F468464
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 605 | 270 | 605 | 111 |
Family's Representative Sequence
| Representative Sequence | 3300009101|Ga0105247_11403825|Ga0105247_114038252 |
| Length | 125 |
| Sequence | MFKPPTTTTLSRHFVTVRAQTDALRGSLDLLVLKTLSLVPMHGWGIGQRIQQTSKGILEVNQGSLYPALQRLEKDGLIVSDWGATDNNRRARYYRLTPSGRRALGQELESWKRFSSGLDAVLRST |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 41 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 52 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 54 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 55 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 56 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 58 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 59 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 60 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 61 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 62 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 63 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 64 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 65 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 66 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 67 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 68 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 69 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 70 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 72 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 73 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 74 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 75 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 76 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 77 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 78 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 79 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 81 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 108 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 162 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 165 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 166 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 167 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 168 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 169 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 170 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 171 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 172 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 173 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 174 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 175 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 176 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 177 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 178 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 179 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 180 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 181 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 182 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 183 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 184 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 185 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 186 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 187 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 188 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 189 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 190 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 191 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 192 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 193 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 194 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 195 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 196 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 197 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 198 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 199 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 200 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 201 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 202 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 203 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 204 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 231 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 232 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 233 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 234 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 235 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 236 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 237 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 238 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 239 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 243 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 246 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 248 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 250 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 251 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 256 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 257 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 259 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 260 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 261 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 267 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 269 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.5 |
| Nodule | 0 |
| Rhizoplane | 1.65 |
| Rhizosphere | 96.69 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.16 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065714_10334836 | 3300005288 | Bacteria | 652 |
| 2 | Ga0065712_10150657 | 3300005290 | Unclassified | 1372 |
| 3 | Ga0070658_10507288 | 3300005327 | Unclassified | 1042 |
| 4 | Ga0070676_10986139 | 3300005328 | Unclassified | 632 |
| 5 | Ga0070683_100000397 | 3300005329 | Bacteria | 30109 |
| 6 | Ga0070683_100118677 | 3300005329 | Bacteria | 2498 |
| 7 | Ga0070683_100128940 | 3300005329 | Bacteria | 2393 |
| 8 | Ga0070683_100186309 | 3300005329 | Bacteria | 1970 |
| 9 | Ga0070683_100491843 | 3300005329 | Unclassified | 1172 |
| 10 | Ga0070683_100550580 | 3300005329 | Bacteria | 1103 |
| 11 | Ga0070683_100784860 | 3300005329 | Bacteria | 913 |
| 12 | Ga0070690_100011574 | 3300005330 | Bacteria | 5164 |
| 13 | Ga0070690_100022311 | 3300005330 | Bacteria | 3872 |
| 14 | Ga0070690_100030192 | 3300005330 | Bacteria | 3366 |
| 15 | Ga0070670_100008704 | 3300005331 | Bacteria | 8662 |
| 16 | Ga0070670_100054671 | 3300005331 | Unclassified | 3427 |
| 17 | Ga0070670_100443381 | 3300005331 | Bacteria | 1150 |
| 18 | Ga0070670_101210081 | 3300005331 | Bacteria | 690 |
| 19 | Ga0070670_101229458 | 3300005331 | Bacteria | 685 |
| 20 | Ga0070677_10742518 | 3300005333 | Unclassified | 556 |
| 21 | Ga0068869_100012820 | 3300005334 | Bacteria | 5548 |
| 22 | Ga0068869_100084552 | 3300005334 | Bacteria | 2375 |
| 23 | Ga0068869_101885675 | 3300005334 | Unclassified | 535 |
| 24 | Ga0070666_10332604 | 3300005335 | Bacteria | 1085 |
| 25 | Ga0070666_10563851 | 3300005335 | Bacteria | 829 |
| 26 | Ga0070666_10642669 | 3300005335 | Unclassified | 776 |
| 27 | Ga0070666_10695871 | 3300005335 | Unclassified | 745 |
| 28 | Ga0070680_100145278 | 3300005336 | Bacteria | 1990 |
| 29 | Ga0070680_100182186 | 3300005336 | Unclassified | 1769 |
| 30 | Ga0070680_100365025 | 3300005336 | Bacteria | 1228 |
| 31 | Ga0070682_100002879 | 3300005337 | Bacteria | 9543 |
| 32 | Ga0070682_100133844 | 3300005337 | Unclassified | 1681 |
| 33 | Ga0070682_100192666 | 3300005337 | Bacteria | 1432 |
| 34 | Ga0068868_100376293 | 3300005338 | Bacteria | 1221 |
| 35 | Ga0068868_101251479 | 3300005338 | Bacteria | 688 |
| 36 | Ga0070660_100071410 | 3300005339 | Unclassified | 2711 |
| 37 | Ga0070660_100105209 | 3300005339 | Bacteria | 2239 |
| 38 | Ga0070689_100014037 | 3300005340 | Bacteria | 5812 |
| 39 | Ga0070689_100043089 | 3300005340 | Unclassified | 3467 |
| 40 | Ga0070689_100301854 | 3300005340 | Bacteria | 1333 |
| 41 | Ga0070691_10939351 | 3300005341 | Bacteria | 536 |
| 42 | Ga0070687_100031001 | 3300005343 | Bacteria | 2619 |
| 43 | Ga0070687_100258414 | 3300005343 | Unclassified | 1085 |
| 44 | Ga0070661_100003510 | 3300005344 | Bacteria | 10799 |
| 45 | Ga0070661_100032444 | 3300005344 | Bacteria | 3781 |
| 46 | Ga0070661_101136032 | 3300005344 | Bacteria | 652 |
| 47 | Ga0070692_10146398 | 3300005345 | Bacteria | 1342 |
| 48 | Ga0070692_10281849 | 3300005345 | Unclassified | 1007 |
| 49 | Ga0070668_100196206 | 3300005347 | Bacteria | 1655 |
| 50 | Ga0070668_101073635 | 3300005347 | Bacteria | 726 |
| 51 | Ga0070669_100345512 | 3300005353 | Bacteria | 1207 |
| 52 | Ga0070669_100890319 | 3300005353 | Bacteria | 760 |
| 53 | Ga0070669_101982180 | 3300005353 | Unclassified | 509 |
| 54 | Ga0070675_100019195 | 3300005354 | Bacteria | 5446 |
| 55 | Ga0070675_100156897 | 3300005354 | Bacteria | 1954 |
| 56 | Ga0070675_100174951 | 3300005354 | Bacteria | 1853 |
| 57 | Ga0070675_100282922 | 3300005354 | Bacteria | 1458 |
| 58 | Ga0070675_100370794 | 3300005354 | Bacteria | 1273 |
| 59 | Ga0070675_100457091 | 3300005354 | Bacteria | 1146 |
| 60 | Ga0070675_100569405 | 3300005354 | Bacteria | 1025 |
| 61 | Ga0070675_102094061 | 3300005354 | Bacteria | 521 |
| 62 | Ga0070671_100403031 | 3300005355 | Bacteria | 1170 |
| 63 | Ga0070671_101436784 | 3300005355 | Bacteria | 610 |
| 64 | Ga0070674_101668657 | 3300005356 | Bacteria | 576 |
| 65 | Ga0070673_100045583 | 3300005364 | Bacteria | 3401 |
| 66 | Ga0070673_100128225 | 3300005364 | Unclassified | 2125 |
| 67 | Ga0070673_100361329 | 3300005364 | Bacteria | 1291 |
| 68 | Ga0070673_100599368 | 3300005364 | Bacteria | 1005 |
| 69 | Ga0070688_100156501 | 3300005365 | Bacteria | 1562 |
| 70 | Ga0070688_100208587 | 3300005365 | Bacteria | 1371 |
| 71 | Ga0070688_101334432 | 3300005365 | Bacteria | 580 |
| 72 | Ga0070659_100021345 | 3300005366 | Bacteria | 4931 |
| 73 | Ga0070659_100032698 | 3300005366 | Bacteria | 4036 |
| 74 | Ga0070659_100054972 | 3300005366 | Bacteria | 3136 |
| 75 | Ga0070667_100052574 | 3300005367 | Bacteria | 3438 |
| 76 | Ga0070667_100393735 | 3300005367 | Bacteria | 1260 |
| 77 | Ga0070667_100517931 | 3300005367 | Unclassified | 1094 |
| 78 | Ga0070667_101400693 | 3300005367 | Bacteria | 656 |
| 79 | Ga0070703_10289507 | 3300005406 | Bacteria | 679 |
| 80 | Ga0070714_102510790 | 3300005435 | Bacteria | 500 |
| 81 | Ga0070710_10827708 | 3300005437 | Unclassified | 663 |
| 82 | Ga0070701_10147152 | 3300005438 | Bacteria | 1353 |
| 83 | Ga0070711_100742921 | 3300005439 | Bacteria | 829 |
| 84 | Ga0070700_100805666 | 3300005441 | Bacteria | 757 |
| 85 | Ga0070694_100672240 | 3300005444 | Bacteria | 840 |
| 86 | Ga0070663_102142797 | 3300005455 | Unclassified | 504 |
