 Ga0436363_0899406
878 Ga0436362_0010396
879 Ga0436362_0941954
880 Ga0436362_0976116
881 Ga0436362_1086879
882 Ga0439465_0225540
883 Ga0451789_0212428
884 Ga0451789_1030109
885 Ga0451793_0901979
886 Ga0451797_0917049
887 Ga0451841_1373453
888 Ga0451846_09700
889 Ga0451843_0711516
890 Ga0451853_1947268
891 Ga0451853_3695048
892 Ga0439437_004749
893 Ga0439441_036985
894 Ga0439445_0007571
895 Ga0439445_0092836
896 Ga0450891_015951
897 Ga0450907_028084
898 Ga0439435_0256023
899 Ga0439459_0000576
900 Ga0450916_000234
901 Ga0466969_0016678
902 Ga0466969_0096092
903 Ga0466966_0001452
904 Ga0466966_0116263
905 Ga0466961_0000659
906 Ga0466961_0237441
907 Ga0466963_0248354
908 Ga0466971_0010445
909 Ga0466970_0024323
910 Ga0466957_0095470
911 Ga0466957_0642690
912 Ga0466959_0000162
913 Ga0466959_0093014
914 Ga0451576_0003979
915 Ga0451576_0043660
916 Ga0466958_0004660
917 Ga0466958_0739905
918 Ga0466967_0468759
919 Ga0495627_000399
920 Ga0495590_0000851
921 Ga0495590_0253139
922 Ga0495590_0322944
923 Ga0495638_0087536
924 Ga0495638_0149164
925 Ga0495638_0603644
926 Ga0495650_0001571
927 Ga0495585_0057569
928 Ga0495583_0000650
929 Ga0495606_0013477
930 Ga0495606_0151705
931 Ga0495610_0026700
932 Ga0495610_0059087
933 Ga0495616_0069112
934 Ga0495620_0125080
935 Ga0495631_0019391
936 Ga0495632_0004552
937 Ga0495632_0140724
938 Ga0495637_0016956
939 Ga0495637_0091939
940 Ga0495643_0094121
941 Ga0495643_0167407
942 Ga0495648_0002288
943 Ga0495648_0445616
944 Ga0495652_0464478
945 Ga0495654_0006712
946 Ga0495609_0030354
947 Ga0495597_0033708
948 Ga0495597_0043806
949 Ga0495633_0080184
950 Ga0495668_0001818
951 Ga0495668_0019185
952 Ga0495668_0421880
953 Ga0495625_0001925
954 Ga0495625_0058314
955 Ga0495625_0232434
956 Ga0495625_0430583
957 Ga0495659_0002869
958 Ga0495661_0138934
959 Ga0495669_0358366
960 Ga0495613_0000576
961 Ga0495670_0168018
962 Ga0495670_0516710
963 Ga0495671_0285026
964 Ga0495649_0000981
965 Ga0495649_0131040
966 Ga0495589_0034715
967 Ga0495589_0454372
968 Ga0495660_0214314
969 Ga0495660_0338009
970 Ga0495672_0000439
971 Ga0495672_0079376
972 Ga0495672_0140450
973 Ga0495683_0011199
974 Ga0495679_006048
975 Ga0495673_0000189
976 Ga0495673_0017740
977 Ga0495673_0132665
978 Ga0495681_0064653
979 Ga0495686_0026646
980 Ga0495686_0072995
981 Ga0495686_0079603
982 Ga0495686_0117797
983 Ga0496100_0545255
984 Ga0496106_0006912
985 Ga0496106_0180175
986 Ga0496107_0000073
987 Ga0496107_0146752
988 Ga0496108_0694872
989 Ga0496111_0272869
990 Ga0496113_0258424
991 Ga0496113_0699668
992 Ga0496114_0000033
993 Ga0496114_0245251
994 Ga0496114_1642310
995 Ga0496115_0021048
996 Ga0496115_0028924
997 Ga0496115_1264471
998 Ga0496121_0025980
999 Ga0496121_0242092
1000 Ga0496121_0246123
1001 Ga0496122_0077737
1002 Ga0496122_0258233
1003 Ga0496122_0549897
1004 Ga0496123_0088232
1005 Ga0496123_0211923
1006 Ga0496124_0158136
1007 Ga0496124_0346068
1008 Ga0496124_0775296
1009 Ga0496125_0153392
1010 Ga0496126_0049088
1011 Ga0501341_02239
1012 Ga0501304_018737
1013 Ga0495678_001705
1014 Ga0501311_009757
1015 Ga0501312_032631
1016 Ga0501314_000774
1017 Ga0501315_004075
1018 Ga0501315_031740
1019 Ga0501317_006835
1020 Ga0501317_009026
1021 Ga0501318_029083
1022 Ga0501319_000756
1023 Ga0501320_038537
1024 Ga0501323_002237
1025 Ga0501323_085480
1026 Ga0501324_002768
1027 Ga0501325_052579
1028 Ga0501329_05361
1029 Ga0501337_019681
1030 Ga0501031_0017521
1031 Ga0501033_0247888
1032 Ga0501033_0401378
1033 Ga0501033_0439003
1034 Ga0501033_0648912
1035 Ga0501034_0000482
1036 Ga0501034_0050358
1037 Ga0501034_0084731
1038 Ga0501034_0114101
1039 Ga0501034_0169117
1040 Ga0501034_0496951
1041 Ga0501034_0553111
1042 Ga0501034_0699995
1043 Ga0501034_0853449
1044 Ga0501034_1568104
1045 Ga0501036_1137566
