F468441

General Info

Members Datasets Scaffolds Average Seq Length
605 308 1210 188

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100003166|Ga0070714_1000031663
Length 197
Sequence MVIQTKPSQAMSLLILGLIVFLGAHSLRIFADSWRSAQIARIGEGSWKGLYSLVSIAGFVLLIWGYGRARAATTVLWQPPSWTHYVAALFVLLAAAYVRGTRIKSALHHPMILGVKSWAFGHLIANGTLADVVLFGSFLVWAIVDFAASRRRDRLAGTVYPPGTASRDAIAIAIGLAAWAIFAFYLHERWIGVRPLG

Samples

Sample ID Description Type Environment
1 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
10 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
11 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
12 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
16 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
17 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
18 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
19 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
20 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
21 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
22 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
23 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
24 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
25 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
28 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
29 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
30 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
31 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
34 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
35 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
42 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
43 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
44 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
45 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
46 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
47 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
48 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
52 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
53 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
54 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
57 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
60 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
61 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
62 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
63 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
74 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
75 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
76 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
77 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
78 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
79 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
80 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
81 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
82 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
97 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
98 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
99 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
113 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
114 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
119 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
120 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
121 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
122 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
123 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
128 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
129 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
131 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
132 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
135 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
136 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
137 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
139 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
195 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
196 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
197 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
198 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
199 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
200 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
201 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
202 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
203 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
204 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
205 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
206 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
207 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
208 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
209 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
210 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
211 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
212 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
213 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
214 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
215 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
216 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
217 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
218 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
219 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
220 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
221 3300044536 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E Metagenome Unclassified
222 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
223 3300044661 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COC2E Metagenome Unclassified
224 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
225 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
226 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
227 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
228 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
229 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
230 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
231 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
232 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
233 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
234 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
235 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
236 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
237 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
238 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
239 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
240 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
241 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
242 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