| 87 | Ga0070678_100357791 | 3300005456 | Bacteria | 1257 |
| 88 | Ga0070678_101207024 | 3300005456 | Bacteria | 701 |
| 89 | Ga0070662_100039730 | 3300005457 | Bacteria | 3347 |
| 90 | Ga0070662_100146976 | 3300005457 | Bacteria | 1832 |
| 91 | Ga0070681_10005421 | 3300005458 | Bacteria | 12324 |
| 92 | Ga0070681_10014161 | 3300005458 | Bacteria | 7938 |
| 93 | Ga0070681_10023567 | 3300005458 | Bacteria | 6191 |
| 94 | Ga0070681_10035575 | 3300005458 | Bacteria | 5003 |
| 95 | Ga0070681_10053917 | 3300005458 | Bacteria | 4006 |
| 96 | Ga0070681_10062326 | 3300005458 | Bacteria | 3702 |
| 97 | Ga0070681_10124064 | 3300005458 | Bacteria | 2515 |
| 98 | Ga0070681_10718209 | 3300005458 | Bacteria | 915 |
| 99 | Ga0068867_100872029 | 3300005459 | Bacteria | 808 |
| 100 | Ga0068867_100920778 | 3300005459 | Bacteria | 788 |
| 101 | Ga0068867_101365879 | 3300005459 | Unclassified | 656 |
| 102 | Ga0070685_10094419 | 3300005466 | Bacteria | 1816 |
| 103 | Ga0070685_10113558 | 3300005466 | Bacteria | 1672 |
| 104 | Ga0070685_10732072 | 3300005466 | Bacteria | 724 |
| 105 | Ga0070707_100600347 | 3300005468 | Bacteria | 1063 |
| 106 | Ga0070698_100238685 | 3300005471 | Bacteria | 1751 |
| 107 | Ga0070679_100027827 | 3300005530 | Bacteria | 5569 |
| 108 | Ga0070679_100135487 | 3300005530 | Bacteria | 2444 |
| 109 | Ga0070679_100196255 | 3300005530 | Bacteria | 1986 |
| 110 | Ga0070679_100302910 | 3300005530 | Bacteria | 1549 |
| 111 | Ga0070679_100608202 | 3300005530 | Bacteria | 1036 |
| 112 | Ga0070679_100762621 | 3300005530 | Bacteria | 910 |
| 113 | Ga0070679_100956427 | 3300005530 | Bacteria | 800 |
| 114 | Ga0070684_100002124 | 3300005535 | Bacteria | 14621 |
| 115 | Ga0070684_100009702 | 3300005535 | Bacteria | 7596 |
| 116 | Ga0070684_100021443 | 3300005535 | Bacteria | 5377 |
| 117 | Ga0070684_100069824 | 3300005535 | Bacteria | 3090 |
| 118 | Ga0070684_100073445 | 3300005535 | Unclassified | 3014 |
| 119 | Ga0070684_100163363 | 3300005535 | Bacteria | 2021 |
| 120 | Ga0070672_100080941 | 3300005543 | Bacteria | 2603 |
| 121 | Ga0070672_100123371 | 3300005543 | Bacteria | 2123 |
| 122 | Ga0070672_100412728 | 3300005543 | Bacteria | 1159 |
| 123 | Ga0070672_100757868 | 3300005543 | Bacteria | 852 |
| 124 | Ga0070672_100819076 | 3300005543 | Bacteria | 820 |
| 125 | Ga0070686_100373998 | 3300005544 | Bacteria | 1077 |
| 126 | Ga0070686_100860422 | 3300005544 | Bacteria | 735 |
| 127 | Ga0070696_100000091 | 3300005546 | Bacteria | 44490 |
| 128 | Ga0070693_100005288 | 3300005547 | Bacteria | 6185 |
| 129 | Ga0070693_100054905 | 3300005547 | Bacteria | 2293 |
| 130 | Ga0070693_100094296 | 3300005547 | Bacteria | 1811 |
| 131 | Ga0070693_100189337 | 3300005547 | Bacteria | 1330 |
| 132 | Ga0070665_100480897 | 3300005548 | Bacteria | 1253 |
| 133 | Ga0070665_101783690 | 3300005548 | Unclassified | 622 |
| 134 | Ga0068855_102541746 | 3300005563 | Bacteria | 509 |
| 135 | Ga0070664_100040858 | 3300005564 | Bacteria | 3912 |
| 136 | Ga0070664_100044326 | 3300005564 | Bacteria | 3756 |
| 137 | Ga0070664_100084312 | 3300005564 | Bacteria | 2743 |
| 138 | Ga0070664_100113459 | 3300005564 | Bacteria | 2367 |
| 139 | Ga0070664_100117072 | 3300005564 | Bacteria | 2331 |
| 140 | Ga0068857_100012441 | 3300005577 | Bacteria | 7408 |
| 141 | Ga0068857_100050063 | 3300005577 | Unclassified | 3706 |
| 142 | Ga0068857_100081828 | 3300005577 | Bacteria | 2883 |
| 143 | Ga0068857_100284974 | 3300005577 | Bacteria | 1520 |
| 144 | Ga0068857_100694042 | 3300005577 | Bacteria | 967 |
| 145 | Ga0068857_102528520 | 3300005577 | Unclassified | 504 |
| 146 | Ga0068854_102045710 | 3300005578 | Bacteria | 528 |
| 147 | Ga0068856_100098099 | 3300005614 | Bacteria | 2920 |
| 148 | Ga0068856_100889628 | 3300005614 | Unclassified | 909 |
| 149 | Ga0070702_101056571 | 3300005615 | Bacteria | 646 |
| 150 | Ga0068852_100057164 | 3300005616 | Bacteria | 3375 |
| 151 | Ga0068852_100896706 | 3300005616 | Bacteria | 904 |
| 152 | Ga0068852_102099570 | 3300005616 | Bacteria | 587 |
| 153 | Ga0068859_100012899 | 3300005617 | Bacteria | 8395 |
| 154 | Ga0068859_100068612 | 3300005617 | Bacteria | 3580 |
| 155 | Ga0068859_100544055 | 3300005617 | Bacteria | 1256 |
| 156 | Ga0068859_101103483 | 3300005617 | Bacteria | 873 |
| 157 | Ga0068859_101209848 | 3300005617 | Bacteria | 832 |
| 158 | Ga0068864_100145945 | 3300005618 | Unclassified | 2139 |
| 159 | Ga0068864_100274761 | 3300005618 | Bacteria | 1571 |
| 160 | Ga0068864_100642562 | 3300005618 | Unclassified | 1033 |
| 161 | Ga0068864_101923877 | 3300005618 | Bacteria | 597 |
| 162 | Ga0068864_102499530 | 3300005618 | Bacteria | 523 |
| 163 | Ga0068866_10169061 | 3300005718 | Unclassified | 1282 |
| 164 | Ga0068861_100209594 | 3300005719 | Bacteria | 1641 |
| 165 | Ga0068861_101418634 | 3300005719 | Bacteria | 679 |
| 166 | Ga0068861_102018286 | 3300005719 | Bacteria | 576 |
| 167 | Ga0068851_10027563 | 3300005834 | Unclassified | 2800 |
| 168 | Ga0068851_10389920 | 3300005834 | Bacteria | 818 |
| 169 | Ga0068870_10023943 | 3300005840 | Bacteria | 3017 |
| 170 | Ga0068870_10067451 | 3300005840 | Bacteria | 1941 |
| 171 | Ga0068870_10095415 | 3300005840 | Bacteria | 1671 |
| 172 | Ga0068870_10326050 | 3300005840 | Bacteria | 977 |
| 173 | Ga0068870_10390273 | 3300005840 | Bacteria | 903 |
| 174 | Ga0068870_10490680 | 3300005840 | Bacteria | 817 |
| 175 | Ga0068863_100085116 | 3300005841 | Bacteria | 2996 |
| 176 | Ga0068863_100580198 | 3300005841 | Bacteria | 1109 |
| 177 | Ga0068863_100839653 | 3300005841 | Bacteria | 917 |
| 178 | Ga0068858_100013502 | 3300005842 | Bacteria | 7707 |
| 179 | Ga0068858_100142831 | 3300005842 | Bacteria | 2248 |
| 180 | Ga0068858_101691433 | 3300005842 | Bacteria | 625 |
| 181 | Ga0068860_100161200 | 3300005843 | Bacteria | 2162 |
| 182 | Ga0068860_101028858 | 3300005843 | Unclassified | 842 |
| 183 | Ga0068860_102052268 | 3300005843 | Unclassified | 593 |
| 184 | Ga0068862_100022773 | 3300005844 | Bacteria | 5242 |
| 185 | Ga0068862_100055358 | 3300005844 | Bacteria | 3398 |
| 186 | Ga0081455_10155791 | 3300005937 | Bacteria | 1756 |
| 187 | Ga0075367_10017173 | 3300006178 | Bacteria | 3967 |
| 188 | Ga0097621_100070749 | 3300006237 | Bacteria | 2881 |
| 189 | Ga0097621_100715762 | 3300006237 | Bacteria | 923 |
| 190 | Ga0097621_100903686 | 3300006237 | Bacteria | 823 |
| 191 | Ga0068871_100027068 | 3300006358 | Bacteria | 4481 |
| 192 | Ga0068871_100981580 | 3300006358 | Bacteria | 786 |
| 193 | Ga0075428_100022057 | 3300006844 | Bacteria | 7049 |
| 194 | Ga0075428_100052361 | 3300006844 | Bacteria | 4475 |
| 195 | Ga0075428_100200113 | 3300006844 | Bacteria | 2160 |
| 196 | Ga0075428_102468747 | 3300006844 | Bacteria | 533 |
| 197 | Ga0075430_100376347 | 3300006846 | Unclassified | 1172 |
| 198 | Ga0075431_100038235 | 3300006847 | Bacteria | 4941 |
| 199 | Ga0075431_100105725 | 3300006847 | Bacteria | 2904 |
| 200 | Ga0075433_10747488 | 3300006852 | Bacteria | 855 |
| 201 | Ga0075434_100013484 | 3300006871 | Bacteria | 7781 |
| 202 | Ga0075434_100335165 | 3300006871 | Unclassified | 1533 |
| 203 | Ga0075434_100499355 | 3300006871 | Bacteria | 1237 |
| 204 | Ga0075434_100618975 | 3300006871 | Unclassified | 1101 |
| 205 | Ga0075429_100004287 | 3300006880 | Bacteria | 12246 |
| 206 | Ga0075429_100022694 | 3300006880 | Bacteria | 5441 |
| 207 | Ga0075429_101597988 | 3300006880 | Bacteria | 567 |
| 208 | Ga0068865_100190954 | 3300006881 | Bacteria | 1584 |
| 209 | Ga0068865_100434577 | 3300006881 | Bacteria | 1082 |
| 210 | Ga0068865_100592729 | 3300006881 | Bacteria | 936 |
| 211 | Ga0068865_100598421 | 3300006881 | Bacteria | 932 |
| 212 | Ga0068865_100931579 | 3300006881 | Bacteria | 757 |
| 213 | Ga0097620_100012901 | 3300006931 | Bacteria | 8395 |
| 214 | Ga0097620_100068610 | 3300006931 | Bacteria | 3580 |
| 215 | Ga0097620_100544096 | 3300006931 | Bacteria | 1256 |
| 216 | Ga0097620_101103529 | 3300006931 | Bacteria | 873 |
| 217 | Ga0097620_101127150 | 3300006931 | Bacteria | 863 |
| 218 | Ga0097620_101209893 | 3300006931 | Bacteria | 832 |
| 219 | Ga0075435_100812627 | 3300007076 | Bacteria | 814 |
| 220 | Ga0111539_10115559 | 3300009094 | Bacteria | 3147 |
| 221 | Ga0111539_10392128 | 3300009094 | Bacteria | 1617 |
| 222 | Ga0111539_10795929 | 3300009094 | Bacteria | 1100 |
| 223 | Ga0111539_11345017 | 3300009094 | Bacteria | 829 |
| 224 | Ga0105245_10006625 | 3300009098 | Bacteria | 10170 |
| 225 | Ga0105245_10175458 | 3300009098 | Bacteria | 2044 |
| 226 | Ga0105245_10211751 | 3300009098 | Unclassified | 1866 |
| 227 | Ga0105245_10294318 | 3300009098 | Bacteria | 1591 |
| 228 | Ga0105245_10964767 | 3300009098 | Bacteria | 896 |
| 229 | Ga0105245_11904924 | 3300009098 | Bacteria | 648 |
| 230 | Ga0105247_10446550 | 3300009101 | Unclassified | 931 |
| 231 | Ga0105247_10715659 | 3300009101 | Bacteria | 755 |
| 232 | Ga0105247_11403825 | 3300009101 | Bacteria | 565 |
| 233 | Ga0114129_10085612 | 3300009147 | Bacteria | 4373 |
| 234 | Ga0114129_10310051 | 3300009147 | Bacteria | 2101 |
| 235 | Ga0114129_11877327 | 3300009147 | Bacteria | 727 |
| 236 | Ga0114129_12294165 | 3300009147 | Unclassified | 648 |
| 237 | Ga0105243_10082332 | 3300009148 | Bacteria | 2630 |
| 238 | Ga0105243_10584989 | 3300009148 | Bacteria | 1072 |
| 239 | Ga0105243_11069245 | 3300009148 | Bacteria | 813 |
| 240 | Ga0105243_12484387 | 3300009148 | Bacteria | 557 |
| 241 | Ga0105241_10003972 | 3300009174 | Bacteria | 10936 |
| 242 | Ga0105241_10609190 | 3300009174 | Bacteria | 987 |
| 243 | Ga0105242_10085925 | 3300009176 | Bacteria | 2639 |
| 244 | Ga0105242_10243769 | 3300009176 | Unclassified | 1617 |
| 245 | Ga0105242_10716290 | 3300009176 | Unclassified | 981 |
| 246 | Ga0105242_11369293 | 3300009176 | Bacteria | 734 |
| 247 | Ga0105242_11463834 | 3300009176 | Bacteria | 712 |
| 248 | Ga0105248_10197420 | 3300009177 | Bacteria | 2267 |
| 249 | Ga0105248_10844042 | 3300009177 | Bacteria | 1034 |
| 250 | Ga0105248_10900805 | 3300009177 | Bacteria | 999 |
| 251 | Ga0105248_11036632 | 3300009177 | Bacteria | 927 |
| 252 | Ga0105248_11552022 | 3300009177 | Bacteria | 750 |
| 253 | Ga0105248_12054343 | 3300009177 | Unclassified | 649 |
| 254 | Ga0105237_10213937 | 3300009545 | Bacteria | 1927 |
| 255 | Ga0105237_10504184 | 3300009545 | Bacteria | 1217 |
| 256 | Ga0105238_10155484 | 3300009551 | Bacteria | 2262 |
| 257 | Ga0105238_10304346 | 3300009551 | Unclassified | 1578 |
| 258 | Ga0105238_10477572 | 3300009551 | Bacteria | 1246 |
| 259 | Ga0105249_10031359 | 3300009553 | Bacteria | 4807 |
| 260 | Ga0105249_10131720 | 3300009553 | Unclassified | 2388 |
| 261 | Ga0105249_10714102 | 3300009553 | Unclassified | 1063 |
| 262 | Ga0105239_11704893 | 3300010375 | Bacteria | 729 |
| 263 | Ga0105246_10047589 | 3300011119 | Bacteria | 2929 |
| 264 | Ga0105246_10293128 | 3300011119 | Bacteria | 1310 |
| 265 | Ga0157371_10007749 | 3300013102 | Bacteria | 8634 |
| 266 | Ga0157371_10047491 | 3300013102 | Bacteria | 3053 |