1046 Ga0501037_0008751
1047 Ga0501037_0614373
1048 Ga0501038_0001299
1049 Ga0501038_0277617
1050 Ga0501039_0241277
1051 Ga0501039_1180565
1052 Ga0501043_0201620
1053 Ga0501043_1193160
1054 Ga0501047_0026121
1055 Ga0501047_0176818
1056 Ga0501047_0199368
1057 Ga0501047_0419998
1058 Ga0501047_0481136
1059 Ga0501047_0575858
1060 Ga0501068_0922849
1061 Ga0501069_0543334
1062 Ga0501072_1376532
1063 Ga0501238_000524
1064 Ga0501238_038222
1065 Ga0501035_0281576
1066 Ga0501035_0430157
1067 Ga0501035_1518929
1068 Ga0501044_0038551
1069 Ga0501044_0306578
1070 Ga0501044_0622533
1071 Ga0501044_0659725
1072 nmdc:mga03683_381207_c1
1073 nmdc:mga03n38_445242_c1
1074 nmdc:mga00v17_937061_c1
1075 nmdc:mga0yw44_618422_c1
1076 nmdc:mga0k408_364897_c1
1077 nmdc:mga07m45_45178_c1
1078 nmdc:mga0qj67_738371_c1
1079 nmdc:mga0sz30_61499_c1
1080 Ga0500578_0000459
1081 Ga0500578_0333499
1082 Ga0500578_0443331
1083 Ga0500643_013573
1084 Ga0500643_013812
1085 Ga0500644_0000193
1086 Ga0500646_0385284
1087 Ga0500647_0049633
1088 Ga0500647_0107844
1089 Ga0500651_0346445
1090 Ga0500566_0249094
1091 Ga0500641_0002284
1092 Ga0500641_0046486
1093 Ga0500650_0035877
1094 Ga0500650_0171820
1095 Ga0500554_000324
1096 Ga0500556_0001068
1097 Ga0500556_0044275
1098 Ga0500556_0083999
1099 Ga0500562_003596
1100 Ga0500562_004084
1101 Ga0500572_028551
1102 Ga0500594_0000153
1103 Ga0500595_016759
1104 Ga0500595_184394
1105 Ga0500597_224954
1106 Ga0500608_000165
1107 Ga0500608_117892
1108 Ga0500614_054013
1109 Ga0500614_061429
1110 Ga0500618_000703
1111 Ga0500642_0239264
1112 Ga0500655_015206
1113 Ga0500658_0001787
1114 Ga0500559_0000113
1115 Ga0500559_0001398
1116 Ga0500559_0016148
1117 Ga0500559_0365135
1118 Ga0500564_000145
1119 Ga0500568_0044246
1120 Ga0500568_0080837
1121 Ga0500573_0144994
1122 Ga0500577_0027599
1123 Ga0500588_0023345
1124 Ga0500589_208111
1125 Ga0500590_172269
1126 Ga0500616_0088560
1127 Ga0500616_0163696
1128 Ga0500619_053637
1129 Ga0500622_0000771
1130 Ga0500622_0003985
1131 Ga0500622_0036800
1132 Ga0500622_0314243
1133 Ga0500622_0350024
1134 Ga0500627_0046520
1135 Ga0500633_0042334
1136 Ga0500634_0171596
1137 Ga0500638_179831
1138 Ga0500639_129768
1139 Ga0500636_0106904
1140 Ga0500570_140607
1141 Ga0500611_011461
1142 Ga0500645_009863
1143 Ga0500645_030083
1144 Ga0500645_038787
1145 Ga0500609_000093
1146 Ga0500609_014359
1147 Ga0500661_055671
1148 Ga0587084_001790
1149 Ga0587084_041670
1150 Ga0587084_049791
1151 Ga0587093_018561
1152 Ga0587093_040621
1153 Ga0587093_060739
1154 Ga0587066_021865
1155 Ga0587066_086518
1156 Ga0587070_023885
1157 Ga0587073_0095231
1158 Ga0587073_0190089
1159 Ga0587077_000161
1160 Ga0587077_007264
1161 Ga0587080_135711
1162 Ga0587083_0138225
1163 Ga0587085_105957
1164 Ga0587086_014512
1165 Ga0587086_014966
1166 Ga0587086_016563
1167 Ga0587086_028377
1168 Ga0587088_031808
1169 Ga0587088_063117
1170 Ga0587089_050042
1171 Ga0587090_001474
1172 Ga0587090_007980
1173 Ga0587091_236636
1174 Ga0587092_032868
1175 Ga0587094_009396
1176 Ga0587101_001189
1177 Ga0587109_036454
1178 Ga0587109_197567
1179 Ga0587117_012260
1180 Ga0587117_072891
1181 Ga0587117_083346
1182 Ga0587062_006587
1183 Ga0587062_048719
1184 Ga0587068_004838
1185 Ga0587068_016860
1186 Ga0587069_041394
1187 Ga0587072_096434
1188 Ga0587075_015780
1189 Ga0587076_000787
1190 Ga0587078_000144
1191 Ga0587078_028975
1192 Ga0587100_008302
1193 Ga0587102_030071
1194 Ga0587107_084058
1195 Ga0587110_003821
1196 Ga0587124_009577
1197 Ga0587124_016159
1198 Ga0587071_063564
1199 Ga0587111_0000079
1200 Ga0587111_0000967
1201 Ga0587111_0037802
1202 Ga0587111_0126633
1203 Ga0587111_0135908
1204 Ga0466962_0003721
1205 2512032375
1206 2599105609
1207 2844534359
1208 2846954705
1209 2848859028
1210 8054005923