243 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
244 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
245 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
246 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
247 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
248 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
249 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
250 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
251 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
252 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
253 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
254 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
255 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
256 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
257 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
258 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
259 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
260 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
261 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
262 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
263 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
264 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
265 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
266 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
267 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
268 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
269 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
270 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
271 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
272 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
273 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
274 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
275 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
276 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
277 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
278 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
279 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
291 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
292 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
295 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
296 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
297 2547132374 Acidovorax radicis N35 Isolate Unclassified
298 2643221596 Acidovorax sp. Root70 Isolate Unclassified
299 2643221717 Acidovorax sp. Root267 Isolate Unclassified
300 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
301 2739367700 Dyella sp. YR388 Isolate Unclassified
302 2884411467 Dyella sp. AD56 Isolate Rhizosphere
303 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
304 2928963466 Dyella japonica 1073 Isolate Unclassified
305 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
306 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
307 641228493 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
308 643348555 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.19
Metatranscriptomes 0.83
Isolates 1.98

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.9
Nodule 0
Rhizoplane 2.31
Rhizosphere 76.2
Stem 0
Stem Tuber 0
Unclassified 2.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070714_100003166 3300005435 Bacteria 12226
2 JGI24739J22299_10033551 3300001989 Bacteria 1755
3 JGI24737J22298_10009446 3300001990 Bacteria 3241
4 JGI24735J21928_10001277 3300002067 Bacteria 8942
5 JGI25156J39149_1015071 3300002705 Bacteria 1564
6 JGI25156J39149_1015911 3300002705 Bacteria 1484
7 JGI25156J39149_1021733 3300002705 Bacteria 1105
8 JGI25162J39368_1000147 3300002737 Bacteria 76626
9 JGI25162J39368_1000542 3300002737 Bacteria 28083
10 JGI25162J39368_1000635 3300002737 Bacteria 24948
11 JGI25162J39368_1005348 3300002737 Bacteria 2558
12 JGI25154J39366_1009293 3300002738 Bacteria 1218
13 JGI25157J39369_1000093 3300002741 Bacteria 76626
14 JGI25157J39369_1000201 3300002741 Bacteria 50342
15 JGI25157J39369_1000880 3300002741 Bacteria 14450
16 JGI25157J39369_1004601 3300002741 Bacteria 2455
17 JGI25163J39215_1000280 3300002771 Bacteria 17823
18 JGI25164J39214_1000118 3300002772 Bacteria 76626
19 JGI25164J39214_1000257 3300002772 Bacteria 40031
20 JGI25164J39214_1000396 3300002772 Bacteria 25543
21 JGI25165J46597_1000236 3300003214 Bacteria 76626
22 JGI25165J46597_1000466 3300003214 Bacteria 40031
23 JGI25165J46597_1001236 3300003214 Bacteria 15148
24 rootH2_10185291 3300003320 Bacteria 3308
25 rootL2_10051235 3300003322 Bacteria 5079
26 rootL2_10051236 3300003322 Bacteria 3927
27 rootL2_10091758 3300003322 Bacteria 1853
28 rootL2_10129005 3300003322 Bacteria 4761
29 rootH1_10122745 3300003323 Bacteria 3189
30 Ga0006562J51391_1049136 3300003578 Bacteria 6642
31 Ga0006562J51391_1049137 3300003578 Bacteria 4845
32 Ga0055538_1001053 3300003751 Bacteria 6171
33 Ga0055539_1002717 3300003752 Bacteria 2619
34 Ga0055533_1000346 3300003756 Bacteria 20192
35 Ga0055533_1001085 3300003756 Bacteria 7806
36 Ga0055527_1000059 3300003760 Bacteria 93123
37 Ga0055527_1000227 3300003760 Bacteria 36032
38 Ga0055527_1014783 3300003760 Bacteria 856
39 Ga0055535_1000138 3300003761 Bacteria 76626
40 Ga0055535_1000174 3300003761 Bacteria 68886
41 Ga0055535_1000710 3300003761 Bacteria 25433
42 Ga0055542_1000137 3300003762 Bacteria 93123
43 Ga0055542_1000148 3300003762 Bacteria 88393
44 Ga0055542_1000186 3300003762 Bacteria 76626
45 Ga0055542_1000247 3300003762 Bacteria 62095
46 Ga0055529_1000174 3300003763 Bacteria 88393
47 Ga0055529_1000226 3300003763 Bacteria 71685
48 Ga0055529_1000617 3300003763 Bacteria 26676
49 Ga0055529_1000673 3300003763 Bacteria 23697
50 Ga0065165_1016309 3300005262 Bacteria 2788
51 Ga0070676_10100119 3300005328 Bacteria 1789
52 Ga0070676_10222141 3300005328 Bacteria 1248
53 Ga0070690_100013405 3300005330 Bacteria 4842
54 Ga0070670_100020464 3300005331 Bacteria 5688
55 Ga0070670_100555319 3300005331 Bacteria 1025
56 Ga0068869_100135379 3300005334 Bacteria 1897
57 Ga0070666_10011473 3300005335 Bacteria 5562
58 Ga0070680_100272770 3300005336 Bacteria 1432
59 Ga0070682_100001784 3300005337 Bacteria 12006
60 Ga0070682_100036416 3300005337 Bacteria 3008
61 Ga0070682_100054070 3300005337 Bacteria 2518
62 Ga0070682_100461798 3300005337 Bacteria 975
63 Ga0070682_101051849 3300005337 Bacteria 679
64 Ga0068868_100004399 3300005338 Bacteria 9876
65 Ga0070660_100014921 3300005339 Bacteria 5606
66 Ga0070660_100333724 3300005339 Bacteria 1247
67 Ga0070689_100000995 3300005340 Bacteria 17729
68 Ga0070689_100007883 3300005340 Bacteria 7469
69 Ga0070691_10013802 3300005341 Bacteria 3708
70 Ga0070661_100050618 3300005344 Bacteria 3040
71 Ga0070661_100256250 3300005344 Bacteria 1351
72 Ga0070671_100017970 3300005355 Bacteria 5736
73 Ga0070673_100002205 3300005364 Bacteria 11773