| 267 | Ga0157369_10358966 | 3300013105 | Unclassified | 1513 |
| 268 | Ga0157369_10760826 | 3300013105 | Unclassified | 996 |
| 269 | Ga0157369_12471710 | 3300013105 | Bacteria | 526 |
| 270 | Ga0157374_10721347 | 3300013296 | Unclassified | 1011 |
| 271 | Ga0157374_10990862 | 3300013296 | Bacteria | 859 |
| 272 | Ga0157378_10391768 | 3300013297 | Bacteria | 1367 |
| 273 | Ga0163162_10286087 | 3300013306 | Bacteria | 1780 |
| 274 | Ga0163162_10767207 | 3300013306 | Bacteria | 1083 |
| 275 | Ga0157372_10096471 | 3300013307 | Bacteria | 3370 |
| 276 | Ga0157372_10439388 | 3300013307 | Bacteria | 1521 |
| 277 | Ga0157372_10491108 | 3300013307 | Bacteria | 1432 |
| 278 | Ga0157372_10847238 | 3300013307 | Bacteria | 1061 |
| 279 | Ga0157372_10919230 | 3300013307 | Unclassified | 1015 |
| 280 | Ga0157372_12599545 | 3300013307 | Bacteria | 581 |
| 281 | Ga0157375_10010663 | 3300013308 | Bacteria | 8094 |
| 282 | Ga0157375_10064241 | 3300013308 | Bacteria | 3654 |
| 283 | Ga0157375_10245359 | 3300013308 | Bacteria | 1951 |
| 284 | Ga0157375_10266493 | 3300013308 | Unclassified | 1875 |
| 285 | Ga0157375_10876025 | 3300013308 | Bacteria | 1043 |
| 286 | Ga0157375_11214131 | 3300013308 | Unclassified | 885 |
| 287 | Ga0157375_12504930 | 3300013308 | Bacteria | 616 |
| 288 | Ga0163163_10005137 | 3300014325 | Bacteria | 11282 |
| 289 | Ga0163163_10376362 | 3300014325 | Bacteria | 1477 |
| 290 | Ga0163163_10685658 | 3300014325 | Bacteria | 1088 |
| 291 | Ga0163163_11391365 | 3300014325 | Bacteria | 763 |
| 292 | Ga0163163_12939761 | 3300014325 | Unclassified | 532 |
| 293 | Ga0157380_10024401 | 3300014326 | Bacteria | 4577 |
| 294 | Ga0157380_10081761 | 3300014326 | Bacteria | 2643 |
| 295 | Ga0157377_10000839 | 3300014745 | Bacteria | 12728 |
| 296 | Ga0157377_10402085 | 3300014745 | Unclassified | 933 |
| 297 | Ga0157377_10749997 | 3300014745 | Bacteria | 714 |
| 298 | Ga0157379_12042109 | 3300014968 | Bacteria | 567 |
| 299 | Ga0157376_10011794 | 3300014969 | Bacteria | 6458 |
| 300 | Ga0157376_10828504 | 3300014969 | Bacteria | 939 |
| 301 | Ga0157376_10859051 | 3300014969 | Bacteria | 923 |
| 302 | Ga0163161_10083452 | 3300017792 | Bacteria | 2355 |
| 303 | Ga0163161_10290839 | 3300017792 | Bacteria | 1284 |
| 304 | Ga0213875_10461425 | 3300021388 | Bacteria | 608 |
| 305 | Ga0207656_10075212 | 3300025321 | Bacteria | 1508 |
| 306 | Ga0207656_10247428 | 3300025321 | Bacteria | 873 |
| 307 | Ga0207682_10344654 | 3300025893 | Unclassified | 701 |
| 308 | Ga0207642_10732565 | 3300025899 | Bacteria | 625 |
| 309 | Ga0207710_10146760 | 3300025900 | Bacteria | 1142 |
| 310 | Ga0207688_10387038 | 3300025901 | Bacteria | 866 |
| 311 | Ga0207680_10427392 | 3300025903 | Bacteria | 938 |
| 312 | Ga0207680_10497401 | 3300025903 | Unclassified | 868 |
| 313 | Ga0207699_10136911 | 3300025906 | Bacteria | 1605 |
| 314 | Ga0207645_10145098 | 3300025907 | Bacteria | 1547 |
| 315 | Ga0207645_10321884 | 3300025907 | Bacteria | 1031 |
| 316 | Ga0207645_10462387 | 3300025907 | Bacteria | 857 |
| 317 | Ga0207643_10086015 | 3300025908 | Bacteria | 1826 |
| 318 | Ga0207643_10292498 | 3300025908 | Bacteria | 1012 |
| 319 | Ga0207643_10611106 | 3300025908 | Bacteria | 702 |
| 320 | Ga0207654_10199473 | 3300025911 | Bacteria | 1317 |
| 321 | Ga0207707_10010391 | 3300025912 | Bacteria | 8078 |
| 322 | Ga0207707_10043961 | 3300025912 | Bacteria | 3895 |
| 323 | Ga0207707_10073652 | 3300025912 | Bacteria | 2978 |
| 324 | Ga0207707_10147988 | 3300025912 | Bacteria | 2053 |
| 325 | Ga0207707_10273185 | 3300025912 | Bacteria | 1465 |
| 326 | Ga0207707_10367697 | 3300025912 | Unclassified | 1238 |
| 327 | Ga0207707_10452911 | 3300025912 | Bacteria | 1098 |
| 328 | Ga0207693_11183891 | 3300025915 | Bacteria | 577 |
| 329 | Ga0207663_10270529 | 3300025916 | Bacteria | 1258 |
| 330 | Ga0207660_10023251 | 3300025917 | Bacteria | 4185 |
| 331 | Ga0207660_10037631 | 3300025917 | Bacteria | 3373 |
| 332 | Ga0207660_10711198 | 3300025917 | Bacteria | 819 |
| 333 | Ga0207662_10001842 | 3300025918 | Bacteria | 10423 |
| 334 | Ga0207662_10027054 | 3300025918 | Bacteria | 3311 |
| 335 | Ga0207662_10056810 | 3300025918 | Bacteria | 2338 |
| 336 | Ga0207662_10960650 | 3300025918 | Bacteria | 606 |
| 337 | Ga0207657_10020891 | 3300025919 | Bacteria | 6179 |
| 338 | Ga0207657_10073934 | 3300025919 | Unclassified | 2879 |
| 339 | Ga0207657_10422436 | 3300025919 | Bacteria | 1048 |
| 340 | Ga0207649_10009278 | 3300025920 | Bacteria | 5381 |
| 341 | Ga0207649_10033247 | 3300025920 | Bacteria | 3080 |
| 342 | Ga0207649_10582031 | 3300025920 | Bacteria | 859 |
| 343 | Ga0207649_10593421 | 3300025920 | Bacteria | 851 |
| 344 | Ga0207652_10010249 | 3300025921 | Bacteria | 7543 |
| 345 | Ga0207652_10020647 | 3300025921 | Bacteria | 5427 |
| 346 | Ga0207652_10063107 | 3300025921 | Bacteria | 3203 |
| 347 | Ga0207652_10314145 | 3300025921 | Unclassified | 1414 |
| 348 | Ga0207652_10316543 | 3300025921 | Bacteria | 1409 |
| 349 | Ga0207652_10321733 | 3300025921 | Bacteria | 1396 |
| 350 | Ga0207652_10333269 | 3300025921 | Bacteria | 1370 |
| 351 | Ga0207681_10717816 | 3300025923 | Bacteria | 832 |
| 352 | Ga0207681_11797131 | 3300025923 | Unclassified | 511 |
| 353 | Ga0207694_10104348 | 3300025924 | Bacteria | 2249 |
| 354 | Ga0207694_10318769 | 3300025924 | Bacteria | 1283 |
| 355 | Ga0207650_10002232 | 3300025925 | Bacteria | 13528 |
| 356 | Ga0207650_10374887 | 3300025925 | Bacteria | 1174 |
| 357 | Ga0207650_11471734 | 3300025925 | Bacteria | 579 |
| 358 | Ga0207659_10005701 | 3300025926 | Bacteria | 7580 |
| 359 | Ga0207659_10017807 | 3300025926 | Bacteria | 4647 |
| 360 | Ga0207659_10181960 | 3300025926 | Bacteria | 1666 |
| 361 | Ga0207659_10624629 | 3300025926 | Bacteria | 919 |
| 362 | Ga0207687_10425343 | 3300025927 | Bacteria | 1097 |
| 363 | Ga0207644_10333311 | 3300025931 | Bacteria | 1229 |
| 364 | Ga0207690_10094585 | 3300025932 | Bacteria | 2120 |
| 365 | Ga0207706_10091782 | 3300025933 | Bacteria | 2670 |
| 366 | Ga0207706_10141402 | 3300025933 | Bacteria | 2117 |
| 367 | Ga0207686_10079643 | 3300025934 | Bacteria | 2134 |
| 368 | Ga0207686_10378199 | 3300025934 | Bacteria | 1073 |
| 369 | Ga0207686_10473680 | 3300025934 | Bacteria | 967 |
| 370 | Ga0207686_10556807 | 3300025934 | Bacteria | 897 |
| 371 | Ga0207686_10799882 | 3300025934 | Bacteria | 756 |
| 372 | Ga0207686_11179664 | 3300025934 | Bacteria | 626 |
| 373 | Ga0207709_10407761 | 3300025935 | Bacteria | 1041 |
| 374 | Ga0207670_10043069 | 3300025936 | Bacteria | 2979 |
| 375 | Ga0207670_10086725 | 3300025936 | Bacteria | 2203 |
| 376 | Ga0207670_10109331 | 3300025936 | Bacteria | 1989 |
| 377 | Ga0207669_10135574 | 3300025937 | Bacteria | 1700 |
| 378 | Ga0207704_10085135 | 3300025938 | Bacteria | 2057 |
| 379 | Ga0207704_10094086 | 3300025938 | Bacteria | 1978 |
| 380 | Ga0207704_10697792 | 3300025938 | Bacteria | 840 |
| 381 | Ga0207704_11207977 | 3300025938 | Bacteria | 645 |
| 382 | Ga0207691_10168942 | 3300025940 | Bacteria | 1916 |
| 383 | Ga0207691_10438309 | 3300025940 | Bacteria | 1112 |
| 384 | Ga0207691_10785357 | 3300025940 | Bacteria | 801 |
| 385 | Ga0207691_11039575 | 3300025940 | Unclassified | 683 |
| 386 | Ga0207691_11191170 | 3300025940 | Bacteria | 632 |
| 387 | Ga0207711_10084797 | 3300025941 | Bacteria | 2774 |
| 388 | Ga0207711_10086359 | 3300025941 | Bacteria | 2751 |
| 389 | Ga0207711_10090672 | 3300025941 | Bacteria | 2687 |
| 390 | Ga0207711_10403847 | 3300025941 | Bacteria | 1270 |
| 391 | Ga0207711_11001379 | 3300025941 | Bacteria | 775 |
| 392 | Ga0207689_10001224 | 3300025942 | Bacteria | 24670 |
| 393 | Ga0207689_10038589 | 3300025942 | Bacteria | 3955 |
| 394 | Ga0207689_11128317 | 3300025942 | Bacteria | 661 |
| 395 | Ga0207661_10011105 | 3300025944 | Bacteria | 6510 |
| 396 | Ga0207661_10148239 | 3300025944 | Unclassified | 2026 |
| 397 | Ga0207661_10162694 | 3300025944 | Bacteria | 1937 |
| 398 | Ga0207661_10183441 | 3300025944 | Bacteria | 1830 |
| 399 | Ga0207661_10580333 | 3300025944 | Bacteria | 1028 |
| 400 | Ga0207661_11151179 | 3300025944 | Bacteria | 714 |
| 401 | Ga0207679_10003985 | 3300025945 | Bacteria | 9172 |
| 402 | Ga0207679_10019893 | 3300025945 | Bacteria | 4522 |
| 403 | Ga0207679_10023391 | 3300025945 | Bacteria | 4225 |
| 404 | Ga0207679_10241310 | 3300025945 | Unclassified | 1531 |
| 405 | Ga0207679_10286011 | 3300025945 | Bacteria | 1416 |
| 406 | Ga0207679_10315835 | 3300025945 | Bacteria | 1351 |
| 407 | Ga0207679_10442011 | 3300025945 | Bacteria | 1152 |
| 408 | Ga0207679_10578223 | 3300025945 | Bacteria | 1010 |
| 409 | Ga0207667_10687893 | 3300025949 | Bacteria | 1026 |
| 410 | Ga0207712_10057052 | 3300025961 | Bacteria | 2753 |
| 411 | Ga0207668_10811404 | 3300025972 | Bacteria | 829 |
| 412 | Ga0207668_11000273 | 3300025972 | Bacteria | 747 |
| 413 | Ga0207640_11125962 | 3300025981 | Bacteria | 695 |
| 414 | Ga0207658_10061439 | 3300025986 | Bacteria | 2808 |
| 415 | Ga0207658_10421764 | 3300025986 | Bacteria | 1177 |
| 416 | Ga0207658_10475092 | 3300025986 | Bacteria | 1110 |
| 417 | Ga0207658_11327189 | 3300025986 | Bacteria | 658 |
| 418 | Ga0207658_12171896 | 3300025986 | Bacteria | 504 |
| 419 | Ga0207677_10209732 | 3300026023 | Bacteria | 1555 |
| 420 | Ga0207677_10863916 | 3300026023 | Bacteria | 814 |
| 421 | Ga0207677_11189549 | 3300026023 | Bacteria | 697 |
| 422 | Ga0207677_11395706 | 3300026023 | Bacteria | 645 |
| 423 | Ga0207677_11928496 | 3300026023 | Unclassified | 549 |
| 424 | Ga0207703_10256341 | 3300026035 | Bacteria | 1579 |
| 425 | Ga0207703_10468496 | 3300026035 | Bacteria | 1179 |
| 426 | Ga0207678_11817707 | 3300026067 | Bacteria | 533 |
| 427 | Ga0207708_10077774 | 3300026075 | Bacteria | 2547 |
| 428 | Ga0207708_10766770 | 3300026075 | Bacteria | 829 |
| 429 | Ga0207702_10448078 | 3300026078 | Bacteria | 1252 |
| 430 | Ga0207702_10587349 | 3300026078 | Unclassified | 1092 |
| 431 | Ga0207641_10616640 | 3300026088 | Bacteria | 1063 |
| 432 | Ga0207641_11079440 | 3300026088 | Bacteria | 801 |
| 433 | Ga0207641_11454805 | 3300026088 | Bacteria | 687 |
| 434 | Ga0207648_10028818 | 3300026089 | Bacteria | 4922 |
| 435 | Ga0207648_10459543 | 3300026089 | Bacteria | 1160 |
| 436 | Ga0207676_10003636 | 3300026095 | Bacteria | 10909 |
| 437 | Ga0207676_10497953 | 3300026095 | Bacteria | 1157 |
| 438 | Ga0207676_10906070 | 3300026095 | Bacteria | 865 |
| 439 | Ga0207676_10969997 | 3300026095 | Bacteria | 836 |
| 440 | Ga0207676_11773220 | 3300026095 | Bacteria | 616 |
| 441 | Ga0207674_10000394 | 3300026116 | Bacteria | 56421 |
| 442 | Ga0207674_10006676 | 3300026116 | Bacteria | 13554 |
| 443 | Ga0207674_10130684 | 3300026116 | Bacteria | 2474 |
| 444 | Ga0207674_10168694 | 3300026116 | Bacteria | 2142 |
| 445 | Ga0207674_10305111 | 3300026116 | Bacteria | 1541 |
| 446 | Ga0207674_10960990 | 3300026116 | Unclassified | 823 |
| 447 | Ga0207674_11673789 | 3300026116 | Bacteria | 604 |