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00276

Ribosomal_L23

Ribosomal protein L23

28

113

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7m4z-assembly1.cif.gz_S a. baumannii ribosome-eravacycline complex: hpf-bound 70s 0.9734 12 97
8cvm-assembly1.cif.gz_s cutibacterium acnes 50s ribosomal subunit with p-site trna and sarecycline bound in the local refined map 0.9653 13 100
6tnn-assembly1.cif.gz_m mini-rnase iii (mini-iii) bound to 50s ribosome with precursor 23s rrna 0.9511 13 100
7jil-assembly1.cif.gz_T 70s ribosome flavobacterium johnsoniae 0.9491 16 99
8cgd-assembly1.cif.gz_s clindamycin bound to the 50s subunit 0.949 12 93
ID Description Score Start End Superfamily
6hmaR00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.9455 13 99 3.30.70.330
af_P61845_1_86_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.9234 15 99 3.30.70.330
af_P54016_1_86_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.9133 13 96 3.30.70.330
4garT00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.909 10 98 3.30.70.330
6hmaR00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.9053 13 99 3.30.70.330
ID Description Score Start End GO Terms
AF-A0A529KDH5-F1-model_v4 50S ribosomal protein L23 0.9892 10 91 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A1F6BQ52-F1-model_v4 Large ribosomal subunit protein uL23 0.9879 15 101 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A554LQX1-F1-model_v4 Large ribosomal subunit protein uL23 0.9875 15 100 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A365Z1K3-F1-model_v4 Large ribosomal subunit protein uL23 0.9868 12 101 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A1G1NIZ4-F1-model_v4 Large ribosomal subunit protein uL23 0.9866 13 99 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904

Map