74 Ga0070688_100000831 3300005365 Bacteria 15289
75 Ga0070659_100001181 3300005366 Bacteria 19020
76 Ga0070659_100008105 3300005366 Bacteria 7662
77 Ga0070667_100021989 3300005367 Bacteria 5293
78 Ga0070667_101183617 3300005367 Bacteria 715
79 Ga0070703_10071009 3300005406 Bacteria 1163
80 Ga0070709_10003682 3300005434 Bacteria 8232
81 Ga0070709_10014647 3300005434 Bacteria 4439
82 Ga0070714_100000469 3300005435 Bacteria 29344
83 Ga0070714_100010012 3300005435 Bacteria 7478
84 Ga0070713_100001157 3300005436 Bacteria 16916
85 Ga0070713_100001667 3300005436 Bacteria 14277
86 Ga0070713_100024483 3300005436 Bacteria 4702
87 Ga0070710_10005292 3300005437 Bacteria 6119
88 Ga0070711_100005338 3300005439 Bacteria 7679
89 Ga0070711_100357918 3300005439 Bacteria 1175
90 Ga0070705_100029748 3300005440 Bacteria 3009
91 Ga0070694_100039028 3300005444 Bacteria 3158
92 Ga0070708_100003086 3300005445 Bacteria 12953
93 Ga0070663_100019336 3300005455 Bacteria 4486
94 Ga0070663_100030132 3300005455 Bacteria 3715
95 Ga0070663_100125392 3300005455 Bacteria 1944
96 Ga0070663_100428083 3300005455 Bacteria 1087
97 Ga0070662_100015393 3300005457 Bacteria 5121
98 Ga0070662_100070623 3300005457 Bacteria 2573
99 Ga0070662_100204665 3300005457 Bacteria 1568
100 Ga0070662_100672278 3300005457 Unclassified 875
101 Ga0070681_10002687 3300005458 Bacteria 16349
102 Ga0070681_10045540 3300005458 Bacteria 4388
103 Ga0070685_10004700 3300005466 Bacteria 6908
104 Ga0070685_10022046 3300005466 Bacteria 3468
105 Ga0070706_100144480 3300005467 Bacteria 2222
106 Ga0070699_100432247 3300005518 Bacteria 1193
107 Ga0070679_100086355 3300005530 Bacteria 3124
108 Ga0070684_100594380 3300005535 Bacteria 1029
109 Ga0070684_100679588 3300005535 Bacteria 959
110 Ga0070697_100064671 3300005536 Bacteria 2987
111 Ga0068853_100004123 3300005539 Bacteria 11204
112 Ga0068853_100093338 3300005539 Bacteria 2649
113 Ga0068853_100350118 3300005539 Bacteria 1374
114 Ga0070695_100043487 3300005545 Bacteria 2856
115 Ga0070696_100000448 3300005546 Bacteria 25817
116 Ga0070696_100047292 3300005546 Bacteria 2985
117 Ga0070696_100071481 3300005546 Bacteria 2441
118 Ga0070693_100001317 3300005547 Bacteria 11188
119 Ga0070693_100014937 3300005547 Bacteria 3992
120 Ga0070693_100050801 3300005547 Bacteria 2371
121 Ga0070693_100051961 3300005547 Bacteria 2348
122 Ga0070665_100003974 3300005548 Bacteria 15588
123 Ga0070665_100146454 3300005548 Unclassified 2364
124 Ga0070704_100004580 3300005549 Bacteria 7994
125 Ga0068855_100016239 3300005563 Bacteria 8953
126 Ga0068855_100131129 3300005563 Bacteria 2862
127 Ga0068855_100136600 3300005563 Bacteria 2797
128 Ga0068855_100510759 3300005563 Bacteria 1305
129 Ga0070664_100709738 3300005564 Unclassified 937
130 Ga0068857_100003595 3300005577 Bacteria 12975
131 Ga0068857_100026961 3300005577 Bacteria 5067
132 Ga0068857_100593813 3300005577 Unclassified 1046
133 Ga0068854_100002135 3300005578 Bacteria 12141
134 Ga0068854_100002377 3300005578 Bacteria 11613
135 Ga0068854_100011613 3300005578 Bacteria 5743
136 Ga0068854_100026834 3300005578 Bacteria 3963
137 Ga0068854_100321635 3300005578 Bacteria 1257
138 Ga0068854_100631316 3300005578 Bacteria 918
139 Ga0068856_100000167 3300005614 Bacteria 68389
140 Ga0068856_100003008 3300005614 Bacteria 17252
141 Ga0070702_100059114 3300005615 Bacteria 2223
142 Ga0068852_100174899 3300005616 Bacteria 2015
143 Ga0068852_100218431 3300005616 Bacteria 1812
144 Ga0068852_100734639 3300005616 Bacteria 999
145 Ga0068859_100134970 3300005617 Bacteria 2540
146 Ga0068859_100208334 3300005617 Bacteria 2041
147 Ga0068864_100003914 3300005618 Bacteria 12263
148 Ga0068864_100062694 3300005618 Unclassified 3221
149 Ga0068864_101375857 3300005618 Bacteria 707
150 Ga0068866_10003710 3300005718 Bacteria 6260
151 Ga0068861_101088336 3300005719 Bacteria 768
152 Ga0068851_10005821 3300005834 Bacteria 5617
153 Ga0068851_10085134 3300005834 Bacteria 1657
154 Ga0068863_100001199 3300005841 Bacteria 25898
155 Ga0068863_100503281 3300005841 Bacteria 1193
156 Ga0068858_100003448 3300005842 Bacteria 15693
157 Ga0068858_100067954 3300005842 Bacteria 3301
158 Ga0068858_100438815 3300005842 Bacteria 1257
159 Ga0068860_100124864 3300005843 Bacteria 2467
160 Ga0068860_100155638 3300005843 Bacteria 2202
161 Ga0068860_100287495 3300005843 Bacteria 1608
162 Ga0068860_100403210 3300005843 Bacteria 1353
163 Ga0068862_100136409 3300005844 Bacteria 2174
164 Ga0070715_10000823 3300006163 Bacteria 8492
165 Ga0070716_100020115 3300006173 Bacteria 3500
166 Ga0070712_100004247 3300006175 Bacteria 8815
167 Ga0070712_100049751 3300006175 Bacteria 2912
168 Ga0070712_100243677 3300006175 Bacteria 1433
169 Ga0068871_100429366 3300006358 Bacteria 1181
170 Ga0075436_100249103 3300006914 Unclassified 1265
171 Ga0097620_100134965 3300006931 Bacteria 2540
172 Ga0097620_100208333 3300006931 Bacteria 2041
173 Ga0105240_10037432 3300009093 Bacteria 6236
174 Ga0105240_10436259 3300009093 Bacteria 1469
175 Ga0105240_10731869 3300009093 Unclassified 1077
176 Ga0105245_10009647 3300009098 Bacteria 8417
177 Ga0105245_10039296 3300009098 Bacteria 4211
178 Ga0105247_10002463 3300009101 Bacteria 12585
179 Ga0105241_10005274 3300009174 Bacteria 9547
180 Ga0105241_10011622 3300009174 Bacteria 6456
181 Ga0105241_10356863 3300009174 Bacteria 1271
182 Ga0105242_10014526 3300009176 Bacteria 6101
183 Ga0105242_10093168 3300009176 Bacteria 2539
184 Ga0105237_10000058 3300009545 Bacteria 146943
185 Ga0105237_10000147 3300009545 Bacteria 99597
186 Ga0105237_10010917 3300009545 Bacteria 9639
187 Ga0105237_10311553 3300009545 Bacteria 1577
188 Ga0105238_10001541 3300009551 Bacteria 23092
189 Ga0105238_10005450 3300009551 Bacteria 12571
190 Ga0105238_10023417 3300009551 Bacteria 6294
191 Ga0105238_10091210 3300009551 Bacteria 3034
192 Ga0105238_10452368 3300009551 Bacteria 1281
193 Ga0105238_10584193 3300009551 Bacteria 1124
194 Ga0105238_11616619 3300009551 Bacteria 678
195 Ga0105249_10327528 3300009553 Bacteria 1545
196 Ga0105249_10867078 3300009553 Bacteria 969
197 Ga0105249_10956700 3300009553 Bacteria 924
198 Ga0105239_10121821 3300010375 Bacteria 2897
199 Ga0105239_10213247 3300010375 Bacteria 2165
200 Ga0105239_10268300 3300010375 Bacteria 1919
201 Ga0105239_10394360 3300010375 Bacteria 1566
202 Ga0105246_10016314 3300011119 Bacteria 4702
203 Ga0157314_1000006 3300012500 Bacteria 27364
204 Ga0157339_1000427 3300012505 Bacteria 2155
205 Ga0157373_10003353 3300013100 Bacteria 12103
206 Ga0157373_10054502 3300013100 Bacteria 2841
207 Ga0157373_10096076 3300013100 Bacteria 2086
208 Ga0157371_10005129 3300013102 Bacteria 11169
209 Ga0157371_10049904 3300013102 Bacteria 2972
210 Ga0157371_10151905 3300013102 Bacteria 1652
211 Ga0157370_10000664 3300013104 Bacteria 42816
212 Ga0157370_10020190 3300013104 Bacteria 6659
213 Ga0157370_10835010 3300013104 Bacteria 838