| 448 | Ga0207675_100242376 | 3300026118 | Bacteria | 1742 |
| 449 | Ga0207683_10061770 | 3300026121 | Bacteria | 3298 |
| 450 | Ga0207683_10444693 | 3300026121 | Bacteria | 1195 |
| 451 | Ga0207683_11345413 | 3300026121 | Bacteria | 661 |
| 452 | Ga0207698_10837596 | 3300026142 | Bacteria | 924 |
| 453 | Ga0207698_11312745 | 3300026142 | Bacteria | 738 |
| 454 | Ga0207428_10132381 | 3300027907 | Bacteria | 1907 |
| 455 | Ga0207428_11253714 | 3300027907 | Bacteria | 515 |
| 456 | Ga0268266_10531015 | 3300028379 | Bacteria | 1126 |
| 457 | Ga0268266_10533721 | 3300028379 | Bacteria | 1123 |
| 458 | Ga0268265_10010077 | 3300028380 | Bacteria | 6380 |
| 459 | Ga0268265_10206517 | 3300028380 | Unclassified | 1708 |
| 460 | Ga0268265_11799124 | 3300028380 | Unclassified | 619 |
| 461 | Ga0316182_1306717 | 3300030745 | Bacteria | 617 |
| 462 | Ga0307408_101022114 | 3300031548 | Bacteria | 763 |
| 463 | Ga0307405_10099939 | 3300031731 | Bacteria | 1943 |
| 464 | Ga0307405_10716918 | 3300031731 | Bacteria | 830 |
| 465 | Ga0307405_11260476 | 3300031731 | Bacteria | 642 |
| 466 | Ga0307413_10538400 | 3300031824 | Bacteria | 945 |
| 467 | Ga0307413_10970167 | 3300031824 | Bacteria | 726 |
| 468 | Ga0307410_10419777 | 3300031852 | Bacteria | 1085 |
| 469 | Ga0307410_11078754 | 3300031852 | Bacteria | 695 |
| 470 | Ga0307410_11436386 | 3300031852 | Bacteria | 606 |
| 471 | Ga0307410_11461286 | 3300031852 | Unclassified | 601 |
| 472 | Ga0307407_10376002 | 3300031903 | Bacteria | 1013 |
| 473 | Ga0307412_11073909 | 3300031911 | Bacteria | 715 |
| 474 | Ga0307409_100347926 | 3300031995 | Bacteria | 1397 |
| 475 | Ga0307409_100382375 | 3300031995 | Unclassified | 1339 |
| 476 | Ga0307409_100545095 | 3300031995 | Unclassified | 1138 |
| 477 | Ga0307416_100565957 | 3300032002 | Bacteria | 1212 |
| 478 | Ga0307414_10540329 | 3300032004 | Bacteria | 1037 |
| 479 | Ga0307414_10611656 | 3300032004 | Bacteria | 978 |
| 480 | Ga0307411_11620321 | 3300032005 | Bacteria | 597 |
| 481 | Ga0307415_100345439 | 3300032126 | Bacteria | 1250 |
| 482 | Ga0307415_100989275 | 3300032126 | Bacteria | 781 |
| 483 | Ga0373926_0006506 | 3300035083 | Unclassified | 3878 |
| 484 | Ga0373944_0011683 | 3300035089 | Bacteria | 2409 |
| 485 | Ga0373923_0245776 | 3300035111 | Bacteria | 837 |
| 486 | Ga0373936_0078687 | 3300035113 | Bacteria | 1369 |
| 487 | Ga0373945_0019274 | 3300035116 | Bacteria | 2328 |
| 488 | Ga0373954_0093755 | 3300035118 | Bacteria | 1444 |
| 489 | Ga0373956_0035157 | 3300035119 | Bacteria | 2209 |
| 490 | Ga0373957_0123287 | 3300035120 | Bacteria | 1050 |
| 491 | Ga0373960_0380476 | 3300035121 | Unclassified | 541 |
| 492 | Ga0373943_0019920 | 3300035170 | Bacteria | 3090 |
| 493 | Ga0373946_0054015 | 3300035171 | Bacteria | 1689 |
| 494 | Ga0373955_0153702 | 3300035172 | Bacteria | 1355 |
| 495 | Ga0373955_0774620 | 3300035172 | Unclassified | 589 |
| 496 | Ga0373931_0056360 | 3300035691 | Bacteria | 2105 |
| 497 | Ga0373931_0910652 | 3300035691 | Bacteria | 591 |
| 498 | Ga0373935_0383147 | 3300035692 | Bacteria | 1007 |
| 499 | Ga0373927_0037180 | 3300035695 | Bacteria | 3165 |
| 500 | Ga0373933_0016869 | 3300035724 | Bacteria | 4092 |
| 501 | Ga0373937_0003144 | 3300036401 | Bacteria | 13817 |
| 502 | Ga0373937_0946075 | 3300036401 | Bacteria | 810 |
| 503 | Ga0373925_0075295 | 3300037068 | Bacteria | 2557 |
| 504 | Ga0395899_0883901 | 3300037312 | Bacteria | 546 |
| 505 | Ga0395898_0855404 | 3300037466 | Bacteria | 849 |
| 506 | Ga0395905_0014873 | 3300037471 | Bacteria | 7424 |
| 507 | Ga0436364_1326811 | 3300037853 | Unclassified | 822 |
| 508 | Ga0436364_1538124 | 3300037853 | Bacteria | 620 |
| 509 | Ga0436365_0332039 | 3300039437 | Bacteria | 813 |
| 510 | Ga0436365_0903494 | 3300039437 | Bacteria | 4671 |
| 511 | Ga0436365_1658826 | 3300039437 | Bacteria | 2638 |
| 512 | Ga0436365_1712124 | 3300039437 | Bacteria | 505 |
| 513 | Ga0439439_0078607 | 3300041406 | Bacteria | 890 |
| 514 | Ga0439433_0038658 | 3300041999 | Bacteria | 1107 |
| 515 | Ga0466957_0627944 | 3300044842 | Bacteria | 754 |
| 516 | Ga0451576_0265703 | 3300045051 | Unclassified | 1794 |
| 517 | Ga0451576_0568451 | 3300045051 | Bacteria | 1191 |
| 518 | Ga0466967_0202025 | 3300045976 | Bacteria | 1883 |
| 519 | Ga0466967_1046235 | 3300045976 | Bacteria | 813 |
| 520 | Ga0466967_1613402 | 3300045976 | Unclassified | 646 |
| 521 | Ga0495629_0003877 | 3300046459 | Bacteria | 11273 |
| 522 | Ga0495629_0026059 | 3300046459 | Bacteria | 4155 |
| 523 | Ga0495638_0140170 | 3300046460 | Bacteria | 1412 |
| 524 | Ga0495580_0129139 | 3300046472 | Bacteria | 1753 |
| 525 | Ga0495582_0002255 | 3300046473 | Bacteria | 10786 |
| 526 | Ga0495582_0006491 | 3300046473 | Bacteria | 6491 |
| 527 | Ga0495639_0004673 | 3300046475 | Bacteria | 5881 |
| 528 | Ga0495630_0001254 | 3300046517 | Bacteria | 17515 |
| 529 | Ga0495652_0026933 | 3300046529 | Bacteria | 5071 |
| 530 | Ga0495652_0196209 | 3300046529 | Bacteria | 1536 |
| 531 | Ga0495665_0002999 | 3300046531 | Bacteria | 9120 |
| 532 | Ga0495665_0148023 | 3300046531 | Bacteria | 1226 |
| 533 | Ga0495587_0010185 | 3300046536 | Bacteria | 5994 |
| 534 | Ga0495587_0146951 | 3300046536 | Bacteria | 1344 |
| 535 | Ga0495598_0071128 | 3300046537 | Unclassified | 1096 |
| 536 | Ga0495645_0023787 | 3300046543 | Bacteria | 4440 |
| 537 | Ga0495667_0013948 | 3300046559 | Bacteria | 5426 |
| 538 | Ga0495634_0601640 | 3300046642 | Bacteria | 638 |
| 539 | Ga0495588_0140397 | 3300046674 | Bacteria | 1276 |
| 540 | Ga0495588_0370394 | 3300046674 | Bacteria | 752 |
| 541 | Ga0495599_0014419 | 3300046678 | Bacteria | 4894 |
| 542 | Ga0495623_0014399 | 3300046679 | Bacteria | 5119 |
| 543 | Ga0495658_0001632 | 3300046683 | Bacteria | 11659 |
| 544 | Ga0495658_0935058 | 3300046683 | Bacteria | 554 |
| 545 | Ga0495669_0197726 | 3300046684 | Bacteria | 960 |
| 546 | Ga0495613_0009300 | 3300046689 | Bacteria | 7291 |
| 547 | Ga0495670_0080203 | 3300046691 | Bacteria | 1662 |
| 548 | Ga0495600_0090673 | 3300046809 | Bacteria | 1994 |
| 549 | Ga0495581_0001399 | 3300047315 | Bacteria | 13344 |
| 550 | Ga0495581_0497897 | 3300047315 | Bacteria | 708 |
| 551 | Ga0495675_0047806 | 3300047444 | Bacteria | 2722 |
| 552 | Ga0495684_0637605 | 3300047471 | Bacteria | 714 |
| 553 | Ga0495593_0001390 | 3300047673 | Bacteria | 14168 |
| 554 | Ga0495614_0000448 | 3300048089 | Bacteria | 16899 |
| 555 | Ga0496104_0120976 | 3300048907 | Bacteria | 2514 |
| 556 | Ga0496105_1127983 | 3300048908 | Bacteria | 581 |
| 557 | Ga0496106_0491328 | 3300048909 | Bacteria | 986 |
| 558 | Ga0496108_0031264 | 3300048911 | Bacteria | 4416 |
| 559 | Ga0496108_0788912 | 3300048911 | Bacteria | 820 |
| 560 | Ga0496109_1376888 | 3300048912 | Bacteria | 641 |
| 561 | Ga0496111_0224052 | 3300048914 | Unclassified | 1397 |
| 562 | Ga0496112_0002500 | 3300048915 | Bacteria | 14829 |
| 563 | Ga0496112_0685557 | 3300048915 | Bacteria | 953 |
| 564 | Ga0496113_0509129 | 3300048916 | Bacteria | 966 |
| 565 | Ga0501297_056842 | 3300049520 | Bacteria | 589 |
| 566 | Ga0501039_0218488 | 3300049575 | Unclassified | 1499 |
| 567 | Ga0501040_0071152 | 3300049576 | Unclassified | 2401 |
| 568 | Ga0501041_0065335 | 3300049577 | Unclassified | 2229 |
| 569 | Ga0501042_0026256 | 3300049578 | Bacteria | 4094 |
| 570 | Ga0501048_0068596 | 3300049582 | Unclassified | 2505 |
| 571 | Ga0501071_0652538 | 3300049587 | Bacteria | 810 |
| 572 | Ga0501072_1521465 | 3300049588 | Unclassified | 516 |
| 573 | Ga0501073_1287659 | 3300049589 | Unclassified | 501 |
| 574 | Ga0501075_0052923 | 3300049591 | Unclassified | 3053 |
| 575 | Ga0501077_0436791 | 3300049593 | Unclassified | 838 |
| 576 | Ga0501242_072049 | 3300049674 | Bacteria | 543 |
| 577 | Ga0501259_130539 | 3300049688 | Bacteria | 606 |
| 578 | Ga0501079_0039644 | 3300049741 | Unclassified | 3633 |
| 579 | Ga0501079_0412289 | 3300049741 | Bacteria | 1060 |
| 580 | Ga0501080_0790075 | 3300049742 | Bacteria | 833 |
| 581 | Ga0501081_0030883 | 3300049743 | Unclassified | 3630 |
| 582 | Ga0501081_0045593 | 3300049743 | Bacteria | 3011 |
| 583 | Ga0501083_0551757 | 3300049744 | Unclassified | 750 |
| 584 | Ga0501268_030357 | 3300049765 | Bacteria | 975 |
| 585 | Ga0501269_037489 | 3300049766 | Bacteria | 638 |
| 586 | Ga0501045_0041609 | 3300049824 | Bacteria | 3343 |
| 587 | nmdc:mga06z11_105101_c1 | 3300050494 | Unclassified | 1555 |
| 588 | nmdc:mga05p37_103157_c1 | 3300050507 | Bacteria | 3511 |
| 589 | nmdc:mga05p37_181581_c1 | 3300050507 | Bacteria | 2559 |
| 590 | nmdc:mga05p37_344200_c1 | 3300050507 | Bacteria | 1757 |
| 591 | nmdc:mga09592_131205_c1 | 3300050508 | Bacteria | 2156 |
| 592 | nmdc:mga09592_25009_c1 | 3300050508 | Bacteria | 4940 |
| 593 | nmdc:mga0qj67_287285_c1 | 3300050509 | Unclassified | 1333 |
| 594 | nmdc:mga0qj67_828125_c1 | 3300050509 | Bacteria | 732 |
| 595 | nmdc:mga06r32_394734_c1 | 3300050510 | Bacteria | 1366 |
| 596 | nmdc:mga08y16_55486_c1 | 3300050511 | Bacteria | 4139 |
| 597 | nmdc:mga0n895_330717_c1 | 3300050512 | Unclassified | 1544 |
| 598 | nmdc:mga0n895_557866_c1 | 3300050512 | Bacteria | 1151 |
| 599 | Ga0495595_0642300 | 3300053084 | Bacteria | 543 |
| 600 | Ga0500596_080974 | 3300053735 | Bacteria | 565 |
| 601 | Ga0501084_0414800 | 3300054114 | Bacteria | 1138 |
| 602 | Ga0501084_1427637 | 3300054114 | Bacteria | 580 |
| 603 | Ga0590071_119630 | 3300059421 | Bacteria | 672 |
| 604 | Ga0501082_0103629 | 3300060353 | Unclassified | 2461 |
| 605 | Ga0530510_0083132 | 3300061734 | Bacteria | 2332 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005341 | Ga0070691_10939351 | Ga0070691_109393511 | 96 |
| 2 | 3300009094 | Ga0111539_10115559 | Ga0111539_101155593 | 96 |
| 3 | 3300009148 | Ga0105243_11069245 | Ga0105243_110692452 | 96 |
| 4 | 3300009177 | Ga0105248_10844042 | Ga0105248_108440421 | 96 |
| 5 | 3300009553 | Ga0105249_10031359 | Ga0105249_100313593 | 96 |
| 6 | 3300013308 | Ga0157375_10010663 | Ga0157375_100106632 | 96 |
| 7 | 3300014326 | Ga0157380_10024401 | Ga0157380_100244012 | 96 |
| 8 | 3300026095 | Ga0207676_11773220 | Ga0207676_117732201 | 101 |
| 9 | 3300006844 | Ga0075428_100022057 | Ga0075428_1000220574 | 103 |
| 10 | 3300006844 | Ga0075428_102468747 | Ga0075428_1024687471 | 103 |
| 11 | 3300009147 | Ga0114129_11877327 | Ga0114129_118773272 | 103 |
| 12 | 3300009147 | Ga0114129_12294165 | Ga0114129_122941652 | 103 |
| 13 | 3300046536 | Ga0495587_0146951 | Ga0495587_0146951_1018_1329 | 103 |
| 14 | 3300049593 | Ga0501077_0436791 | Ga0501077_0436791_292_603 | 103 |
| 15 | 3300049743 | Ga0501081_0045593 | Ga0501081_0045593_1412_1723 | 103 |
| 16 | 3300050507 | nmdc:mga05p37_344200_c1 | nmdc:mga05p37_344200_c1_51_362 | 103 |
| 17 | 3300054114 | Ga0501084_0414800 | Ga0501084_0414800_31_342 | 103 |
| 18 | 3300061734 | Ga0530510_0083132 | Ga0530510_0083132_1383_1694 | 103 |
| 19 | 3300005364 | Ga0070673_100128225 | Ga0070673_1001282252 | 107 |
| 20 | 3300005365 | Ga0070688_100156501 | Ga0070688_1001565013 | 107 |
| 21 | 3300005367 | Ga0070667_100517931 | Ga0070667_1005179312 | 107 |
| 22 | 3300005548 | Ga0070665_101783690 | Ga0070665_1017836902 | 107 |
| 23 | 3300005617 | Ga0068859_100544055 | Ga0068859_1005440552 | 107 |
| 24 | 3300005618 | Ga0068864_101923877 | Ga0068864_1019238771 | 107 |
| 25 | 3300005840 | Ga0068870_10390273 | Ga0068870_103902732 | 107 |
| 26 | 3300005841 | Ga0068863_100839653 | Ga0068863_1008396532 | 107 |
| 27 | 3300006931 | Ga0097620_100544096 | Ga0097620_1005440962 | 107 |
| 28 | 3300009176 | Ga0105242_11463834 | Ga0105242_114638341 | 107 |
| 29 | 3300013308 | Ga0157375_10876025 | Ga0157375_108760252 | 107 |
| 30 | 3300014745 | Ga0157377_10402085 | Ga0157377_104020852 | 107 |
| 31 | 3300025942 | Ga0207689_11128317 | Ga0207689_111283171 | 107 |
| 32 | 3300025972 | Ga0207668_10811404 | Ga0207668_108114042 | 107 |
| 33 | 3300025986 | Ga0207658_10421764 | Ga0207658_104217642 | 107 |
| 34 | 3300026088 | Ga0207641_11079440 | Ga0207641_110794402 | 107 |
| 35 | 3300035111 | Ga0373923_0245776 | Ga0373923_0245776_371_703 | 107 |
| 36 | 3300035118 | Ga0373954_0093755 | Ga0373954_0093755_535_867 | 107 |
| 37 | 3300035119 | Ga0373956_0035157 | Ga0373956_0035157_1189_1521 | 107 |
| 38 | 3300035120 | Ga0373957_0123287 | Ga0373957_0123287_556_888 | 107 |
| 39 | 3300035172 | Ga0373955_0153702 | Ga0373955_0153702_711_1043 | 107 |
| 40 | 3300035724 | Ga0373933_0016869 | Ga0373933_0016869_3596_3928 | 107 |
| 41 | 3300036401 | Ga0373937_0003144 | Ga0373937_0003144_9738_10070 | 107 |
| 42 | 3300046529 | Ga0495652_0026933 | Ga0495652_0026933_485_817 | 107 |
| 43 | 3300046536 | Ga0495587_0010185 | Ga0495587_0010185_1891_2223 | 107 |
| 44 | 3300046543 | Ga0495645_0023787 | Ga0495645_0023787_4021_4353 | 107 |
| 45 | 3300046559 | Ga0495667_0013948 | Ga0495667_0013948_1041_1373 | 107 |
| 46 | 3300046678 | Ga0495599_0014419 | Ga0495599_0014419_777_1109 | 107 |
| 47 | 3300046679 | Ga0495623_0014399 | Ga0495623_0014399_4111_4443 | 107 |
| 48 | 3300046809 | Ga0495600_0090673 | Ga0495600_0090673_1550_1882 | 107 |
| 49 | 3300047444 | Ga0495675_0047806 | Ga0495675_0047806_1863_2195 | 107 |
| 50 | 3300047471 | Ga0495684_0637605 | Ga0495684_0637605_121_453 | 107 |
| 51 | 3300053084 | Ga0495595_0642300 | Ga0495595_0642300_90_422 | 107 |
| 52 | 3300005471 | Ga0070698_100238685 | Ga0070698_1002386852 | 108 |
| 53 | 3300025940 | Ga0207691_10438309 | Ga0207691_104383092 | 108 |
| 54 | 3300005327 | Ga0070658_10507288 | Ga0070658_105072881 | 109 |
| 55 | 3300005329 | Ga0070683_100550580 | Ga0070683_1005505802 | 109 |
| 56 | 3300005330 | Ga0070690_100030192 | Ga0070690_1000301922 | 109 |
| 57 | 3300005331 | Ga0070670_100054671 | Ga0070670_1000546712 | 109 |
| 58 | 3300005334 | Ga0068869_101885675 | Ga0068869_1018856751 | 109 |
| 59 | 3300005335 | Ga0070666_10332604 | Ga0070666_103326042 | 109 |
| 60 | 3300005335 | Ga0070666_10563851 | Ga0070666_105638512 | 109 |
| 61 | 3300005336 | Ga0070680_100365025 | Ga0070680_1003650253 | 109 |
| 62 | 3300005337 | Ga0070682_100133844 | Ga0070682_1001338442 | 109 |
| 63 | 3300005339 | Ga0070660_100071410 | Ga0070660_1000714101 | 109 |
| 64 | 3300005340 | Ga0070689_100014037 | Ga0070689_1000140372 | 109 |
| 65 | 3300005340 | Ga0070689_100301854 | Ga0070689_1003018541 | 109 |
| 66 | 3300005343 | Ga0070687_100031001 | Ga0070687_1000310012 | 109 |
| 67 | 3300005344 | Ga0070661_100003510 | Ga0070661_1000035105 | 109 |
| 68 | 3300005344 | Ga0070661_101136032 | Ga0070661_1011360321 | 109 |
| 69 | 3300005345 | Ga0070692_10281849 | Ga0070692_102818492 | 109 |
| 70 | 3300005347 | Ga0070668_101073635 | Ga0070668_1010736351 | 109 |
| 71 | 3300005354 | Ga0070675_100019195 | Ga0070675_1000191953 | 109 |
| 72 | 3300005364 | Ga0070673_100045583 | Ga0070673_1000455832 | 109 |
| 73 | 3300005365 | Ga0070688_100208587 | Ga0070688_1002085872 | 109 |
| 74 | 3300005366 | Ga0070659_100021345 | Ga0070659_1000213452 | 109 |
| 75 | 3300005458 | Ga0070681_10023567 | Ga0070681_100235672 | 109 |
| 76 | 3300005458 | Ga0070681_10053917 | Ga0070681_100539172 | 109 |
| 77 | 3300005459 | Ga0068867_101365879 | Ga0068867_1013658791 | 109 |
| 78 | 3300005466 | Ga0070685_10732072 | Ga0070685_107320721 | 109 |
| 79 | 3300005468 | Ga0070707_100600347 | Ga0070707_1006003471 | 109 |
| 80 | 3300005530 | Ga0070679_100302910 | Ga0070679_1003029102 | 109 |
| 81 | 3300005530 | Ga0070679_100762621 | Ga0070679_1007626211 | 109 |
| 82 | 3300005535 | Ga0070684_100009702 | Ga0070684_1000097025 | 109 |
| 83 | 3300005543 | Ga0070672_100412728 | Ga0070672_1004127282 | 109 |
| 84 | 3300005544 | Ga0070686_100860422 | Ga0070686_1008604221 | 109 |
| 85 | 3300005577 | Ga0068857_100050063 | Ga0068857_1000500633 | 109 |
| 86 | 3300005614 | Ga0068856_100889628 | Ga0068856_1008896281 | 109 |
| 87 | 3300005616 | Ga0068852_100896706 | Ga0068852_1008967061 | 109 |
| 88 | 3300005617 | Ga0068859_100068612 | Ga0068859_1000686121 | 109 |
| 89 | 3300005618 | Ga0068864_100642562 | Ga0068864_1006425622 | 109 |
| 90 | 3300005834 | Ga0068851_10027563 | Ga0068851_100275632 | 109 |
| 91 | 3300005840 | Ga0068870_10095415 | Ga0068870_100954152 | 109 |
| 92 | 3300005842 | Ga0068858_100142831 | Ga0068858_1001428312 | 109 |
| 93 | 3300005843 | Ga0068860_102052268 | Ga0068860_1020522682 | 109 |
| 94 | 3300006237 | Ga0097621_100715762 | Ga0097621_1007157622 | 109 |
| 95 | 3300006844 | Ga0075428_100200113 | Ga0075428_1002001133 | 109 |
| 96 | 3300006847 | Ga0075431_100105725 | Ga0075431_1001057253 | 109 |
| 97 | 3300006871 | Ga0075434_100013484 | Ga0075434_1000134843 | 109 |
| 98 | 3300006881 | Ga0068865_100434577 | Ga0068865_1004345772 | 109 |
| 99 | 3300006931 | Ga0097620_100068610 | Ga0097620_1000686101 | 109 |
| 100 | 3300007076 | Ga0075435_100812627 | Ga0075435_1008126272 | 109 |
| 101 | 3300009148 | Ga0105243_10584989 | Ga0105243_105849892 | 109 |
| 102 | 3300009176 | Ga0105242_10716290 | Ga0105242_107162902 | 109 |
| 103 | 3300009177 | Ga0105248_10900805 | Ga0105248_109008052 | 109 |
| 104 | 3300013308 | Ga0157375_12504930 | Ga0157375_125049301 | 109 |
| 105 | 3300017792 | Ga0163161_10290839 | Ga0163161_102908392 | 109 |
| 106 | 3300025908 | Ga0207643_10292498 | Ga0207643_102924981 | 109 |
| 107 | 3300025912 | Ga0207707_10010391 | Ga0207707_100103912 | 109 |
| 108 | 3300025912 | Ga0207707_10273185 | Ga0207707_102731852 | 109 |
| 109 | 3300025918 | Ga0207662_10001842 | Ga0207662_100018426 | 109 |
| 110 | 3300025919 | Ga0207657_10073934 | Ga0207657_100739341 | 109 |
| 111 | 3300025920 | Ga0207649_10009278 | Ga0207649_100092783 | 109 |
| 112 | 3300025921 | Ga0207652_10316543 | Ga0207652_103165432 | 109 |
| 113 | 3300025921 | Ga0207652_10333269 | Ga0207652_103332692 | 109 |
| 114 | 3300025925 | Ga0207650_10002232 | Ga0207650_100022327 | 109 |
| 115 | 3300025926 | Ga0207659_10017807 | Ga0207659_100178072 | 109 |
| 116 | 3300025932 | Ga0207690_10094585 | Ga0207690_100945852 | 109 |
| 117 | 3300025936 | Ga0207670_10109331 | Ga0207670_101093311 | 109 |
| 118 | 3300025938 | Ga0207704_10697792 | Ga0207704_106977921 | 109 |
| 119 | 3300025941 | Ga0207711_10084797 | Ga0207711_100847972 | 109 |
| 120 | 3300025941 | Ga0207711_11001379 | Ga0207711_110013792 | 109 |
| 121 | 3300025944 | Ga0207661_10162694 | Ga0207661_101626942 | 109 |
| 122 | 3300025945 | Ga0207679_10003985 | Ga0207679_100039852 | 109 |
| 123 | 3300025972 | Ga0207668_11000273 | Ga0207668_110002732 | 109 |
| 124 | 3300025981 | Ga0207640_11125962 | Ga0207640_111259622 | 109 |
| 125 | 3300025986 | Ga0207658_10475092 | Ga0207658_104750922 | 109 |
| 126 | 3300026035 | Ga0207703_10256341 | Ga0207703_102563412 | 109 |
| 127 | 3300026078 | Ga0207702_10587349 | Ga0207702_105873492 | 109 |
| 128 | 3300026088 | Ga0207641_11454805 | Ga0207641_114548052 | 109 |
| 129 | 3300026095 | Ga0207676_10969997 | Ga0207676_109699972 | 109 |
| 130 | 3300026116 | Ga0207674_10000394 | Ga0207674_100003943 | 109 |
| 131 | 3300026142 | Ga0207698_10837596 | Ga0207698_108375961 | 109 |
| 132 | 3300031903 | Ga0307407_10376002 | Ga0307407_103760022 | 109 |
| 133 | 3300031995 | Ga0307409_100545095 | Ga0307409_1005450952 | 109 |
| 134 | 3300037853 | Ga0436364_1326811 | Ga0436364_1326811_404_748 | 109 |
| 135 | 3300039437 | Ga0436365_0903494 | Ga0436365_0903494_1795_2139 | 109 |
| 136 | 3300039437 | Ga0436365_1712124 | Ga0436365_1712124_18_362 | 109 |
| 137 | 3300046529 | Ga0495652_0196209 | Ga0495652_0196209_185_517 | 109 |
| 138 | 3300046691 | Ga0495670_0080203 | Ga0495670_0080203_213_542 | 109 |
| 139 | 3300048911 | Ga0496108_0788912 | Ga0496108_0788912_372_701 | 109 |
| 140 | 3300048912 | Ga0496109_1376888 | Ga0496109_1376888_260_589 | 109 |
| 141 | 3300048915 | Ga0496112_0685557 | Ga0496112_0685557_368_697 | 109 |
| 142 | 3300005439 | Ga0070711_100742921 | Ga0070711_1007429212 | 110 |
| 143 | 3300005458 | Ga0070681_10718209 | Ga0070681_107182092 | 110 |
| 144 | 3300014325 | Ga0163163_10685658 | Ga0163163_106856582 | 110 |
| 145 | 3300025912 | Ga0207707_10452911 | Ga0207707_104529112 | 110 |
| 146 | 3300025916 | Ga0207663_10270529 | Ga0207663_102705291 | 110 |
| 147 | 3300035172 | Ga0373955_0774620 | Ga0373955_0774620_38_370 | 110 |
| 148 | 3300036401 | Ga0373937_0946075 | Ga0373937_0946075_65_406 | 110 |
| 149 | 3300046459 | Ga0495629_0003877 | Ga0495629_0003877_4519_4860 | 110 |
| 150 | 3300046473 | Ga0495582_0006491 | Ga0495582_0006491_44_385 | 110 |
| 151 | 3300046531 | Ga0495665_0148023 | Ga0495665_0148023_621_962 | 110 |
| 152 | 3300046642 | Ga0495634_0601640 | Ga0495634_0601640_293_625 | 110 |
| 153 | 3300046683 | Ga0495658_0935058 | Ga0495658_0935058_180_521 | 110 |
| 154 | 3300049741 | Ga0501079_0412289 | Ga0501079_0412289_588_920 | 110 |
| 155 | 3300053735 | Ga0500596_080974 | Ga0500596_080974_188_526 | 110 |
| 156 | 3300005288 | Ga0065714_10334836 | Ga0065714_103348361 | 111 |
| 157 | 3300005290 | Ga0065712_10150657 | Ga0065712_101506572 | 111 |
| 158 | 3300005328 | Ga0070676_10986139 | Ga0070676_109861391 | 111 |
| 159 | 3300005329 | Ga0070683_100000397 | Ga0070683_10000039710 | 111 |
| 160 | 3300005329 | Ga0070683_100118677 | Ga0070683_1001186772 | 111 |
| 161 | 3300005329 | Ga0070683_100128940 | Ga0070683_1001289402 | 111 |
| 162 | 3300005329 | Ga0070683_100186309 | Ga0070683_1001863092 | 111 |
| 163 | 3300005329 | Ga0070683_100491843 | Ga0070683_1004918432 | 111 |
| 164 | 3300005329 | Ga0070683_100784860 | Ga0070683_1007848602 | 111 |
| 165 | 3300005330 | Ga0070690_100011574 | Ga0070690_1000115743 | 111 |
| 166 | 3300005330 | Ga0070690_100022311 | Ga0070690_1000223112 | 111 |
| 167 | 3300005331 | Ga0070670_100008704 | Ga0070670_1000087042 | 111 |
| 168 | 3300005331 | Ga0070670_100443381 | Ga0070670_1004433812 | 111 |
| 169 | 3300005331 | Ga0070670_101210081 | Ga0070670_1012100811 | 111 |
| 170 | 3300005331 | Ga0070670_101229458 | Ga0070670_1012294581 | 111 |
| 171 | 3300005333 | Ga0070677_10742518 | Ga0070677_107425181 | 111 |
| 172 | 3300005334 | Ga0068869_100012820 | Ga0068869_1000128201 | 111 |
| 173 | 3300005334 | Ga0068869_100084552 | Ga0068869_1000845522 | 111 |