214 Ga0157369_10000100 3300013105 Bacteria 118782
215 Ga0157369_10010075 3300013105 Bacteria 10792
216 Ga0157369_10115226 3300013105 Bacteria 2854
217 Ga0157369_10538269 3300013105 Bacteria 1207
218 Ga0157369_10628970 3300013105 Bacteria 1107
219 Ga0157369_10882804 3300013105 Bacteria 917
220 Ga0157369_10950498 3300013105 Bacteria 881
221 Ga0157374_10003230 3300013296 Bacteria 13688
222 Ga0157378_10050967 3300013297 Bacteria 3683
223 Ga0157378_10076901 3300013297 Bacteria 3008
224 Ga0163162_10016492 3300013306 Bacteria 7217
225 Ga0163162_10047236 3300013306 Bacteria 4314
226 Ga0163162_10771767 3300013306 Bacteria 1080
227 Ga0157372_10032910 3300013307 Bacteria 5689
228 Ga0157372_10033933 3300013307 Bacteria 5607
229 Ga0157372_11244302 3300013307 Bacteria 860
230 Ga0163163_10005663 3300014325 Bacteria 10836
231 Ga0157380_11168520 3300014326 Bacteria 812
232 Ga0182008_10009583 3300014497 Bacteria 5217
233 Ga0182008_10038064 3300014497 Bacteria 2406
234 Ga0182008_10248145 3300014497 Bacteria 917
235 Ga0157377_10032749 3300014745 Bacteria 2833
236 Ga0157379_10004754 3300014968 Bacteria 11662
237 Ga0157376_10020337 3300014969 Bacteria 5133
238 Ga0157376_10082068 3300014969 Bacteria 2769
239 Ga0182007_10039379 3300015262 Bacteria 1581
240 Ga0183369_1011 3300015685 Bacteria 252490
241 Ga0183368_1007 3300015687 Bacteria 405609
242 Ga0163161_10061600 3300017792 Bacteria 2732
243 Ga0206356_10724426 3300020070 Bacteria 4208
244 Ga0206353_10557298 3300020082 Bacteria 3164
245 Ga0206353_10927230 3300020082 Bacteria 3237
246 Ga0213872_10000744 3300021361 Bacteria 24091
247 Ga0213874_10108813 3300021377 Bacteria 930
248 Ga0213876_10139963 3300021384 Unclassified 1287
249 Ga0209435_103441 3300025206 Bacteria 1810
250 Ga0209435_103823 3300025206 Bacteria 1710
251 Ga0209760_100453 3300025207 Bacteria 9387
252 Ga0209784_100094 3300025224 Bacteria 113434
253 Ga0209674_100037 3300025226 Bacteria 404339
254 Ga0209674_100058 3300025226 Bacteria 286902
255 Ga0209674_100282 3300025226 Bacteria 37567
256 Ga0209674_100645 3300025226 Bacteria 12635
257 Ga0209672_100043 3300025228 Bacteria 270302
258 Ga0209672_100061 3300025228 Bacteria 206098
259 Ga0209672_101847 3300025228 Bacteria 6334
260 Ga0209672_102691 3300025228 Bacteria 4133
261 Ga0209563_100062 3300025230 Bacteria 264769
262 Ga0207427_100068 3300025231 Bacteria 164460
263 Ga0207427_100100 3300025231 Bacteria 121264
264 Ga0207427_100233 3300025231 Bacteria 46070
265 Ga0207427_101476 3300025231 Bacteria 8461
266 Ga0209437_100005 3300025233 Bacteria 1071596
267 Ga0209437_100059 3300025233 Bacteria 355048
268 Ga0209437_100285 3300025233 Bacteria 74366
269 Ga0209437_100305 3300025233 Bacteria 67799
270 Ga0209437_100382 3300025233 Bacteria 43727
271 Ga0209437_106244 3300025233 Bacteria 1990
272 Ga0209258_100034 3300025242 Bacteria 437372
273 Ga0209258_100054 3300025242 Bacteria 339063
274 Ga0209258_100076 3300025242 Bacteria 270302
275 Ga0209258_101955 3300025242 Bacteria 6008
276 Ga0209258_102248 3300025242 Bacteria 5209
277 Ga0209646_1000977 3300025246 Bacteria 8852
278 Ga0209646_1001264 3300025246 Bacteria 7152
279 Ga0209026_1000010 3300025250 Bacteria 511986
280 Ga0209026_1000161 3300025250 Bacteria 102959
281 Ga0209026_1000277 3300025250 Bacteria 59750
282 Ga0209026_1000734 3300025250 Bacteria 18959
283 Ga0209026_1001715 3300025250 Bacteria 9142
284 Ga0209026_1016536 3300025250 Bacteria 1192
285 Ga0209677_100921 3300025253 Bacteria 14378
286 Ga0209148_1000001 3300025254 Bacteria 2545271
287 Ga0209148_1000055 3300025254 Bacteria 367500
288 Ga0209148_1000066 3300025254 Bacteria 339063
289 Ga0209148_1000082 3300025254 Bacteria 270302
290 Ga0209759_1000308 3300025256 Bacteria 66182
291 Ga0209759_1000467 3300025256 Bacteria 45696
292 Ga0209759_1003241 3300025256 Bacteria 6584
293 Ga0209759_1006101 3300025256 Bacteria 4104
294 Ga0209759_1030871 3300025256 Bacteria 1051
295 Ga0209129_1004897 3300025258 Bacteria 4998
296 Ga0209233_1000002 3300025261 Bacteria 2501366
297 Ga0209233_1000011 3300025261 Bacteria 1071611
298 Ga0209233_1000172 3300025261 Bacteria 146504
299 Ga0209233_1019249 3300025261 Bacteria 1819
300 Ga0209455_1000054 3300025272 Bacteria 358936
301 Ga0209455_1000078 3300025272 Bacteria 270237
302 Ga0209455_1000101 3300025272 Bacteria 206098
303 Ga0209455_1000306 3300025272 Bacteria 50304
304 Ga0209455_1010090 3300025272 Bacteria 2427
305 Ga0209758_1001218 3300025297 Bacteria 32278
306 Ga0207656_10001074 3300025321 Bacteria 8932
307 Ga0207692_10014508 3300025898 Bacteria 3444
308 Ga0207642_10001351 3300025899 Bacteria 7605
309 Ga0207710_10012059 3300025900 Bacteria 3633
310 Ga0207680_10125107 3300025903 Bacteria 1687
311 Ga0207647_10006973 3300025904 Bacteria 8189
312 Ga0207647_10010457 3300025904 Bacteria 6555
313 Ga0207647_10039089 3300025904 Bacteria 2996
314 Ga0207685_10007887 3300025905 Bacteria 2998
315 Ga0207699_10007753 3300025906 Bacteria 5257
316 Ga0207699_10013897 3300025906 Bacteria 4134
317 Ga0207699_10152046 3300025906 Bacteria 1532
318 Ga0207645_10319662 3300025907 Bacteria 1035
319 Ga0207645_10766993 3300025907 Bacteria 656
320 Ga0207643_10013762 3300025908 Bacteria 4389
321 Ga0207705_10013749 3300025909 Bacteria 5839
322 Ga0207654_10027662 3300025911 Bacteria 3084
323 Ga0207654_10161186 3300025911 Bacteria 1449
324 Ga0207654_10377629 3300025911 Bacteria 981
325 Ga0207707_10009604 3300025912 Bacteria 8393
326 Ga0207707_10015884 3300025912 Bacteria 6566
327 Ga0207707_10063484 3300025912 Bacteria 3214
328 Ga0207695_10000639 3300025913 Bacteria 69783
329 Ga0207695_10002641 3300025913 Bacteria 26208
330 Ga0207695_10009476 3300025913 Bacteria 12043
331 Ga0207695_10042035 3300025913 Bacteria 4887
332 Ga0207671_10000026 3300025914 Bacteria 268845
333 Ga0207671_10000444 3300025914 Bacteria 57054
334 Ga0207671_10000472 3300025914 Bacteria 54647
335 Ga0207693_10004641 3300025915 Bacteria 11591
336 Ga0207693_10007768 3300025915 Bacteria 8799
337 Ga0207693_10520413 3300025915 Bacteria 928
338 Ga0207663_10223133 3300025916 Unclassified 1372
339 Ga0207657_10016378 3300025919 Bacteria 7151
340 Ga0207657_10023666 3300025919 Bacteria 5714
341 Ga0207657_10065426 3300025919 Bacteria 3099
342 Ga0207657_10283205 3300025919 Bacteria 1316
343 Ga0207649_10053285 3300025920 Bacteria 2513
344 Ga0207649_10406036 3300025920 Bacteria 1020
345 Ga0207652_10038230 3300025921 Bacteria 4066
346 Ga0207652_10064182 3300025921 Bacteria 3177
347 Ga0207694_10000540 3300025924 Bacteria 34333
348 Ga0207694_10168653 3300025924 Bacteria 1771
349 Ga0207694_10228267 3300025924 Bacteria 1520
350 Ga0207650_10029362 3300025925 Bacteria 3953
351 Ga0207687_10022186 3300025927 Bacteria 4223
352 Ga0207687_10032651 3300025927 Bacteria 3527
353 Ga0207700_10001796 3300025928 Bacteria 12186
354 Ga0207700_10039533 3300025928 Bacteria 3435
355 Ga0207700_10124815 3300025928 Bacteria 2093