| 174 | 3300005335 | Ga0070666_10642669 | Ga0070666_106426692 | 111 |
| 175 | 3300005335 | Ga0070666_10695871 | Ga0070666_106958712 | 111 |
| 176 | 3300005336 | Ga0070680_100145278 | Ga0070680_1001452782 | 111 |
| 177 | 3300005336 | Ga0070680_100182186 | Ga0070680_1001821862 | 111 |
| 178 | 3300005337 | Ga0070682_100002879 | Ga0070682_10000287910 | 111 |
| 179 | 3300005337 | Ga0070682_100192666 | Ga0070682_1001926662 | 111 |
| 180 | 3300005338 | Ga0068868_100376293 | Ga0068868_1003762932 | 111 |
| 181 | 3300005338 | Ga0068868_101251479 | Ga0068868_1012514792 | 111 |
| 182 | 3300005339 | Ga0070660_100105209 | Ga0070660_1001052092 | 111 |
| 183 | 3300005340 | Ga0070689_100043089 | Ga0070689_1000430893 | 111 |
| 184 | 3300005343 | Ga0070687_100258414 | Ga0070687_1002584141 | 111 |
| 185 | 3300005344 | Ga0070661_100032444 | Ga0070661_1000324445 | 111 |
| 186 | 3300005345 | Ga0070692_10146398 | Ga0070692_101463982 | 111 |
| 187 | 3300005347 | Ga0070668_100196206 | Ga0070668_1001962062 | 111 |
| 188 | 3300005353 | Ga0070669_100345512 | Ga0070669_1003455122 | 111 |
| 189 | 3300005353 | Ga0070669_100890319 | Ga0070669_1008903192 | 111 |
| 190 | 3300005353 | Ga0070669_101982180 | Ga0070669_1019821801 | 111 |
| 191 | 3300005354 | Ga0070675_100156897 | Ga0070675_1001568972 | 111 |
| 192 | 3300005354 | Ga0070675_100174951 | Ga0070675_1001749511 | 111 |
| 193 | 3300005354 | Ga0070675_100282922 | Ga0070675_1002829222 | 111 |
| 194 | 3300005354 | Ga0070675_100370794 | Ga0070675_1003707942 | 111 |
| 195 | 3300005354 | Ga0070675_100457091 | Ga0070675_1004570911 | 111 |
| 196 | 3300005354 | Ga0070675_100569405 | Ga0070675_1005694052 | 111 |
| 197 | 3300005354 | Ga0070675_102094061 | Ga0070675_1020940612 | 111 |
| 198 | 3300005355 | Ga0070671_100403031 | Ga0070671_1004030312 | 111 |
| 199 | 3300005355 | Ga0070671_101436784 | Ga0070671_1014367841 | 111 |
| 200 | 3300005356 | Ga0070674_101668657 | Ga0070674_1016686571 | 111 |
| 201 | 3300005364 | Ga0070673_100361329 | Ga0070673_1003613292 | 111 |
| 202 | 3300005364 | Ga0070673_100599368 | Ga0070673_1005993682 | 111 |
| 203 | 3300005365 | Ga0070688_101334432 | Ga0070688_1013344321 | 111 |
| 204 | 3300005366 | Ga0070659_100032698 | Ga0070659_1000326982 | 111 |
| 205 | 3300005366 | Ga0070659_100054972 | Ga0070659_1000549721 | 111 |
| 206 | 3300005367 | Ga0070667_100052574 | Ga0070667_1000525742 | 111 |
| 207 | 3300005367 | Ga0070667_100393735 | Ga0070667_1003937352 | 111 |
| 208 | 3300005367 | Ga0070667_101400693 | Ga0070667_1014006931 | 111 |
| 209 | 3300005406 | Ga0070703_10289507 | Ga0070703_102895071 | 111 |
| 210 | 3300005435 | Ga0070714_102510790 | Ga0070714_1025107901 | 111 |
| 211 | 3300005437 | Ga0070710_10827708 | Ga0070710_108277081 | 111 |
| 212 | 3300005438 | Ga0070701_10147152 | Ga0070701_101471522 | 111 |
| 213 | 3300005441 | Ga0070700_100805666 | Ga0070700_1008056662 | 111 |
| 214 | 3300005444 | Ga0070694_100672240 | Ga0070694_1006722401 | 111 |
| 215 | 3300005455 | Ga0070663_102142797 | Ga0070663_1021427971 | 111 |
| 216 | 3300005456 | Ga0070678_100357791 | Ga0070678_1003577912 | 111 |
| 217 | 3300005456 | Ga0070678_101207024 | Ga0070678_1012070241 | 111 |
| 218 | 3300005457 | Ga0070662_100039730 | Ga0070662_1000397302 | 111 |
| 219 | 3300005457 | Ga0070662_100146976 | Ga0070662_1001469763 | 111 |
| 220 | 3300005458 | Ga0070681_10005421 | Ga0070681_100054217 | 111 |
| 221 | 3300005458 | Ga0070681_10014161 | Ga0070681_100141615 | 111 |
| 222 | 3300005458 | Ga0070681_10035575 | Ga0070681_100355756 | 111 |
| 223 | 3300005458 | Ga0070681_10062326 | Ga0070681_100623262 | 111 |
| 224 | 3300005458 | Ga0070681_10124064 | Ga0070681_101240642 | 111 |
| 225 | 3300005459 | Ga0068867_100872029 | Ga0068867_1008720291 | 111 |
| 226 | 3300005459 | Ga0068867_100920778 | Ga0068867_1009207782 | 111 |
| 227 | 3300005466 | Ga0070685_10094419 | Ga0070685_100944192 | 111 |
| 228 | 3300005466 | Ga0070685_10113558 | Ga0070685_101135582 | 111 |
| 229 | 3300005530 | Ga0070679_100027827 | Ga0070679_1000278278 | 111 |
| 230 | 3300005530 | Ga0070679_100135487 | Ga0070679_1001354871 | 111 |
| 231 | 3300005530 | Ga0070679_100196255 | Ga0070679_1001962552 | 111 |
| 232 | 3300005530 | Ga0070679_100608202 | Ga0070679_1006082022 | 111 |
| 233 | 3300005530 | Ga0070679_100956427 | Ga0070679_1009564271 | 111 |
| 234 | 3300005535 | Ga0070684_100002124 | Ga0070684_1000021246 | 111 |
| 235 | 3300005535 | Ga0070684_100021443 | Ga0070684_1000214432 | 111 |
| 236 | 3300005535 | Ga0070684_100069824 | Ga0070684_1000698242 | 111 |
| 237 | 3300005535 | Ga0070684_100073445 | Ga0070684_1000734452 | 111 |
| 238 | 3300005535 | Ga0070684_100163363 | Ga0070684_1001633632 | 111 |
| 239 | 3300005543 | Ga0070672_100080941 | Ga0070672_1000809412 | 111 |
| 240 | 3300005543 | Ga0070672_100123371 | Ga0070672_1001233712 | 111 |
| 241 | 3300005543 | Ga0070672_100757868 | Ga0070672_1007578682 | 111 |
| 242 | 3300005543 | Ga0070672_100819076 | Ga0070672_1008190762 | 111 |
| 243 | 3300005544 | Ga0070686_100373998 | Ga0070686_1003739983 | 111 |
| 244 | 3300005546 | Ga0070696_100000091 | Ga0070696_10000009130 | 111 |
| 245 | 3300005547 | Ga0070693_100005288 | Ga0070693_1000052886 | 111 |
| 246 | 3300005547 | Ga0070693_100054905 | Ga0070693_1000549052 | 111 |
| 247 | 3300005547 | Ga0070693_100094296 | Ga0070693_1000942962 | 111 |
| 248 | 3300005547 | Ga0070693_100189337 | Ga0070693_1001893372 | 111 |
| 249 | 3300005548 | Ga0070665_100480897 | Ga0070665_1004808972 | 111 |
| 250 | 3300005563 | Ga0068855_102541746 | Ga0068855_1025417461 | 111 |
| 251 | 3300005564 | Ga0070664_100040858 | Ga0070664_1000408583 | 111 |
| 252 | 3300005564 | Ga0070664_100044326 | Ga0070664_1000443263 | 111 |
| 253 | 3300005564 | Ga0070664_100084312 | Ga0070664_1000843122 | 111 |
| 254 | 3300005564 | Ga0070664_100113459 | Ga0070664_1001134592 | 111 |
| 255 | 3300005564 | Ga0070664_100117072 | Ga0070664_1001170722 | 111 |
| 256 | 3300005577 | Ga0068857_100012441 | Ga0068857_1000124412 | 111 |
| 257 | 3300005577 | Ga0068857_100081828 | Ga0068857_1000818282 | 111 |
| 258 | 3300005577 | Ga0068857_100284974 | Ga0068857_1002849742 | 111 |
| 259 | 3300005577 | Ga0068857_100694042 | Ga0068857_1006940422 | 111 |
| 260 | 3300005577 | Ga0068857_102528520 | Ga0068857_1025285201 | 111 |
| 261 | 3300005578 | Ga0068854_102045710 | Ga0068854_1020457102 | 111 |
| 262 | 3300005614 | Ga0068856_100098099 | Ga0068856_1000980992 | 111 |
| 263 | 3300005615 | Ga0070702_101056571 | Ga0070702_1010565711 | 111 |
| 264 | 3300005616 | Ga0068852_100057164 | Ga0068852_1000571642 | 111 |
| 265 | 3300005616 | Ga0068852_102099570 | Ga0068852_1020995701 | 111 |
| 266 | 3300005617 | Ga0068859_100012899 | Ga0068859_1000128999 | 111 |
| 267 | 3300005617 | Ga0068859_101103483 | Ga0068859_1011034832 | 111 |
| 268 | 3300005617 | Ga0068859_101209848 | Ga0068859_1012098482 | 111 |
| 269 | 3300005618 | Ga0068864_100145945 | Ga0068864_1001459451 | 111 |
| 270 | 3300005618 | Ga0068864_100274761 | Ga0068864_1002747612 | 111 |
| 271 | 3300005618 | Ga0068864_102499530 | Ga0068864_1024995301 | 111 |
| 272 | 3300005718 | Ga0068866_10169061 | Ga0068866_101690611 | 111 |
| 273 | 3300005719 | Ga0068861_100209594 | Ga0068861_1002095942 | 111 |
| 274 | 3300005719 | Ga0068861_101418634 | Ga0068861_1014186342 | 111 |
| 275 | 3300005719 | Ga0068861_102018286 | Ga0068861_1020182862 | 111 |
| 276 | 3300005834 | Ga0068851_10389920 | Ga0068851_103899201 | 111 |
| 277 | 3300005840 | Ga0068870_10023943 | Ga0068870_100239432 | 111 |
| 278 | 3300005840 | Ga0068870_10067451 | Ga0068870_100674514 | 111 |
| 279 | 3300005840 | Ga0068870_10326050 | Ga0068870_103260502 | 111 |
| 280 | 3300005840 | Ga0068870_10490680 | Ga0068870_104906801 | 111 |
| 281 | 3300005841 | Ga0068863_100085116 | Ga0068863_1000851162 | 111 |
| 282 | 3300005841 | Ga0068863_100580198 | Ga0068863_1005801981 | 111 |
| 283 | 3300005842 | Ga0068858_100013502 | Ga0068858_1000135022 | 111 |
| 284 | 3300005842 | Ga0068858_101691433 | Ga0068858_1016914331 | 111 |
| 285 | 3300005843 | Ga0068860_100161200 | Ga0068860_1001612001 | 111 |
| 286 | 3300005843 | Ga0068860_101028858 | Ga0068860_1010288582 | 111 |
| 287 | 3300005844 | Ga0068862_100022773 | Ga0068862_1000227732 | 111 |
| 288 | 3300005844 | Ga0068862_100055358 | Ga0068862_1000553582 | 111 |
| 289 | 3300005937 | Ga0081455_10155791 | Ga0081455_101557913 | 111 |
| 290 | 3300006178 | Ga0075367_10017173 | Ga0075367_100171732 | 111 |
| 291 | 3300006237 | Ga0097621_100070749 | Ga0097621_1000707496 | 111 |
| 292 | 3300006237 | Ga0097621_100903686 | Ga0097621_1009036862 | 111 |
| 293 | 3300006358 | Ga0068871_100027068 | Ga0068871_1000270682 | 111 |
| 294 | 3300006358 | Ga0068871_100981580 | Ga0068871_1009815801 | 111 |
| 295 | 3300006844 | Ga0075428_100052361 | Ga0075428_1000523614 | 111 |
| 296 | 3300006846 | Ga0075430_100376347 | Ga0075430_1003763472 | 111 |
| 297 | 3300006847 | Ga0075431_100038235 | Ga0075431_1000382352 | 111 |
| 298 | 3300006852 | Ga0075433_10747488 | Ga0075433_107474881 | 111 |
| 299 | 3300006871 | Ga0075434_100335165 | Ga0075434_1003351652 | 111 |
| 300 | 3300006871 | Ga0075434_100499355 | Ga0075434_1004993552 | 111 |
| 301 | 3300006871 | Ga0075434_100618975 | Ga0075434_1006189752 | 111 |
| 302 | 3300006880 | Ga0075429_100004287 | Ga0075429_1000042874 | 111 |
| 303 | 3300006880 | Ga0075429_100022694 | Ga0075429_1000226942 | 111 |
| 304 | 3300006880 | Ga0075429_101597988 | Ga0075429_1015979881 | 111 |
| 305 | 3300006881 | Ga0068865_100190954 | Ga0068865_1001909542 | 111 |
| 306 | 3300006881 | Ga0068865_100592729 | Ga0068865_1005927292 | 111 |
| 307 | 3300006881 | Ga0068865_100598421 | Ga0068865_1005984212 | 111 |
| 308 | 3300006881 | Ga0068865_100931579 | Ga0068865_1009315792 | 111 |
| 309 | 3300006931 | Ga0097620_100012901 | Ga0097620_1000129019 | 111 |
| 310 | 3300006931 | Ga0097620_101103529 | Ga0097620_1011035292 | 111 |
| 311 | 3300006931 | Ga0097620_101127150 | Ga0097620_1011271501 | 111 |
| 312 | 3300006931 | Ga0097620_101209893 | Ga0097620_1012098932 | 111 |
| 313 | 3300009094 | Ga0111539_10392128 | Ga0111539_103921281 | 111 |
| 314 | 3300009094 | Ga0111539_10795929 | Ga0111539_107959292 | 111 |
| 315 | 3300009094 | Ga0111539_11345017 | Ga0111539_113450172 | 111 |
| 316 | 3300009098 | Ga0105245_10006625 | Ga0105245_1000662511 | 111 |
| 317 | 3300009098 | Ga0105245_10175458 | Ga0105245_101754582 | 111 |
| 318 | 3300009098 | Ga0105245_10211751 | Ga0105245_102117512 | 111 |
| 319 | 3300009098 | Ga0105245_10294318 | Ga0105245_102943183 | 111 |
| 320 | 3300009098 | Ga0105245_10964767 | Ga0105245_109647671 | 111 |
| 321 | 3300009098 | Ga0105245_11904924 | Ga0105245_119049241 | 111 |
| 322 | 3300009101 | Ga0105247_10446550 | Ga0105247_104465502 | 111 |
| 323 | 3300009101 | Ga0105247_10715659 | Ga0105247_107156592 | 111 |
| 324 | 3300009101 | Ga0105247_11403825 | Ga0105247_114038252 | 111 |
| 325 | 3300009147 | Ga0114129_10085612 | Ga0114129_100856122 | 111 |
| 326 | 3300009147 | Ga0114129_10310051 | Ga0114129_103100512 | 111 |
| 327 | 3300009148 | Ga0105243_10082332 | Ga0105243_100823322 | 111 |
| 328 | 3300009148 | Ga0105243_12484387 | Ga0105243_124843871 | 111 |
| 329 | 3300009174 | Ga0105241_10003972 | Ga0105241_1000397215 | 111 |
| 330 | 3300009174 | Ga0105241_10609190 | Ga0105241_106091902 | 111 |
| 331 | 3300009176 | Ga0105242_10085925 | Ga0105242_100859253 | 111 |
| 332 | 3300009176 | Ga0105242_10243769 | Ga0105242_102437692 | 111 |
| 333 | 3300009176 | Ga0105242_11369293 | Ga0105242_113692932 | 111 |
| 334 | 3300009177 | Ga0105248_10197420 | Ga0105248_101974202 | 111 |
| 335 | 3300009177 | Ga0105248_11036632 | Ga0105248_110366322 | 111 |
| 336 | 3300009177 | Ga0105248_11552022 | Ga0105248_115520222 | 111 |
| 337 | 3300009177 | Ga0105248_12054343 | Ga0105248_120543432 | 111 |
| 338 | 3300009545 | Ga0105237_10213937 | Ga0105237_102139372 | 111 |
| 339 | 3300009545 | Ga0105237_10504184 | Ga0105237_105041841 | 111 |
| 340 | 3300009551 | Ga0105238_10155484 | Ga0105238_101554842 | 111 |
| 341 | 3300009551 | Ga0105238_10304346 | Ga0105238_103043463 | 111 |
| 342 | 3300009551 | Ga0105238_10477572 | Ga0105238_104775722 | 111 |
| 343 | 3300009553 | Ga0105249_10131720 | Ga0105249_101317202 | 111 |
| 344 | 3300009553 | Ga0105249_10714102 | Ga0105249_107141021 | 111 |
| 345 | 3300010375 | Ga0105239_11704893 | Ga0105239_117048932 | 111 |
| 346 | 3300011119 | Ga0105246_10047589 | Ga0105246_100475892 | 111 |
| 347 | 3300011119 | Ga0105246_10293128 | Ga0105246_102931282 | 111 |
| 348 | 3300013102 | Ga0157371_10007749 | Ga0157371_1000774911 | 111 |
| 349 | 3300013102 | Ga0157371_10047491 | Ga0157371_100474913 | 111 |
| 350 | 3300013105 | Ga0157369_10358966 | Ga0157369_103589661 | 111 |
| 351 | 3300013105 | Ga0157369_10760826 | Ga0157369_107608262 | 111 |
| 352 | 3300013105 | Ga0157369_12471710 | Ga0157369_124717101 | 111 |
| 353 | 3300013296 | Ga0157374_10721347 | Ga0157374_107213471 | 111 |
| 354 | 3300013296 | Ga0157374_10990862 | Ga0157374_109908622 | 111 |
| 355 | 3300013297 | Ga0157378_10391768 | Ga0157378_103917682 | 111 |
| 356 | 3300013306 | Ga0163162_10286087 | Ga0163162_102860872 | 111 |
| 357 | 3300013306 | Ga0163162_10767207 | Ga0163162_107672072 | 111 |
| 358 | 3300013307 | Ga0157372_10096471 | Ga0157372_100964712 | 111 |
| 359 | 3300013307 | Ga0157372_10439388 | Ga0157372_104393881 | 111 |
| 360 | 3300013307 | Ga0157372_10491108 | Ga0157372_104911081 | 111 |
| 361 | 3300013307 | Ga0157372_10847238 | Ga0157372_108472381 | 111 |
| 362 | 3300013307 | Ga0157372_10919230 | Ga0157372_109192302 | 111 |
| 363 | 3300013307 | Ga0157372_12599545 | Ga0157372_125995452 | 111 |
| 364 | 3300013308 | Ga0157375_10064241 | Ga0157375_100642412 | 111 |
| 365 | 3300013308 | Ga0157375_10245359 | Ga0157375_102453592 | 111 |
| 366 | 3300013308 | Ga0157375_10266493 | Ga0157375_102664932 | 111 |
| 367 | 3300013308 | Ga0157375_11214131 | Ga0157375_112141312 | 111 |
| 368 | 3300014325 | Ga0163163_10005137 | Ga0163163_100051372 | 111 |
| 369 | 3300014325 | Ga0163163_10376362 | Ga0163163_103763622 | 111 |
| 370 | 3300014325 | Ga0163163_11391365 | Ga0163163_113913651 | 111 |
| 371 | 3300014325 | Ga0163163_12939761 | Ga0163163_129397611 | 111 |
| 372 | 3300014326 | Ga0157380_10081761 | Ga0157380_100817611 | 111 |
| 373 | 3300014745 | Ga0157377_10000839 | Ga0157377_1000083912 | 111 |
| 374 | 3300014745 | Ga0157377_10749997 | Ga0157377_107499972 | 111 |
| 375 | 3300014968 | Ga0157379_12042109 | Ga0157379_120421092 | 111 |
| 376 | 3300014969 | Ga0157376_10011794 | Ga0157376_100117942 | 111 |
| 377 | 3300014969 | Ga0157376_10828504 | Ga0157376_108285042 | 111 |
| 378 | 3300014969 | Ga0157376_10859051 | Ga0157376_108590512 | 111 |
| 379 | 3300017792 | Ga0163161_10083452 | Ga0163161_100834522 | 111 |
| 380 | 3300021388 | Ga0213875_10461425 | Ga0213875_104614252 | 111 |
| 381 | 3300025321 | Ga0207656_10075212 | Ga0207656_100752121 | 111 |
| 382 | 3300025321 | Ga0207656_10247428 | Ga0207656_102474282 | 111 |
| 383 | 3300025893 | Ga0207682_10344654 | Ga0207682_103446541 | 111 |
| 384 | 3300025899 | Ga0207642_10732565 | Ga0207642_107325652 | 111 |
| 385 | 3300025900 | Ga0207710_10146760 | Ga0207710_101467602 | 111 |
| 386 | 3300025901 | Ga0207688_10387038 | Ga0207688_103870382 | 111 |
| 387 | 3300025903 | Ga0207680_10427392 | Ga0207680_104273922 | 111 |
| 388 | 3300025903 | Ga0207680_10497401 | Ga0207680_104974011 | 111 |
| 389 | 3300025906 | Ga0207699_10136911 | Ga0207699_101369112 | 111 |
| 390 | 3300025907 | Ga0207645_10145098 | Ga0207645_101450982 | 111 |
| 391 | 3300025907 | Ga0207645_10321884 | Ga0207645_103218842 | 111 |
| 392 | 3300025907 | Ga0207645_10462387 | Ga0207645_104623872 | 111 |
| 393 | 3300025908 | Ga0207643_10086015 | Ga0207643_100860152 | 111 |
| 394 | 3300025908 | Ga0207643_10611106 | Ga0207643_106111061 | 111 |
| 395 | 3300025911 | Ga0207654_10199473 | Ga0207654_101994732 | 111 |
| 396 | 3300025912 | Ga0207707_10043961 | Ga0207707_100439612 | 111 |
| 397 | 3300025912 | Ga0207707_10073652 | Ga0207707_100736522 | 111 |
| 398 | 3300025912 | Ga0207707_10147988 | Ga0207707_101479882 | 111 |
| 399 | 3300025912 | Ga0207707_10367697 | Ga0207707_103676971 | 111 |
| 400 | 3300025915 | Ga0207693_11183891 | Ga0207693_111838911 | 111 |
| 401 | 3300025917 | Ga0207660_10023251 | Ga0207660_100232512 | 111 |
| 402 | 3300025917 | Ga0207660_10037631 | Ga0207660_100376312 | 111 |
| 403 | 3300025917 | Ga0207660_10711198 | Ga0207660_107111982 | 111 |
| 404 | 3300025918 | Ga0207662_10027054 | Ga0207662_100270542 | 111 |
| 405 | 3300025918 | Ga0207662_10056810 | Ga0207662_100568101 | 111 |
| 406 | 3300025918 | Ga0207662_10960650 | Ga0207662_109606501 | 111 |
| 407 | 3300025919 | Ga0207657_10020891 | Ga0207657_100208913 | 111 |
| 408 | 3300025919 | Ga0207657_10422436 | Ga0207657_104224361 | 111 |
| 409 | 3300025920 | Ga0207649_10033247 | Ga0207649_100332476 | 111 |
| 410 | 3300025920 | Ga0207649_10582031 | Ga0207649_105820312 | 111 |
| 411 | 3300025920 | Ga0207649_10593421 | Ga0207649_105934212 | 111 |
| 412 | 3300025921 | Ga0207652_10010249 | Ga0207652_100102493 | 111 |
| 413 | 3300025921 | Ga0207652_10020647 | Ga0207652_100206472 | 111 |
| 414 | 3300025921 | Ga0207652_10063107 | Ga0207652_100631072 | 111 |
| 415 | 3300025921 | Ga0207652_10314145 | Ga0207652_103141451 | 111 |
| 416 | 3300025921 | Ga0207652_10321733 | Ga0207652_103217332 | 111 |
| 417 | 3300025923 | Ga0207681_10717816 | Ga0207681_107178162 | 111 |
| 418 | 3300025923 | Ga0207681_11797131 | Ga0207681_117971311 | 111 |
| 419 | 3300025924 | Ga0207694_10104348 | Ga0207694_101043483 | 111 |
| 420 | 3300025924 | Ga0207694_10318769 | Ga0207694_103187691 | 111 |
| 421 | 3300025925 | Ga0207650_10374887 | Ga0207650_103748872 | 111 |
| 422 | 3300025925 | Ga0207650_11471734 | Ga0207650_114717341 | 111 |
| 423 | 3300025926 | Ga0207659_10005701 | Ga0207659_100057019 | 111 |
| 424 | 3300025926 | Ga0207659_10181960 | Ga0207659_101819602 | 111 |
| 425 | 3300025926 | Ga0207659_10624629 | Ga0207659_106246291 | 111 |
| 426 | 3300025927 | Ga0207687_10425343 | Ga0207687_104253432 | 111 |
| 427 | 3300025931 | Ga0207644_10333311 | Ga0207644_103333113 | 111 |
| 428 | 3300025933 | Ga0207706_10091782 | Ga0207706_100917822 | 111 |
| 429 | 3300025933 | Ga0207706_10141402 | Ga0207706_101414022 | 111 |
| 430 | 3300025934 | Ga0207686_10079643 | Ga0207686_100796432 | 111 |
| 431 | 3300025934 | Ga0207686_10378199 | Ga0207686_103781992 | 111 |
| 432 | 3300025934 | Ga0207686_10473680 | Ga0207686_104736802 | 111 |
| 433 | 3300025934 | Ga0207686_10556807 | Ga0207686_105568071 | 111 |
| 434 | 3300025934 | Ga0207686_10799882 | Ga0207686_107998822 | 111 |
| 435 | 3300025934 | Ga0207686_11179664 | Ga0207686_111796642 | 111 |
| 436 | 3300025935 | Ga0207709_10407761 | Ga0207709_104077612 | 111 |
| 437 | 3300025936 | Ga0207670_10043069 | Ga0207670_100430691 | 111 |
| 438 | 3300025936 | Ga0207670_10086725 | Ga0207670_100867252 | 111 |
| 439 | 3300025937 | Ga0207669_10135574 | Ga0207669_101355742 | 111 |
| 440 | 3300025938 | Ga0207704_10085135 | Ga0207704_100851352 | 111 |
| 441 | 3300025938 | Ga0207704_10094086 | Ga0207704_100940862 | 111 |
| 442 | 3300025938 | Ga0207704_11207977 | Ga0207704_112079771 | 111 |
| 443 | 3300025940 | Ga0207691_10168942 | Ga0207691_101689422 | 111 |
| 444 | 3300025940 | Ga0207691_10785357 | Ga0207691_107853571 | 111 |
| 445 | 3300025940 | Ga0207691_11039575 | Ga0207691_110395752 | 111 |
| 446 | 3300025940 | Ga0207691_11191170 | Ga0207691_111911702 | 111 |
| 447 | 3300025941 | Ga0207711_10086359 | Ga0207711_100863592 | 111 |
| 448 | 3300025941 | Ga0207711_10090672 | Ga0207711_100906722 | 111 |
| 449 | 3300025941 | Ga0207711_10403847 | Ga0207711_104038472 | 111 |
| 450 | 3300025942 | Ga0207689_10001224 | Ga0207689_1000122417 | 111 |
| 451 | 3300025942 | Ga0207689_10038589 | Ga0207689_100385892 | 111 |
| 452 | 3300025944 | Ga0207661_10011105 | Ga0207661_100111051 | 111 |
| 453 | 3300025944 | Ga0207661_10148239 | Ga0207661_101482392 | 111 |
| 454 | 3300025944 | Ga0207661_10183441 | Ga0207661_101834411 | 111 |
| 455 | 3300025944 | Ga0207661_10580333 | Ga0207661_105803332 | 111 |
| 456 | 3300025944 | Ga0207661_11151179 | Ga0207661_111511792 | 111 |
| 457 | 3300025945 | Ga0207679_10019893 | Ga0207679_100198933 | 111 |
| 458 | 3300025945 | Ga0207679_10023391 | Ga0207679_100233912 | 111 |
| 459 | 3300025945 | Ga0207679_10241310 | Ga0207679_102413102 | 111 |
| 460 | 3300025945 | Ga0207679_10286011 | Ga0207679_102860111 | 111 |
| 461 | 3300025945 | Ga0207679_10315835 | Ga0207679_103158352 | 111 |
| 462 | 3300025945 | Ga0207679_10442011 | Ga0207679_104420112 | 111 |
| 463 | 3300025945 | Ga0207679_10578223 | Ga0207679_105782232 | 111 |
| 464 | 3300025949 | Ga0207667_10687893 | Ga0207667_106878932 | 111 |
| 465 | 3300025961 | Ga0207712_10057052 | Ga0207712_100570522 | 111 |
| 466 | 3300025986 | Ga0207658_10061439 | Ga0207658_100614392 | 111 |
| 467 | 3300025986 | Ga0207658_11327189 | Ga0207658_113271891 | 111 |
| 468 | 3300025986 | Ga0207658_12171896 | Ga0207658_121718961 | 111 |
| 469 | 3300026023 | Ga0207677_10209732 | Ga0207677_102097322 | 111 |
| 470 | 3300026023 | Ga0207677_10863916 | Ga0207677_108639161 | 111 |
| 471 | 3300026023 | Ga0207677_11189549 | Ga0207677_111895492 | 111 |
| 472 | 3300026023 | Ga0207677_11395706 | Ga0207677_113957062 | 111 |
| 473 | 3300026023 | Ga0207677_11928496 | Ga0207677_119284962 | 111 |
| 474 | 3300026035 | Ga0207703_10468496 | Ga0207703_104684962 | 111 |
| 475 | 3300026067 | Ga0207678_11817707 | Ga0207678_118177071 | 111 |
| 476 | 3300026075 | Ga0207708_10077774 | Ga0207708_100777743 | 111 |
| 477 | 3300026075 | Ga0207708_10766770 | Ga0207708_107667701 | 111 |
| 478 | 3300026078 | Ga0207702_10448078 | Ga0207702_104480782 | 111 |
| 479 | 3300026088 | Ga0207641_10616640 | Ga0207641_106166401 | 111 |
| 480 | 3300026089 | Ga0207648_10028818 | Ga0207648_100288182 | 111 |
| 481 | 3300026089 | Ga0207648_10459543 | Ga0207648_104595432 | 111 |
| 482 | 3300026095 | Ga0207676_10003636 | Ga0207676_100036369 | 111 |