356 Ga0207664_10000587 3300025929 Bacteria 25388
357 Ga0207664_10002728 3300025929 Bacteria 11725
358 Ga0207664_10042410 3300025929 Bacteria 3551
359 Ga0207644_10021580 3300025931 Bacteria 4389
360 Ga0207690_10001816 3300025932 Bacteria 13094
361 Ga0207690_10002343 3300025932 Bacteria 11496
362 Ga0207690_10003332 3300025932 Bacteria 9609
363 Ga0207690_10004703 3300025932 Bacteria 8059
364 Ga0207690_10029242 3300025932 Bacteria 3501
365 Ga0207706_10001379 3300025933 Bacteria 24277
366 Ga0207706_10117414 3300025933 Bacteria 2340
367 Ga0207706_10129756 3300025933 Bacteria 2217
368 Ga0207686_10000512 3300025934 Bacteria 25164
369 Ga0207686_10008180 3300025934 Bacteria 5643
370 Ga0207670_10000825 3300025936 Bacteria 16217
371 Ga0207670_10005423 3300025936 Bacteria 6997
372 Ga0207704_10039183 3300025938 Bacteria 2756
373 Ga0207665_10012635 3300025939 Bacteria 5550
374 Ga0207691_10099194 3300025940 Bacteria 2601
375 Ga0207711_10000318 3300025941 Bacteria 51496
376 Ga0207711_10378571 3300025941 Bacteria 1313
377 Ga0207689_10082219 3300025942 Bacteria 2648
378 Ga0207679_10521107 3300025945 Bacteria 1063
379 Ga0207667_10000335 3300025949 Bacteria 64576
380 Ga0207667_10000534 3300025949 Bacteria 50148
381 Ga0207667_10007069 3300025949 Bacteria 13560
382 Ga0207667_10198691 3300025949 Bacteria 2057
383 Ga0207667_10452926 3300025949 Bacteria 1304
384 Ga0207651_10002366 3300025960 Bacteria 8998
385 Ga0207712_10205060 3300025961 Bacteria 1566
386 Ga0207712_10627110 3300025961 Bacteria 932
387 Ga0207640_10000434 3300025981 Bacteria 25494
388 Ga0207640_10001615 3300025981 Bacteria 12093
389 Ga0207640_10006812 3300025981 Bacteria 6284
390 Ga0207640_10037901 3300025981 Bacteria 3037
391 Ga0207640_10061627 3300025981 Bacteria 2485
392 Ga0207640_10252957 3300025981 Bacteria 1368
393 Ga0207658_10002930 3300025986 Bacteria 12219
394 Ga0207658_10051244 3300025986 Bacteria 3041
395 Ga0207658_10115693 3300025986 Bacteria 2129
396 Ga0207677_10001431 3300026023 Bacteria 12674
397 Ga0207677_10071908 3300026023 Bacteria 2443
398 Ga0207677_10095363 3300026023 Bacteria 2174
399 Ga0207703_10031572 3300026035 Bacteria 4189
400 Ga0207703_10037730 3300026035 Bacteria 3851
401 Ga0207639_10032195 3300026041 Bacteria 3858
402 Ga0207639_10759189 3300026041 Bacteria 902
403 Ga0207678_10019116 3300026067 Bacteria 6014
404 Ga0207678_10022875 3300026067 Bacteria 5471
405 Ga0207678_10053912 3300026067 Bacteria 3464
406 Ga0207702_10000130 3300026078 Bacteria 89196
407 Ga0207702_10000230 3300026078 Bacteria 64987
408 Ga0207702_10009239 3300026078 Bacteria 8284
409 Ga0207702_10040101 3300026078 Bacteria 3925
410 Ga0207641_10005410 3300026088 Bacteria 10901
411 Ga0207641_10489451 3300026088 Bacteria 1193
412 Ga0207676_10001126 3300026095 Bacteria 20196
413 Ga0207676_10051152 3300026095 Bacteria 3224
414 Ga0207674_10001848 3300026116 Bacteria 26995
415 Ga0207674_10002370 3300026116 Bacteria 23818
416 Ga0207674_10027939 3300026116 Bacteria 5961
417 Ga0207674_10254032 3300026116 Bacteria 1705
418 Ga0207674_10580153 3300026116 Unclassified 1083
419 Ga0207683_10000340 3300026121 Bacteria 42502
420 Ga0207698_10291404 3300026142 Bacteria 1515
421 Ga0207698_10779774 3300026142 Bacteria 957
422 Ga0209974_10004332 3300027876 Bacteria 5047
423 Ga0268266_10199196 3300028379 Bacteria 1832
424 Ga0268266_10626215 3300028379 Bacteria 1034
425 Ga0268265_10025014 3300028380 Bacteria 4232
426 Ga0268264_10014821 3300028381 Bacteria 6403
427 Ga0268264_10044097 3300028381 Bacteria 3699
428 Ga0268264_10074700 3300028381 Bacteria 2880
429 Ga0268264_10082393 3300028381 Unclassified 2752
430 Ga0268264_10162798 3300028381 Bacteria 2011
431 Ga0265331_10190559 3300031250 Bacteria 925
432 Ga0307508_10018765 3300031616 Bacteria 6287
433 Ga0373934_0017516 3300035086 Bacteria 2735
434 Ga0373923_0001138 3300035111 Bacteria 7370
435 Ga0373936_0141617 3300035113 Bacteria 1038
436 Ga0373945_0070590 3300035116 Bacteria 1321
437 Ga0373953_0003856 3300035117 Bacteria 4721
438 Ga0373954_0005075 3300035118 Bacteria 5679
439 Ga0373943_0109753 3300035170 Bacteria 1453
440 Ga0373946_0130113 3300035171 Bacteria 1157
441 Ga0373955_0076885 3300035172 Bacteria 1878
442 Ga0373935_0220757 3300035692 Bacteria 1316
443 Ga0373927_0364746 3300035695 Bacteria 952
444 Ga0373933_0068227 3300035724 Bacteria 2159
445 Ga0373933_0198837 3300035724 Unclassified 1282
446 Ga0373947_0189946 3300035725 Bacteria 1340
447 Ga0373937_0001566 3300036401 Bacteria 19213
448 Ga0373937_0014382 3300036401 Bacteria 6987
449 Ga0373925_0290448 3300037068 Bacteria 1318
450 Ga0395899_0000215 3300037312 Bacteria 82905
451 Ga0395899_0267845 3300037312 Bacteria 1166
452 Ga0395899_0727183 3300037312 Bacteria 620
453 Ga0395900_0000117 3300037418 Bacteria 137733
454 Ga0395898_0000120 3300037466 Bacteria 209091
455 Ga0395898_0031786 3300037466 Bacteria 5272
456 Ga0395898_0507156 3300037466 Bacteria 1147
457 Ga0395901_0006274 3300038443 Bacteria 12046
458 Ga0395901_0637552 3300038443 Bacteria 1070
459 Ga0436365_1746594 3300039437 Bacteria 5593
460 Ga0436361_0953601 3300039447 Bacteria 68101
461 Ga0436363_0550317 3300039450 Unclassified 1320
462 Ga0436363_1016651 3300039450 Bacteria 2246
463 Ga0439437_002011 3300042000 Bacteria 2155
464 Ga0439448_0158129 3300042005 Bacteria 788
465 Ga0439432_028290 3300042006 Bacteria 1826
466 Ga0466988_0062120 3300044536 Bacteria 2202
467 Ga0466969_0005899 3300044656 Bacteria 6512
468 Ga0466969_0010128 3300044656 Bacteria 4999
469 Ga0466969_0015710 3300044656 Bacteria 3967
470 Ga0466975_0029900 3300044661 Bacteria 3786
471 Ga0466982_0000015 3300044672 Bacteria 131281
472 Ga0453683_0867604 3300044673 Unclassified 596
473 Ga0466966_0006222 3300044684 Bacteria 7892
474 Ga0466966_0028014 3300044684 Bacteria 3670
475 Ga0466966_0040737 3300044684 Bacteria 2988
476 Ga0466961_0000721 3300044693 Bacteria 20822
477 Ga0466961_0019093 3300044693 Bacteria 4410
478 Ga0466961_0051808 3300044693 Bacteria 2620
479 Ga0466961_0509112 3300044693 Unclassified 726
480 Ga0466963_0552738 3300044694 Bacteria 813
481 Ga0466971_0012879 3300044719 Bacteria 3668
482 Ga0466971_0045789 3300044719 Bacteria 1965
483 Ga0466968_0011621 3300044735 Bacteria 3433
484 Ga0466970_0000981 3300044765 Bacteria 13735
485 Ga0466970_0033845 3300044765 Bacteria 2702
486 Ga0466970_0113579 3300044765 Bacteria 1480
487 Ga0466970_0134883 3300044765 Bacteria 1357
488 Ga0466959_0000522 3300045049 Bacteria 22243
489 Ga0466959_0024499 3300045049 Bacteria 4470
490 Ga0466959_0188116 3300045049 Bacteria 1442
491 Ga0466959_0198501 3300045049 Bacteria 1397
492 Ga0466958_0031309 3300045836 Bacteria 3162
493 Ga0495629_0408406 3300046459 Bacteria 922
494 Ga0495638_0000324 3300046460 Bacteria 60721
495 Ga0495650_0000092 3300046471 Bacteria 224681
496 Ga0495650_0003845 3300046471 Bacteria 10646
497 Ga0495580_0220794 3300046472 Bacteria 1302
498 Ga0495580_0597595 3300046472 Bacteria 729
499 Ga0495582_0110443 3300046473 Bacteria 1544
500 Ga0495639_0002962 3300046475 Bacteria 7387
501 Ga0495664_0021629 3300046477 Bacteria 3716
502 Ga0495606_0000923 3300046507 Bacteria 43313
503 Ga0495642_0024394 3300046528 Bacteria 2392
504 Ga0495642_0032978 3300046528 Bacteria 2081
505 Ga0495652_0765941 3300046529 Bacteria 645
506 Ga0495665_0025276 3300046531 Bacteria 3190
507 Ga0495586_0094517 3300046535 Bacteria 1654
508 Ga0495622_0002536 3300046557 Bacteria 8820
509 Ga0495667_0137979 3300046559 Bacteria 1572
510 Ga0495625_0029177 3300046660 Bacteria 4129
511 Ga0495625_0280589 3300046660 Bacteria 1072
512 Ga0495659_0010265 3300046664 Bacteria 3000
513 Ga0495588_0126514 3300046674 Bacteria 1348
514 Ga0495657_0452015 3300046675 Unclassified 752
515 Ga0495647_0004971 3300046681 Bacteria 4352
516 Ga0495658_0053101 3300046683 Bacteria 2300
517 Ga0495669_0168152 3300046684 Bacteria 1042
518 Ga0495613_0241298 3300046689 Bacteria 1263
519 Ga0495670_0448239 3300046691 Bacteria 699
520 Ga0495649_0020820 3300046694 Bacteria 3676
521 Ga0495581_0133388 3300047315 Bacteria 1447
522 Ga0495604_0401745 3300047317 Unclassified 902
523 Ga0495636_0070636 3300047318 Bacteria 1489
524 Ga0495674_0149426 3300047319 Bacteria 1960
525 Ga0495672_0000078 3300047320 Bacteria 164474
526 Ga0495675_0242733 3300047444 Bacteria 1084
527 Ga0495685_017300 3300047447 Bacteria 2468
528 Ga0495685_102633 3300047447 Bacteria 944
529 Ga0495684_0279755 3300047471 Bacteria 1204
530 Ga0496100_0272924 3300048903 Bacteria 1258
531 Ga0496101_0419158 3300048904 Bacteria 1055
532 Ga0496102_0000349 3300048905 Bacteria 55942
533 Ga0496104_0004160 3300048907 Bacteria 12557
534 Ga0496105_0078324 3300048908 Bacteria 2729
535 Ga0496109_0025978 3300048912 Bacteria 5219
536 Ga0496109_0764356 3300048912 Bacteria 904
537 Ga0496112_0001169 3300048915 Bacteria 19651
538 Ga0496112_0118265 3300048915 Bacteria 2620
539 Ga0496115_0000105 3300048918 Bacteria 78763
540 Ga0496115_0000261 3300048918 Bacteria 46951
541 Ga0496115_0014620 3300048918 Bacteria 5943
542 Ga0496115_0075876 3300048918 Bacteria 2732
543 Ga0496115_0130963 3300048918 Bacteria 2067
544 Ga0496118_0491680 3300048921 Bacteria 612
545 Ga0496121_0045462 3300048924 Bacteria 3772
546 Ga0496121_0048799 3300048924 Bacteria 3597
547 Ga0496122_0433066 3300048925 Bacteria 657
548 Ga0496125_0003619 3300048928 Bacteria 18554
549 Ga0496126_0044859 3300048929 Bacteria 4068
550 Ga0496126_0088435 3300048929 Bacteria 2728
551 Ga0496126_0219786 3300048929 Bacteria 1596
552 Ga0501032_0613892 3300049569 Unclassified 691
553 Ga0501033_0000758 3300049570 Bacteria 29718
554 Ga0501033_0051135 3300049570 Bacteria 3063
555 Ga0501033_0054031 3300049570 Bacteria 2973
556 Ga0501033_0126177 3300049570 Bacteria 1855
557 Ga0501034_0046063 3300049571 Bacteria 4406
558 Ga0501036_0008940 3300049572 Bacteria 8235
559 Ga0501036_0096963 3300049572 Bacteria 2493
560 Ga0501037_0007221 3300049573 Bacteria 8117
561 Ga0501037_0161776 3300049573 Bacteria 1595
562 Ga0501037_0170381 3300049573 Bacteria 1548
563 Ga0501037_0301595 3300049573 Bacteria 1112
564 Ga0501038_0066680 3300049574 Bacteria 3064
565 Ga0501038_0499466 3300049574 Bacteria 930
566 Ga0501039_0088641 3300049575 Bacteria 2410
567 Ga0501039_0525404 3300049575 Bacteria 929
568 Ga0501043_0020084 3300049579 Bacteria 5243
569 Ga0501043_0571892 3300049579 Bacteria 837
570 Ga0501046_0072369 3300049580 Bacteria 2676
571 Ga0501046_0159638 3300049580 Bacteria 1696
572 Ga0501046_0238775 3300049580 Bacteria 1341
573 Ga0501046_0453913 3300049580 Bacteria 921
574 Ga0501047_0031924 3300049581 Bacteria 5082
575 Ga0501047_0234257 3300049581 Bacteria 1688
576 Ga0501047_0301005 3300049581 Bacteria 1446
577 Ga0501048_0128815 3300049582 Bacteria 1789
578 Ga0501070_0069159 3300049586 Bacteria 2923
579 Ga0501070_0281037 3300049586 Bacteria 1358
580 Ga0501080_0596461 3300049742 Bacteria 981
581 Ga0501035_0028205 3300049822 Bacteria 5124
582 Ga0501035_0136921 3300049822 Bacteria 2131
583 Ga0501035_0180194 3300049822 Bacteria 1820
584 Ga0501044_0014398 3300049823 Bacteria 8541
585 Ga0501044_0016526 3300049823 Bacteria 7920
586 Ga0501044_0267992 3300049823 Bacteria 1644
587 Ga0501044_0437927 3300049823 Bacteria 1215
588 Ga0501044_0606357 3300049823 Bacteria 987
589 Ga0501045_0218690 3300049824 Bacteria 1419
590 nmdc:mga06r32_1271110_c1 3300050510 Bacteria 680
591 Ga0466962_0011568 3300061719 Bacteria 4250
592 Ga0466962_0083638 3300061719 Bacteria 1527
593 Ga0466962_0125318 3300061719 Bacteria 1240
594 2548500668 2547132374 Bacteria 5530232
595 2643992635 2643221596 Bacteria 5006805
596 2644646780 2643221717 Bacteria 5676132
597 2687581611 2687453130 Bacteria 4227172
598 2739733761 2739367700 Bacteria 4747630
599 2884411711 2884411467 Bacteria 5246714
600 2895396002 2895395659 Bacteria 3983269
601 2928966570 2928963466 Bacteria 5165703
602 2939613248 2939611941 Bacteria 3892017
603 2990714935 2990710928 Bacteria 5002431
604 641334524 641228493 Bacteria 3999591
605 643390964 643348555 Bacteria 3914947
606 Ga0070714_100003166
607 JGI24739J22299_10033551
608 JGI24737J22298_10009446
609 JGI24735J21928_10001277
610 JGI25156J39149_1015071
611 JGI25156J39149_1015911
612 JGI25156J39149_1021733
613 JGI25162J39368_1000147
614 JGI25162J39368_1000542
615 JGI25162J39368_1000635
616 JGI25162J39368_1005348
617 JGI25154J39366_1009293
618 JGI25157J39369_1000093
619 JGI25157J39369_1000201
620 JGI25157J39369_1000880
621 JGI25157J39369_1004601
622 JGI25163J39215_1000280
623 JGI25164J39214_1000118
624 JGI25164J39214_1000257
625 JGI25164J39214_1000396
626 JGI25165J46597_1000236
627 JGI25165J46597_1000466
628 JGI25165J46597_1001236
629 rootH2_10185291
630 rootL2_10051235
631 rootL2_10051236
632 rootL2_10091758
633 rootL2_10129005
634 rootH1_10122745
635 Ga0006562J51391_1049136
636 Ga0006562J51391_1049137
637 Ga0055538_1001053
638 Ga0055539_1002717
639 Ga0055533_1000346
640 Ga0055533_1001085
641 Ga0055527_1000059
642 Ga0055527_1000227
643 Ga0055527_1014783
644 Ga0055535_1000138
645 Ga0055535_1000174
646 Ga0055535_1000710
647 Ga0055542_1000137
648 Ga0055542_1000148
649 Ga0055542_1000186
650 Ga0055542_1000247
651 Ga0055529_1000174
652 Ga0055529_1000226
653 Ga0055529_1000617
654 Ga0055529_1000673
655 Ga0065165_1016309
656 Ga0070676_10100119
657 Ga0070676_10222141
658 Ga0070690_100013405
659 Ga0070670_100020464
660 Ga0070670_100555319
661 Ga0068869_100135379
662 Ga0070666_10011473
663 Ga0070680_100272770
664 Ga0070682_100001784
665 Ga0070682_100036416
666 Ga0070682_100054070
667 Ga0070682_100461798
668 Ga0070682_101051849
669 Ga0068868_100004399
670 Ga0070660_100014921
671 Ga0070660_100333724
672 Ga0070689_100000995
673 Ga0070689_100007883
674 Ga0070691_10013802
675 Ga0070661_100050618
676 Ga0070661_100256250
677 Ga0070671_100017970
678 Ga0070673_100002205
679 Ga0070688_100000831
680 Ga0070659_100001181
681 Ga0070659_100008105
682 Ga0070667_100021989
683 Ga0070667_101183617
684 Ga0070703_10071009
685 Ga0070709_10003682
686 Ga0070709_10014647
687 Ga0070714_100000469
688 Ga0070714_100010012
689 Ga0070713_100001157
690 Ga0070713_100001667
691 Ga0070713_100024483
692 Ga0070710_10005292
693 Ga0070711_100005338
694 Ga0070711_100357918
695 Ga0070705_100029748
696 Ga0070694_100039028
697 Ga0070708_100003086
698 Ga0070663_100019336
699 Ga0070663_100030132
700 Ga0070663_100125392
701 Ga0070663_100428083
702 Ga0070662_100015393
703 Ga0070662_100070623
704 Ga0070662_100204665
705 Ga0070662_100672278
706 Ga0070681_10002687
707 Ga0070681_10045540
708 Ga0070685_10004700
709 Ga0070685_10022046
710 Ga0070706_100144480
711 Ga0070699_100432247
712 Ga0070679_100086355
713 Ga0070684_100594380
714 Ga0070684_100679588
715 Ga0070697_100064671
716 Ga0068853_100004123
717 Ga0068853_100093338
718 Ga0068853_100350118
719 Ga0070695_100043487
720 Ga0070696_100000448
721 Ga0070696_100047292
722 Ga0070696_100071481
723 Ga0070693_100001317
724 Ga0070693_100014937
725 Ga0070693_100050801
726 Ga0070693_100051961
727 Ga0070665_100003974
728 Ga0070665_100146454
729 Ga0070704_100004580
730 Ga0068855_100016239
731 Ga0068855_100131129
732 Ga0068855_100136600
733 Ga0068855_100510759
734 Ga0070664_100709738
735 Ga0068857_100003595
736 Ga0068857_100026961
737 Ga0068857_100593813
738 Ga0068854_100002135
739 Ga0068854_100002377
740 Ga0068854_100011613
741 Ga0068854_100026834
742 Ga0068854_100321635
743 Ga0068854_100631316
744 Ga0068856_100000167
745 Ga0068856_100003008
746 Ga0070702_100059114
747 Ga0068852_100174899
748 Ga0068852_100218431
749 Ga0068852_100734639
750 Ga0068859_100134970
751 Ga0068859_100208334
752 Ga0068864_100003914
753 Ga0068864_100062694
754 Ga0068864_101375857
755 Ga0068866_10003710
756 Ga0068861_101088336
757 Ga0068851_10005821
758 Ga0068851_10085134
759 Ga0068863_100001199
760 Ga0068863_100503281
761 Ga0068858_100003448
762 Ga0068858_100067954
763 Ga0068858_100438815
764 Ga0068860_100124864
765 Ga0068860_100155638
766 Ga0068860_100287495
767 Ga0068860_100403210
768 Ga0068862_100136409
769 Ga0070715_10000823
770 Ga0070716_100020115
771 Ga0070712_100004247
772 Ga0070712_100049751
773 Ga0070712_100243677
774 Ga0068871_100429366
775 Ga0075436_100249103
776 Ga0097620_100134965
777 Ga0097620_100208333
778 Ga0105240_10037432
779 Ga0105240_10436259
780 Ga0105240_10731869
781 Ga0105245_10009647
782 Ga0105245_10039296
783 Ga0105247_10002463
784 Ga0105241_10005274
785 Ga0105241_10011622
786 Ga0105241_10356863
787 Ga0105242_10014526
788 Ga0105242_10093168
789 Ga0105237_10000058
790 Ga0105237_10000147
791 Ga0105237_10010917
792 Ga0105237_10311553
793 Ga0105238_10001541
794 Ga0105238_10005450
795 Ga0105238_10023417
796 Ga0105238_10091210
797 Ga0105238_10452368
798 Ga0105238_10584193
799 Ga0105238_11616619
800 Ga0105249_10327528
801 Ga0105249_10867078
802 Ga0105249_10956700
803 Ga0105239_10121821
804 Ga0105239_10213247
805 Ga0105239_10268300
806 Ga0105239_10394360
807 Ga0105246_10016314
808 Ga0157314_1000006
809 Ga0157339_1000427
810 Ga0157373_10003353
811 Ga0157373_10054502
812 Ga0157373_10096076
813 Ga0157371_10005129
814 Ga0157371_10049904
815 Ga0157371_10151905
816 Ga0157370_10000664
817 Ga0157370_10020190
818 Ga0157370_10835010
819 Ga0157369_10000100
820 Ga0157369_10010075
821 Ga0157369_10115226
822 Ga0157369_10538269
823 Ga0157369_10628970
824 Ga0157369_10882804
825 Ga0157369_10950498
826 Ga0157374_10003230
827 Ga0157378_10050967
828 Ga0157378_10076901
829 Ga0163162_10016492
830 Ga0163162_10047236
831 Ga0163162_10771767
832 Ga0157372_10032910
833 Ga0157372_10033933
834 Ga0157372_11244302
835 Ga0163163_10005663
836 Ga0157380_11168520
837 Ga0182008_10009583
838 Ga0182008_10038064
839 Ga0182008_10248145
840 Ga0157377_10032749
841 Ga0157379_10004754
842 Ga0157376_10020337
843 Ga0157376_10082068
844 Ga0182007_10039379
845 Ga0183369_1011
846 Ga0183368_1007
847 Ga0163161_10061600
848 Ga0206356_10724426
849 Ga0206353_10557298
850 Ga0206353_10927230
851 Ga0213872_10000744
852 Ga0213874_10108813
853 Ga0213876_10139963
854 Ga0209435_103441
855 Ga0209435_103823
856 Ga0209760_100453
857 Ga0209784_100094
858 Ga0209674_100037
859 Ga0209674_100058
860 Ga0209674_100282
861 Ga0209674_100645
862 Ga0209672_100043
863 Ga0209672_100061
864 Ga0209672_101847
865 Ga0209672_102691
866 Ga0209563_100062
867 Ga0207427_100068
868 Ga0207427_100100
869 Ga0207427_100233
870 Ga0207427_101476
871 Ga0209437_100005
872 Ga0209437_100059
873 Ga0209437_100285
874 Ga0209437_100305
875 Ga0209437_100382
876 Ga0209437_106244
877 Ga0209258_100034
878 Ga0209258_100054
879 Ga0209258_100076
880 Ga0209258_101955
881 Ga0209258_102248
882 Ga0209646_1000977
883 Ga0209646_1001264
884 Ga0209026_1000010
885 Ga0209026_1000161
886 Ga0209026_1000277
887 Ga0209026_1000734
888 Ga0209026_1001715
889 Ga0209026_1016536
890 Ga0209677_100921
891 Ga0209148_1000001
892 Ga0209148_1000055
893 Ga0209148_1000066
894 Ga0209148_1000082
895 Ga0209759_1000308
896 Ga0209759_1000467
897 Ga0209759_1003241
898 Ga0209759_1006101
899 Ga0209759_1030871
900 Ga0209129_1004897
901 Ga0209233_1000002
902 Ga0209233_1000011
903 Ga0209233_1000172
904 Ga0209233_1019249
905 Ga0209455_1000054
906 Ga0209455_1000078
907 Ga0209455_1000101
908 Ga0209455_1000306
909 Ga0209455_1010090
910 Ga0209758_1001218
911 Ga0207656_10001074
912 Ga0207692_10014508
913 Ga0207642_10001351
914 Ga0207710_10012059
915 Ga0207680_10125107
916 Ga0207647_10006973
917 Ga0207647_10010457
918 Ga0207647_10039089
919 Ga0207685_10007887
920 Ga0207699_10007753
921 Ga0207699_10013897
922 Ga0207699_10152046
923 Ga0207645_10319662
924 Ga0207645_10766993
925 Ga0207643_10013762
926 Ga0207705_10013749
927 Ga0207654_10027662
928 Ga0207654_10161186
929 Ga0207654_10377629
930 Ga0207707_10009604
931 Ga0207707_10015884
932 Ga0207707_10063484
933 Ga0207695_10000639
934 Ga0207695_10002641
935 Ga0207695_10009476
936 Ga0207695_10042035
937 Ga0207671_10000026
938 Ga0207671_10000444
939 Ga0207671_10000472
940 Ga0207693_10004641
941 Ga0207693_10007768
942 Ga0207693_10520413
943 Ga0207663_10223133
944 Ga0207657_10016378
945 Ga0207657_10023666
946 Ga0207657_10065426
947 Ga0207657_10283205
948 Ga0207649_10053285
949 Ga0207649_10406036
950 Ga0207652_10038230
951 Ga0207652_10064182
952 Ga0207694_10000540
953 Ga0207694_10168653
954 Ga0207694_10228267
955 Ga0207650_10029362
956 Ga0207687_10022186
957 Ga0207687_10032651
958 Ga0207700_10001796
959 Ga0207700_10039533
960 Ga0207700_10124815
961 Ga0207664_10000587
962 Ga0207664_10002728
963 Ga0207664_10042410
964 Ga0207644_10021580
965 Ga0207690_10001816
966 Ga0207690_10002343
967 Ga0207690_10003332
968 Ga0207690_10004703
969 Ga0207690_10029242
970 Ga0207706_10001379
971 Ga0207706_10117414
972 Ga0207706_10129756
973 Ga0207686_10000512
974 Ga0207686_10008180
975 Ga0207670_10000825
976 Ga0207670_10005423
977 Ga0207704_10039183
978 Ga0207665_10012635
979 Ga0207691_10099194
980 Ga0207711_10000318
981 Ga0207711_10378571
982 Ga0207689_10082219
983 Ga0207679_10521107
984 Ga0207667_10000335
985 Ga0207667_10000534
986 Ga0207667_10007069
987 Ga0207667_10198691
988 Ga0207667_10452926
989 Ga0207651_10002366
990 Ga0207712_10205060
991 Ga0207712_10627110
992 Ga0207640_10000434
993 Ga0207640_10001615
994 Ga0207640_10006812
995 Ga0207640_10037901
996 Ga0207640_10061627
997 Ga0207640_10252957
998 Ga0207658_10002930
999 Ga0207658_10051244
1000 Ga0207658_10115693
1001 Ga0207677_10001431
1002 Ga0207677_10071908
1003 Ga0207677_10095363
1004 Ga0207703_10031572
1005 Ga0207703_10037730
1006 Ga0207639_10032195
1007 Ga0207639_10759189
1008 Ga0207678_10019116
1009 Ga0207678_10022875
1010 Ga0207678_10053912
1011 Ga0207702_10000130
1012 Ga0207702_10000230
1013 Ga0207702_10009239
1014 Ga0207702_10040101
1015 Ga0207641_10005410
1016 Ga0207641_10489451
1017 Ga0207676_10001126
1018 Ga0207676_10051152
1019 Ga0207674_10001848
1020 Ga0207674_10002370
1021 Ga0207674_10027939
1022 Ga0207674_10254032
1023 Ga0207674_10580153
1024 Ga0207683_10000340
1025 Ga0207698_10291404
1026 Ga0207698_10779774
1027 Ga0209974_10004332
1028 Ga0268266_10199196
1029 Ga0268266_10626215
1030 Ga0268265_10025014
1031 Ga0268264_10014821
1032 Ga0268264_10044097
1033 Ga0268264_10074700
1034 Ga0268264_10082393
1035 Ga0268264_10162798
1036 Ga0265331_10190559
1037 Ga0307508_10018765
1038 Ga0373934_0017516
1039 Ga0373923_0001138
1040 Ga0373936_0141617
1041 Ga0373945_0070590
1042 Ga0373953_0003856
1043 Ga0373954_0005075
1044 Ga0373943_0109753
1045 Ga0373946_0130113
1046 Ga0373955_0076885
1047 Ga0373935_0220757
1048 Ga0373927_0364746
1049 Ga0373933_0068227
1050 Ga0373933_0198837
1051 Ga0373947_0189946
1052 Ga0373937_0001566
1053 Ga0373937_0014382
1054 Ga0373925_0290448
1055 Ga0395899_0000215
1056 Ga0395899_0267845
1057 Ga0395899_0727183
1058 Ga0395900_0000117
1059 Ga0395898_0000120
1060 Ga0395898_0031786
1061 Ga0395898_0507156
1062 Ga0395901_0006274
1063 Ga0395901_0637552
1064 Ga0436365_1746594
1065 Ga0436361_0953601
1066 Ga0436363_0550317
1067 Ga0436363_1016651
1068 Ga0439437_002011
1069 Ga0439448_0158129
1070 Ga0439432_028290
1071 Ga0466988_0062120
1072 Ga0466969_0005899
1073 Ga0466969_0010128
1074 Ga0466969_0015710
1075 Ga0466975_0029900
1076 Ga0466982_0000015
1077 Ga0453683_0867604
1078 Ga0466966_0006222
1079 Ga0466966_0028014
1080 Ga0466966_0040737
1081 Ga0466961_0000721
1082 Ga0466961_0019093
1083 Ga0466961_0051808
1084 Ga0466961_0509112
1085 Ga0466963_0552738
1086 Ga0466971_0012879
1087 Ga0466971_0045789
1088 Ga0466968_0011621
1089 Ga0466970_0000981
1090 Ga0466970_0033845
1091 Ga0466970_0113579
1092 Ga0466970_0134883
1093 Ga0466959_0000522
1094 Ga0466959_0024499
1095 Ga0466959_0188116
1096 Ga0466959_0198501
1097 Ga0466958_0031309
1098 Ga0495629_0408406
1099 Ga0495638_0000324
1100 Ga0495650_0000092
1101 Ga0495650_0003845
1102 Ga0495580_0220794
1103 Ga0495580_0597595
1104 Ga0495582_0110443
1105 Ga0495639_0002962
1106 Ga0495664_0021629
1107 Ga0495606_0000923
1108 Ga0495642_0024394
1109 Ga0495642_0032978
1110 Ga0495652_0765941
1111 Ga0495665_0025276
1112 Ga0495586_0094517
1113 Ga0495622_0002536
1114 Ga0495667_0137979
1115 Ga0495625_0029177
1116 Ga0495625_0280589
1117 Ga0495659_0010265
1118 Ga0495588_0126514
1119 Ga0495657_0452015
1120 Ga0495647_0004971
1121 Ga0495658_0053101
1122 Ga0495669_0168152
1123 Ga0495613_0241298
1124 Ga0495670_0448239
1125 Ga0495649_0020820
1126 Ga0495581_0133388
1127 Ga0495604_0401745
1128 Ga0495636_0070636
1129 Ga0495674_0149426
1130 Ga0495672_0000078
1131 Ga0495675_0242733
1132 Ga0495685_017300
1133 Ga0495685_102633
1134 Ga0495684_0279755
1135 Ga0496100_0272924
1136 Ga0496101_0419158
1137 Ga0496102_0000349
1138 Ga0496104_0004160
1139 Ga0496105_0078324
1140 Ga0496109_0025978
1141 Ga0496109_0764356
1142 Ga0496112_0001169
1143 Ga0496112_0118265
1144 Ga0496115_0000105
1145 Ga0496115_0000261
1146 Ga0496115_0014620
1147 Ga0496115_0075876
1148 Ga0496115_0130963
1149 Ga0496118_0491680
1150 Ga0496121_0045462
1151 Ga0496121_0048799
1152 Ga0496122_0433066
1153 Ga0496125_0003619
1154 Ga0496126_0044859
1155 Ga0496126_0088435
1156 Ga0496126_0219786
1157 Ga0501032_0613892
1158 Ga0501033_0000758
1159 Ga0501033_0051135
1160 Ga0501033_0054031
1161 Ga0501033_0126177
1162 Ga0501034_0046063
1163 Ga0501036_0008940
1164 Ga0501036_0096963
1165 Ga0501037_0007221
1166 Ga0501037_0161776
1167 Ga0501037_0170381
1168 Ga0501037_0301595
1169 Ga0501038_0066680
1170 Ga0501038_0499466
1171 Ga0501039_0088641
1172 Ga0501039_0525404
1173 Ga0501043_0020084
1174 Ga0501043_0571892
1175 Ga0501046_0072369
1176 Ga0501046_0159638
1177 Ga0501046_0238775
1178 Ga0501046_0453913
1179 Ga0501047_0031924
1180 Ga0501047_0234257
1181 Ga0501047_0301005
1182 Ga0501048_0128815
1183 Ga0501070_0069159
1184 Ga0501070_0281037
1185 Ga0501080_0596461
1186 Ga0501035_0028205
1187 Ga0501035_0136921
1188 Ga0501035_0180194
1189 Ga0501044_0014398
1190 Ga0501044_0016526
1191 Ga0501044_0267992
1192 Ga0501044_0437927
1193 Ga0501044_0606357
1194 Ga0501045_0218690
1195 nmdc:mga06r32_1271110_c1
1196 Ga0466962_0011568
1197 Ga0466962_0083638
1198 Ga0466962_0125318
1199 2548500668
1200 2643992635
1201 2644646780
1202 2687581611
1203 2739733761
1204 2884411711
1205 2895396002
1206 2928966570
1207 2939613248
1208 2990714935
1209 641334524
1210 643390964

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07298

NnrU

NnrU protein

13

195

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7v2c-assembly1.cif.gz_m active state complex i from q10 dataset 0.5889 69 180
7zdh-assembly1.cif.gz_J complex i from ovis aries at ph7.4, closed state 0.5854 72 180
8c2s-assembly1.cif.gz_J cryo-em structure ndufs4 knockout complex i from mus musculus heart (class 1). 0.5441 72 184
6qc5-assembly1.cif.gz_D6 ovine respiratory complex i frc closed class 1 0.4813 74 177
7zme-assembly1.cif.gz_6 cryoem structure of mitochondrial complex i from chaetomium thermophilum (state 2) - membrane arm 0.4736 65 185
ID Description Score Start End Superfamily
af_O05883_47_239_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.6449 3 150 1.20.120.1630
af_B4FHU1_131_318_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.6256 2 164 1.20.120.1630
af_Q9UBM1_11_191_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.5958 3 148 1.20.120.1630
af_Q2FVZ3_1_83_1.10.287.90 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.5816 71 151 1.10.287.90
af_Q2FVZ3_1_83_1.10.287.90 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.5621 71 151 1.10.287.90
ID Description Score Start End GO Terms
AF-A0A4Q3N5V1-F1-model_v4 Protein NrnU 0.9887 1 190 GO:0016020
AF-A0A7Y0GFU3-F1-model_v4 NnrU family protein 0.9884 1 189 GO:0016020
AF-A0A3B8PDE7-F1-model_v4 deleted 0.9883 88 190
AF-A2RW18-F1-model_v4 Putative membrane protein 0.9875 2 190 GO:0016020
AF-R7XPW0-F1-model_v4 NnrU domain-containing protein 0.9866 39 190 GO:0016020

Map