| 483 | 3300026095 | Ga0207676_10497953 | Ga0207676_104979532 | 111 |
| 484 | 3300026095 | Ga0207676_10906070 | Ga0207676_109060702 | 111 |
| 485 | 3300026116 | Ga0207674_10006676 | Ga0207674_100066762 | 111 |
| 486 | 3300026116 | Ga0207674_10130684 | Ga0207674_101306842 | 111 |
| 487 | 3300026116 | Ga0207674_10168694 | Ga0207674_101686941 | 111 |
| 488 | 3300026116 | Ga0207674_10305111 | Ga0207674_103051112 | 111 |
| 489 | 3300026116 | Ga0207674_10960990 | Ga0207674_109609902 | 111 |
| 490 | 3300026116 | Ga0207674_11673789 | Ga0207674_116737892 | 111 |
| 491 | 3300026118 | Ga0207675_100242376 | Ga0207675_1002423762 | 111 |
| 492 | 3300026121 | Ga0207683_10061770 | Ga0207683_100617702 | 111 |
| 493 | 3300026121 | Ga0207683_10444693 | Ga0207683_104446931 | 111 |
| 494 | 3300026121 | Ga0207683_11345413 | Ga0207683_113454131 | 111 |
| 495 | 3300026142 | Ga0207698_11312745 | Ga0207698_113127452 | 111 |
| 496 | 3300027907 | Ga0207428_10132381 | Ga0207428_101323812 | 111 |
| 497 | 3300027907 | Ga0207428_11253714 | Ga0207428_112537141 | 111 |
| 498 | 3300028379 | Ga0268266_10531015 | Ga0268266_105310152 | 111 |
| 499 | 3300028379 | Ga0268266_10533721 | Ga0268266_105337211 | 111 |
| 500 | 3300028380 | Ga0268265_10010077 | Ga0268265_100100776 | 111 |
| 501 | 3300028380 | Ga0268265_10206517 | Ga0268265_102065173 | 111 |
| 502 | 3300028380 | Ga0268265_11799124 | Ga0268265_117991242 | 111 |
| 503 | 3300030745 | Ga0316182_1306717 | Ga0316182_13067172 | 111 |
| 504 | 3300031548 | Ga0307408_101022114 | Ga0307408_1010221142 | 111 |
| 505 | 3300031731 | Ga0307405_10099939 | Ga0307405_100999392 | 111 |
| 506 | 3300031731 | Ga0307405_10716918 | Ga0307405_107169182 | 111 |
| 507 | 3300031731 | Ga0307405_11260476 | Ga0307405_112604762 | 111 |
| 508 | 3300031824 | Ga0307413_10538400 | Ga0307413_105384002 | 111 |
| 509 | 3300031824 | Ga0307413_10970167 | Ga0307413_109701671 | 111 |
| 510 | 3300031852 | Ga0307410_10419777 | Ga0307410_104197772 | 111 |
| 511 | 3300031852 | Ga0307410_11078754 | Ga0307410_110787542 | 111 |
| 512 | 3300031852 | Ga0307410_11436386 | Ga0307410_114363862 | 111 |
| 513 | 3300031852 | Ga0307410_11461286 | Ga0307410_114612861 | 111 |
| 514 | 3300031911 | Ga0307412_11073909 | Ga0307412_110739091 | 111 |
| 515 | 3300031995 | Ga0307409_100347926 | Ga0307409_1003479262 | 111 |
| 516 | 3300031995 | Ga0307409_100382375 | Ga0307409_1003823752 | 111 |
| 517 | 3300032002 | Ga0307416_100565957 | Ga0307416_1005659572 | 111 |
| 518 | 3300032004 | Ga0307414_10540329 | Ga0307414_105403292 | 111 |
| 519 | 3300032004 | Ga0307414_10611656 | Ga0307414_106116562 | 111 |
| 520 | 3300032005 | Ga0307411_11620321 | Ga0307411_116203212 | 111 |
| 521 | 3300032126 | Ga0307415_100345439 | Ga0307415_1003454392 | 111 |
| 522 | 3300032126 | Ga0307415_100989275 | Ga0307415_1009892752 | 111 |
| 523 | 3300035083 | Ga0373926_0006506 | Ga0373926_0006506_49_399 | 111 |
| 524 | 3300035089 | Ga0373944_0011683 | Ga0373944_0011683_759_1109 | 111 |
| 525 | 3300035113 | Ga0373936_0078687 | Ga0373936_0078687_815_1165 | 111 |
| 526 | 3300035116 | Ga0373945_0019274 | Ga0373945_0019274_1010_1360 | 111 |
| 527 | 3300035121 | Ga0373960_0380476 | Ga0373960_0380476_97_432 | 111 |
| 528 | 3300035170 | Ga0373943_0019920 | Ga0373943_0019920_2185_2535 | 111 |
| 529 | 3300035171 | Ga0373946_0054015 | Ga0373946_0054015_392_742 | 111 |
| 530 | 3300035691 | Ga0373931_0056360 | Ga0373931_0056360_226_561 | 111 |
| 531 | 3300035691 | Ga0373931_0910652 | Ga0373931_0910652_233_568 | 111 |
| 532 | 3300035692 | Ga0373935_0383147 | Ga0373935_0383147_46_396 | 111 |
| 533 | 3300035695 | Ga0373927_0037180 | Ga0373927_0037180_1539_1889 | 111 |
| 534 | 3300037068 | Ga0373925_0075295 | Ga0373925_0075295_2186_2536 | 111 |
| 535 | 3300037312 | Ga0395899_0883901 | Ga0395899_0883901_102_437 | 111 |
| 536 | 3300037466 | Ga0395898_0855404 | Ga0395898_0855404_458_793 | 111 |
| 537 | 3300037471 | Ga0395905_0014873 | Ga0395905_0014873_5338_5673 | 111 |
| 538 | 3300037853 | Ga0436364_1538124 | Ga0436364_1538124_128_463 | 111 |
| 539 | 3300039437 | Ga0436365_0332039 | Ga0436365_0332039_105_440 | 111 |
| 540 | 3300039437 | Ga0436365_1658826 | Ga0436365_1658826_1744_2079 | 111 |
| 541 | 3300041406 | Ga0439439_0078607 | Ga0439439_0078607_221_556 | 111 |
| 542 | 3300041999 | Ga0439433_0038658 | Ga0439433_0038658_67_402 | 111 |
| 543 | 3300044842 | Ga0466957_0627944 | Ga0466957_0627944_148_498 | 111 |
| 544 | 3300045051 | Ga0451576_0265703 | Ga0451576_0265703_934_1269 | 111 |
| 545 | 3300045051 | Ga0451576_0568451 | Ga0451576_0568451_831_1166 | 111 |
| 546 | 3300045976 | Ga0466967_0202025 | Ga0466967_0202025_343_678 | 111 |
| 547 | 3300045976 | Ga0466967_1046235 | Ga0466967_1046235_294_629 | 111 |
| 548 | 3300045976 | Ga0466967_1613402 | Ga0466967_1613402_103_453 | 111 |
| 549 | 3300046459 | Ga0495629_0026059 | Ga0495629_0026059_3177_3527 | 111 |
| 550 | 3300046460 | Ga0495638_0140170 | Ga0495638_0140170_721_1056 | 111 |
| 551 | 3300046472 | Ga0495580_0129139 | Ga0495580_0129139_275_625 | 111 |
| 552 | 3300046473 | Ga0495582_0002255 | Ga0495582_0002255_331_681 | 111 |
| 553 | 3300046475 | Ga0495639_0004673 | Ga0495639_0004673_1976_2326 | 111 |
| 554 | 3300046517 | Ga0495630_0001254 | Ga0495630_0001254_4178_4528 | 111 |
| 555 | 3300046531 | Ga0495665_0002999 | Ga0495665_0002999_1879_2229 | 111 |
| 556 | 3300046537 | Ga0495598_0071128 | Ga0495598_0071128_161_496 | 111 |
| 557 | 3300046674 | Ga0495588_0140397 | Ga0495588_0140397_857_1192 | 111 |
| 558 | 3300046674 | Ga0495588_0370394 | Ga0495588_0370394_113_448 | 111 |
| 559 | 3300046683 | Ga0495658_0001632 | Ga0495658_0001632_7138_7488 | 111 |
| 560 | 3300046684 | Ga0495669_0197726 | Ga0495669_0197726_25_360 | 111 |
| 561 | 3300046689 | Ga0495613_0009300 | Ga0495613_0009300_6146_6496 | 111 |
| 562 | 3300047315 | Ga0495581_0001399 | Ga0495581_0001399_5600_5950 | 111 |
| 563 | 3300047315 | Ga0495581_0497897 | Ga0495581_0497897_45_395 | 111 |
| 564 | 3300047673 | Ga0495593_0001390 | Ga0495593_0001390_8423_8773 | 111 |
| 565 | 3300048089 | Ga0495614_0000448 | Ga0495614_0000448_1835_2185 | 111 |
| 566 | 3300048907 | Ga0496104_0120976 | Ga0496104_0120976_878_1213 | 111 |
| 567 | 3300048908 | Ga0496105_1127983 | Ga0496105_1127983_69_404 | 111 |
| 568 | 3300048909 | Ga0496106_0491328 | Ga0496106_0491328_600_935 | 111 |
| 569 | 3300048911 | Ga0496108_0031264 | Ga0496108_0031264_153_488 | 111 |
| 570 | 3300048914 | Ga0496111_0224052 | Ga0496111_0224052_637_972 | 111 |
| 571 | 3300048915 | Ga0496112_0002500 | Ga0496112_0002500_13013_13348 | 111 |
| 572 | 3300048916 | Ga0496113_0509129 | Ga0496113_0509129_131_466 | 111 |
| 573 | 3300049520 | Ga0501297_056842 | Ga0501297_056842_240_575 | 111 |
| 574 | 3300049575 | Ga0501039_0218488 | Ga0501039_0218488_13_348 | 111 |
| 575 | 3300049576 | Ga0501040_0071152 | Ga0501040_0071152_394_729 | 111 |
| 576 | 3300049577 | Ga0501041_0065335 | Ga0501041_0065335_860_1195 | 111 |
| 577 | 3300049578 | Ga0501042_0026256 | Ga0501042_0026256_2504_2839 | 111 |
| 578 | 3300049582 | Ga0501048_0068596 | Ga0501048_0068596_127_462 | 111 |
| 579 | 3300049587 | Ga0501071_0652538 | Ga0501071_0652538_33_368 | 111 |
| 580 | 3300049588 | Ga0501072_1521465 | Ga0501072_1521465_53_388 | 111 |
| 581 | 3300049589 | Ga0501073_1287659 | Ga0501073_1287659_144_479 | 111 |
| 582 | 3300049591 | Ga0501075_0052923 | Ga0501075_0052923_1668_2003 | 111 |
| 583 | 3300049674 | Ga0501242_072049 | Ga0501242_072049_48_383 | 111 |
| 584 | 3300049688 | Ga0501259_130539 | Ga0501259_130539_93_428 | 111 |
| 585 | 3300049741 | Ga0501079_0039644 | Ga0501079_0039644_1545_1880 | 111 |
| 586 | 3300049742 | Ga0501080_0790075 | Ga0501080_0790075_113_448 | 111 |
| 587 | 3300049743 | Ga0501081_0030883 | Ga0501081_0030883_804_1139 | 111 |
| 588 | 3300049744 | Ga0501083_0551757 | Ga0501083_0551757_75_410 | 111 |
| 589 | 3300049765 | Ga0501268_030357 | Ga0501268_030357_209_544 | 111 |
| 590 | 3300049766 | Ga0501269_037489 | Ga0501269_037489_280_615 | 111 |
| 591 | 3300049824 | Ga0501045_0041609 | Ga0501045_0041609_2353_2688 | 111 |
| 592 | 3300050494 | nmdc:mga06z11_105101_c1 | nmdc:mga06z11_105101_c1_1204_1539 | 111 |
| 593 | 3300050507 | nmdc:mga05p37_103157_c1 | nmdc:mga05p37_103157_c1_1140_1475 | 111 |
| 594 | 3300050507 | nmdc:mga05p37_181581_c1 | nmdc:mga05p37_181581_c1_349_684 | 111 |
| 595 | 3300050508 | nmdc:mga09592_131205_c1 | nmdc:mga09592_131205_c1_848_1186 | 111 |
| 596 | 3300050508 | nmdc:mga09592_25009_c1 | nmdc:mga09592_25009_c1_2949_3284 | 111 |
| 597 | 3300050509 | nmdc:mga0qj67_287285_c1 | nmdc:mga0qj67_287285_c1_437_772 | 111 |
| 598 | 3300050509 | nmdc:mga0qj67_828125_c1 | nmdc:mga0qj67_828125_c1_229_567 | 111 |
| 599 | 3300050510 | nmdc:mga06r32_394734_c1 | nmdc:mga06r32_394734_c1_334_672 | 111 |
| 600 | 3300050511 | nmdc:mga08y16_55486_c1 | nmdc:mga08y16_55486_c1_1803_2138 | 111 |
| 601 | 3300050512 | nmdc:mga0n895_330717_c1 | nmdc:mga0n895_330717_c1_564_914 | 111 |
| 602 | 3300050512 | nmdc:mga0n895_557866_c1 | nmdc:mga0n895_557866_c1_237_572 | 111 |
| 603 | 3300054114 | Ga0501084_1427637 | Ga0501084_1427637_169_504 | 111 |
| 604 | 3300059421 | Ga0590071_119630 | Ga0590071_119630_182_517 | 111 |
| 605 | 3300060353 | Ga0501082_0103629 | Ga0501082_0103629_1518_1853 | 111 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1xma-assembly1.cif.gz_B-2 | structure of a transcriptional regulator from clostridium thermocellum cth-833 | 0.9249 | 8 | 105 |
| 3hhh-assembly1.cif.gz_B | crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 | 0.9246 | 6 | 109 |
| 1xma-assembly1.cif.gz_A | structure of a transcriptional regulator from clostridium thermocellum cth-833 | 0.9195 | 8 | 105 |
| 3hhh-assembly1.cif.gz_A | crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 | 0.9143 | 6 | 109 |
| 6abq-assembly1.cif.gz_A | crystal structure of transcription factor from listeria monocytogenes | 0.9133 | 7 | 107 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9SU39_105_239_3.40.50.1000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.9588 | 66 | 81 | 3.40.50.1000 |
| 1xmaA00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9195 | 8 | 105 | 1.10.10.10 |
| af_I6X7F9_1_101_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9194 | 11 | 109 | 1.10.10.10 |
| 5zqhA00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.894 | 9 | 109 | 1.10.10.10 |
| 3l7wA00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8935 | 14 | 108 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V9ELH6-F1-model_v4 | PadR family transcriptional regulator | 0.9968 | 11 | 109 |
|
| AF-A0A2V9Y9M6-F1-model_v4 | PadR family transcriptional regulator | 0.9964 | 12 | 108 |
|
| AF-A0A7V0Y414-F1-model_v4 | PadR family transcriptional regulator | 0.9964 | 12 | 110 |
|
| AF-A0A2V8EA09-F1-model_v4 | PadR family transcriptional regulator | 0.9954 | 7 | 89 |
|
| AF-A0A2E8EBH7-F1-model_v4 | PadR family transcriptional regulator | 0.9953 | 11 | 109 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar