F468464

General Info

Members Datasets Scaffolds Average Seq Length
605 270 605 111

Family's Representative Sequence

Representative Sequence 3300009101|Ga0105247_11403825|Ga0105247_114038252
Length 125
Sequence MFKPPTTTTLSRHFVTVRAQTDALRGSLDLLVLKTLSLVPMHGWGIGQRIQQTSKGILEVNQGSLYPALQRLEKDGLIVSDWGATDNNRRARYYRLTPSGRRALGQELESWKRFSSGLDAVLRST

Samples

Sample ID Description Type Environment
1 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
108 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
162 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
165 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
166 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
167 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
168 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
169 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
170 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
171 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
172 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
173 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
174 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
175 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
176 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
177 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
178 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
179 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
180 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
181 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
182 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
183 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
184 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
185 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
186 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
187 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
188 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
189 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
190 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
191 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
192 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
193 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
194 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
195 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
196 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
197 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
198 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
199 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
200 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
201 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
202 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
203 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
204 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
205 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
206 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
207 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
208 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
209 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
210 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
211 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
212 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
213 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
214 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
215 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
216 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
217 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
218 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
219 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
220 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
221 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
222 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
223 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
224 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
225 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
226 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
227 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
228 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
229 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
230 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
231 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
232 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
233 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
234 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
235 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
236 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
237 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
238 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
239 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
245 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
246 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
247 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
248 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
249 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
250 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
251 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
252 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
253 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
254 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
255 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
256 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
257 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
258 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
259 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
260 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
261 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
262 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
263 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
264 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
265 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
266 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
267 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
268 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
269 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
270 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.5
Nodule 0
Rhizoplane 1.65
Rhizosphere 96.69
Stem 0
Stem Tuber 0
Unclassified 1.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065714_10334836 3300005288 Bacteria 652
2 Ga0065712_10150657 3300005290 Unclassified 1372
3 Ga0070658_10507288 3300005327 Unclassified 1042
4 Ga0070676_10986139 3300005328 Unclassified 632
5 Ga0070683_100000397 3300005329 Bacteria 30109
6 Ga0070683_100118677 3300005329 Bacteria 2498
7 Ga0070683_100128940 3300005329 Bacteria 2393
8 Ga0070683_100186309 3300005329 Bacteria 1970
9 Ga0070683_100491843 3300005329 Unclassified 1172
10 Ga0070683_100550580 3300005329 Bacteria 1103
11 Ga0070683_100784860 3300005329 Bacteria 913
12 Ga0070690_100011574 3300005330 Bacteria 5164
13 Ga0070690_100022311 3300005330 Bacteria 3872
14 Ga0070690_100030192 3300005330 Bacteria 3366
15 Ga0070670_100008704 3300005331 Bacteria 8662
16 Ga0070670_100054671 3300005331 Unclassified 3427
17 Ga0070670_100443381 3300005331 Bacteria 1150
18 Ga0070670_101210081 3300005331 Bacteria 690
19 Ga0070670_101229458 3300005331 Bacteria 685
20 Ga0070677_10742518 3300005333 Unclassified 556
21 Ga0068869_100012820 3300005334 Bacteria 5548
22 Ga0068869_100084552 3300005334 Bacteria 2375
23 Ga0068869_101885675 3300005334 Unclassified 535
24 Ga0070666_10332604 3300005335 Bacteria 1085
25 Ga0070666_10563851 3300005335 Bacteria 829
26 Ga0070666_10642669 3300005335 Unclassified 776
27 Ga0070666_10695871 3300005335 Unclassified 745
28 Ga0070680_100145278 3300005336 Bacteria 1990
29 Ga0070680_100182186 3300005336 Unclassified 1769
30 Ga0070680_100365025 3300005336 Bacteria 1228
31 Ga0070682_100002879 3300005337 Bacteria 9543
32 Ga0070682_100133844 3300005337 Unclassified 1681
33 Ga0070682_100192666 3300005337 Bacteria 1432
34 Ga0068868_100376293 3300005338 Bacteria 1221
35 Ga0068868_101251479 3300005338 Bacteria 688
36 Ga0070660_100071410 3300005339 Unclassified 2711
37 Ga0070660_100105209 3300005339 Bacteria 2239
38 Ga0070689_100014037 3300005340 Bacteria 5812
39 Ga0070689_100043089 3300005340 Unclassified 3467
40 Ga0070689_100301854 3300005340 Bacteria 1333
41 Ga0070691_10939351 3300005341 Bacteria 536
42 Ga0070687_100031001 3300005343 Bacteria 2619
43 Ga0070687_100258414 3300005343 Unclassified 1085
44 Ga0070661_100003510 3300005344 Bacteria 10799
45 Ga0070661_100032444 3300005344 Bacteria 3781
46 Ga0070661_101136032 3300005344 Bacteria 652
47 Ga0070692_10146398 3300005345 Bacteria 1342
48 Ga0070692_10281849 3300005345 Unclassified 1007
49 Ga0070668_100196206 3300005347 Bacteria 1655
50 Ga0070668_101073635 3300005347 Bacteria 726
51 Ga0070669_100345512 3300005353 Bacteria 1207
52 Ga0070669_100890319 3300005353 Bacteria 760
53 Ga0070669_101982180 3300005353 Unclassified 509
54 Ga0070675_100019195 3300005354 Bacteria 5446
55 Ga0070675_100156897 3300005354 Bacteria 1954
56 Ga0070675_100174951 3300005354 Bacteria 1853
57 Ga0070675_100282922 3300005354 Bacteria 1458
58 Ga0070675_100370794 3300005354 Bacteria 1273
59 Ga0070675_100457091 3300005354 Bacteria 1146
60 Ga0070675_100569405 3300005354 Bacteria 1025
61 Ga0070675_102094061 3300005354 Bacteria 521
62 Ga0070671_100403031 3300005355 Bacteria 1170
63 Ga0070671_101436784 3300005355 Bacteria 610
64 Ga0070674_101668657 3300005356 Bacteria 576
65 Ga0070673_100045583 3300005364 Bacteria 3401
66 Ga0070673_100128225 3300005364 Unclassified 2125
67 Ga0070673_100361329 3300005364 Bacteria 1291
68 Ga0070673_100599368 3300005364 Bacteria 1005
69 Ga0070688_100156501 3300005365 Bacteria 1562
70 Ga0070688_100208587 3300005365 Bacteria 1371
71 Ga0070688_101334432 3300005365 Bacteria 580
72 Ga0070659_100021345 3300005366 Bacteria 4931
73 Ga0070659_100032698 3300005366 Bacteria 4036
74 Ga0070659_100054972 3300005366 Bacteria 3136
75 Ga0070667_100052574 3300005367 Bacteria 3438
76 Ga0070667_100393735 3300005367 Bacteria 1260
77 Ga0070667_100517931 3300005367 Unclassified 1094
78 Ga0070667_101400693 3300005367 Bacteria 656
79 Ga0070703_10289507 3300005406 Bacteria 679
80 Ga0070714_102510790 3300005435 Bacteria 500
81 Ga0070710_10827708 3300005437 Unclassified 663
82 Ga0070701_10147152 3300005438 Bacteria 1353
83 Ga0070711_100742921 3300005439 Bacteria 829
84 Ga0070700_100805666 3300005441 Bacteria 757
85 Ga0070694_100672240 3300005444 Bacteria 840
86 Ga0070663_102142797 3300005455 Unclassified 504
87 Ga0070678_100357791 3300005456 Bacteria 1257
88 Ga0070678_101207024 3300005456 Bacteria 701
89 Ga0070662_100039730 3300005457 Bacteria 3347
90 Ga0070662_100146976 3300005457 Bacteria 1832
91 Ga0070681_10005421 3300005458 Bacteria 12324
92 Ga0070681_10014161 3300005458 Bacteria 7938
93 Ga0070681_10023567 3300005458 Bacteria 6191
94 Ga0070681_10035575 3300005458 Bacteria 5003
95 Ga0070681_10053917 3300005458 Bacteria 4006
96 Ga0070681_10062326 3300005458 Bacteria 3702
97 Ga0070681_10124064 3300005458 Bacteria 2515
98 Ga0070681_10718209 3300005458 Bacteria 915
99 Ga0068867_100872029 3300005459 Bacteria 808
100 Ga0068867_100920778 3300005459 Bacteria 788
101 Ga0068867_101365879 3300005459 Unclassified 656
102 Ga0070685_10094419 3300005466 Bacteria 1816
103 Ga0070685_10113558 3300005466 Bacteria 1672
104 Ga0070685_10732072 3300005466 Bacteria 724
105 Ga0070707_100600347 3300005468 Bacteria 1063
106 Ga0070698_100238685 3300005471 Bacteria 1751
107 Ga0070679_100027827 3300005530 Bacteria 5569
108 Ga0070679_100135487 3300005530 Bacteria 2444
109 Ga0070679_100196255 3300005530 Bacteria 1986
110 Ga0070679_100302910 3300005530 Bacteria 1549
111 Ga0070679_100608202 3300005530 Bacteria 1036
112 Ga0070679_100762621 3300005530 Bacteria 910
113 Ga0070679_100956427 3300005530 Bacteria 800
114 Ga0070684_100002124 3300005535 Bacteria 14621
115 Ga0070684_100009702 3300005535 Bacteria 7596
116 Ga0070684_100021443 3300005535 Bacteria 5377
117 Ga0070684_100069824 3300005535 Bacteria 3090
118 Ga0070684_100073445 3300005535 Unclassified 3014
119 Ga0070684_100163363 3300005535 Bacteria 2021
120 Ga0070672_100080941 3300005543 Bacteria 2603
121 Ga0070672_100123371 3300005543 Bacteria 2123
122 Ga0070672_100412728 3300005543 Bacteria 1159
123 Ga0070672_100757868 3300005543 Bacteria 852
124 Ga0070672_100819076 3300005543 Bacteria 820
125 Ga0070686_100373998 3300005544 Bacteria 1077
126 Ga0070686_100860422 3300005544 Bacteria 735
127 Ga0070696_100000091 3300005546 Bacteria 44490
128 Ga0070693_100005288 3300005547 Bacteria 6185
129 Ga0070693_100054905 3300005547 Bacteria 2293
130 Ga0070693_100094296 3300005547 Bacteria 1811
131 Ga0070693_100189337 3300005547 Bacteria 1330
132 Ga0070665_100480897 3300005548 Bacteria 1253
133 Ga0070665_101783690 3300005548 Unclassified 622
134 Ga0068855_102541746 3300005563 Bacteria 509
135 Ga0070664_100040858 3300005564 Bacteria 3912
136 Ga0070664_100044326 3300005564 Bacteria 3756
137 Ga0070664_100084312 3300005564 Bacteria 2743
138 Ga0070664_100113459 3300005564 Bacteria 2367
139 Ga0070664_100117072 3300005564 Bacteria 2331
140 Ga0068857_100012441 3300005577 Bacteria 7408
141 Ga0068857_100050063 3300005577 Unclassified 3706
142 Ga0068857_100081828 3300005577 Bacteria 2883
143 Ga0068857_100284974 3300005577 Bacteria 1520
144 Ga0068857_100694042 3300005577 Bacteria 967
145 Ga0068857_102528520 3300005577 Unclassified 504
146 Ga0068854_102045710 3300005578 Bacteria 528
147 Ga0068856_100098099 3300005614 Bacteria 2920
148 Ga0068856_100889628 3300005614 Unclassified 909
149 Ga0070702_101056571 3300005615 Bacteria 646
150 Ga0068852_100057164 3300005616 Bacteria 3375
151 Ga0068852_100896706 3300005616 Bacteria 904
152 Ga0068852_102099570 3300005616 Bacteria 587
153 Ga0068859_100012899 3300005617 Bacteria 8395
154 Ga0068859_100068612 3300005617 Bacteria 3580
155 Ga0068859_100544055 3300005617 Bacteria 1256
156 Ga0068859_101103483 3300005617 Bacteria 873
157 Ga0068859_101209848 3300005617 Bacteria 832
158 Ga0068864_100145945 3300005618 Unclassified 2139
159 Ga0068864_100274761 3300005618 Bacteria 1571
160 Ga0068864_100642562 3300005618 Unclassified 1033
161 Ga0068864_101923877 3300005618 Bacteria 597
162 Ga0068864_102499530 3300005618 Bacteria 523
163 Ga0068866_10169061 3300005718 Unclassified 1282
164 Ga0068861_100209594 3300005719 Bacteria 1641
165 Ga0068861_101418634 3300005719 Bacteria 679
166 Ga0068861_102018286 3300005719 Bacteria 576
167 Ga0068851_10027563 3300005834 Unclassified 2800
168 Ga0068851_10389920 3300005834 Bacteria 818
169 Ga0068870_10023943 3300005840 Bacteria 3017
170 Ga0068870_10067451 3300005840 Bacteria 1941
171 Ga0068870_10095415 3300005840 Bacteria 1671
172 Ga0068870_10326050 3300005840 Bacteria 977
173 Ga0068870_10390273 3300005840 Bacteria 903
174 Ga0068870_10490680 3300005840 Bacteria 817
175 Ga0068863_100085116 3300005841 Bacteria 2996
176 Ga0068863_100580198 3300005841 Bacteria 1109
177 Ga0068863_100839653 3300005841 Bacteria 917
178 Ga0068858_100013502 3300005842 Bacteria 7707
179 Ga0068858_100142831 3300005842 Bacteria 2248
180 Ga0068858_101691433 3300005842 Bacteria 625
181 Ga0068860_100161200 3300005843 Bacteria 2162
182 Ga0068860_101028858 3300005843 Unclassified 842
183 Ga0068860_102052268 3300005843 Unclassified 593
184 Ga0068862_100022773 3300005844 Bacteria 5242
185 Ga0068862_100055358 3300005844 Bacteria 3398
186 Ga0081455_10155791 3300005937 Bacteria 1756
187 Ga0075367_10017173 3300006178 Bacteria 3967
188 Ga0097621_100070749 3300006237 Bacteria 2881
189 Ga0097621_100715762 3300006237 Bacteria 923
190 Ga0097621_100903686 3300006237 Bacteria 823
191 Ga0068871_100027068 3300006358 Bacteria 4481
192 Ga0068871_100981580 3300006358 Bacteria 786
193 Ga0075428_100022057 3300006844 Bacteria 7049
194 Ga0075428_100052361 3300006844 Bacteria 4475
195 Ga0075428_100200113 3300006844 Bacteria 2160
196 Ga0075428_102468747 3300006844 Bacteria 533
197 Ga0075430_100376347 3300006846 Unclassified 1172
198 Ga0075431_100038235 3300006847 Bacteria 4941
199 Ga0075431_100105725 3300006847 Bacteria 2904
200 Ga0075433_10747488 3300006852 Bacteria 855
201 Ga0075434_100013484 3300006871 Bacteria 7781
202 Ga0075434_100335165 3300006871 Unclassified 1533
203 Ga0075434_100499355 3300006871 Bacteria 1237
204 Ga0075434_100618975 3300006871 Unclassified 1101
205 Ga0075429_100004287 3300006880 Bacteria 12246
206 Ga0075429_100022694 3300006880 Bacteria 5441
207 Ga0075429_101597988 3300006880 Bacteria 567
208 Ga0068865_100190954 3300006881 Bacteria 1584
209 Ga0068865_100434577 3300006881 Bacteria 1082
210 Ga0068865_100592729 3300006881 Bacteria 936
211 Ga0068865_100598421 3300006881 Bacteria 932
212 Ga0068865_100931579 3300006881 Bacteria 757
213 Ga0097620_100012901 3300006931 Bacteria 8395
214 Ga0097620_100068610 3300006931 Bacteria 3580
215 Ga0097620_100544096 3300006931 Bacteria 1256
216 Ga0097620_101103529 3300006931 Bacteria 873
217 Ga0097620_101127150 3300006931 Bacteria 863
218 Ga0097620_101209893 3300006931 Bacteria 832
219 Ga0075435_100812627 3300007076 Bacteria 814
220 Ga0111539_10115559 3300009094 Bacteria 3147
221 Ga0111539_10392128 3300009094 Bacteria 1617
222 Ga0111539_10795929 3300009094 Bacteria 1100
223 Ga0111539_11345017 3300009094 Bacteria 829
224 Ga0105245_10006625 3300009098 Bacteria 10170
225 Ga0105245_10175458 3300009098 Bacteria 2044
226 Ga0105245_10211751 3300009098 Unclassified 1866
227 Ga0105245_10294318 3300009098 Bacteria 1591
228 Ga0105245_10964767 3300009098 Bacteria 896
229 Ga0105245_11904924 3300009098 Bacteria 648
230 Ga0105247_10446550 3300009101 Unclassified 931
231 Ga0105247_10715659 3300009101 Bacteria 755
232 Ga0105247_11403825 3300009101 Bacteria 565
233 Ga0114129_10085612 3300009147 Bacteria 4373
234 Ga0114129_10310051 3300009147 Bacteria 2101
235 Ga0114129_11877327 3300009147 Bacteria 727
236 Ga0114129_12294165 3300009147 Unclassified 648
237 Ga0105243_10082332 3300009148 Bacteria 2630
238 Ga0105243_10584989 3300009148 Bacteria 1072
239 Ga0105243_11069245 3300009148 Bacteria 813
240 Ga0105243_12484387 3300009148 Bacteria 557
241 Ga0105241_10003972 3300009174 Bacteria 10936
242 Ga0105241_10609190 3300009174 Bacteria 987
243 Ga0105242_10085925 3300009176 Bacteria 2639
244 Ga0105242_10243769 3300009176 Unclassified 1617
245 Ga0105242_10716290 3300009176 Unclassified 981
246 Ga0105242_11369293 3300009176 Bacteria 734
247 Ga0105242_11463834 3300009176 Bacteria 712
248 Ga0105248_10197420 3300009177 Bacteria 2267
249 Ga0105248_10844042 3300009177 Bacteria 1034
250 Ga0105248_10900805 3300009177 Bacteria 999
251 Ga0105248_11036632 3300009177 Bacteria 927
252 Ga0105248_11552022 3300009177 Bacteria 750
253 Ga0105248_12054343 3300009177 Unclassified 649
254 Ga0105237_10213937 3300009545 Bacteria 1927
255 Ga0105237_10504184 3300009545 Bacteria 1217
256 Ga0105238_10155484 3300009551 Bacteria 2262
257 Ga0105238_10304346 3300009551 Unclassified 1578
258 Ga0105238_10477572 3300009551 Bacteria 1246
259 Ga0105249_10031359 3300009553 Bacteria 4807
260 Ga0105249_10131720 3300009553 Unclassified 2388
261 Ga0105249_10714102 3300009553 Unclassified 1063
262 Ga0105239_11704893 3300010375 Bacteria 729
263 Ga0105246_10047589 3300011119 Bacteria 2929
264 Ga0105246_10293128 3300011119 Bacteria 1310
265 Ga0157371_10007749 3300013102 Bacteria 8634
266 Ga0157371_10047491 3300013102 Bacteria 3053
267 Ga0157369_10358966 3300013105 Unclassified 1513
268 Ga0157369_10760826 3300013105 Unclassified 996
269 Ga0157369_12471710 3300013105 Bacteria 526
270 Ga0157374_10721347 3300013296 Unclassified 1011
271 Ga0157374_10990862 3300013296 Bacteria 859
272 Ga0157378_10391768 3300013297 Bacteria 1367
273 Ga0163162_10286087 3300013306 Bacteria 1780
274 Ga0163162_10767207 3300013306 Bacteria 1083
275 Ga0157372_10096471 3300013307 Bacteria 3370
276 Ga0157372_10439388 3300013307 Bacteria 1521
277 Ga0157372_10491108 3300013307 Bacteria 1432
278 Ga0157372_10847238 3300013307 Bacteria 1061
279 Ga0157372_10919230 3300013307 Unclassified 1015
280 Ga0157372_12599545 3300013307 Bacteria 581
281 Ga0157375_10010663 3300013308 Bacteria 8094
282 Ga0157375_10064241 3300013308 Bacteria 3654
283 Ga0157375_10245359 3300013308 Bacteria 1951
284 Ga0157375_10266493 3300013308 Unclassified 1875
285 Ga0157375_10876025 3300013308 Bacteria 1043
286 Ga0157375_11214131 3300013308 Unclassified 885
287 Ga0157375_12504930 3300013308 Bacteria 616
288 Ga0163163_10005137 3300014325 Bacteria 11282
289 Ga0163163_10376362 3300014325 Bacteria 1477
290 Ga0163163_10685658 3300014325 Bacteria 1088
291 Ga0163163_11391365 3300014325 Bacteria 763
292 Ga0163163_12939761 3300014325 Unclassified 532
293 Ga0157380_10024401 3300014326 Bacteria 4577
294 Ga0157380_10081761 3300014326 Bacteria 2643
295 Ga0157377_10000839 3300014745 Bacteria 12728
296 Ga0157377_10402085 3300014745 Unclassified 933
297 Ga0157377_10749997 3300014745 Bacteria 714
298 Ga0157379_12042109 3300014968 Bacteria 567
299 Ga0157376_10011794 3300014969 Bacteria 6458
300 Ga0157376_10828504 3300014969 Bacteria 939
301 Ga0157376_10859051 3300014969 Bacteria 923
302 Ga0163161_10083452 3300017792 Bacteria 2355
303 Ga0163161_10290839 3300017792 Bacteria 1284
304 Ga0213875_10461425 3300021388 Bacteria 608
305 Ga0207656_10075212 3300025321 Bacteria 1508
306 Ga0207656_10247428 3300025321 Bacteria 873
307 Ga0207682_10344654 3300025893 Unclassified 701
308 Ga0207642_10732565 3300025899 Bacteria 625
309 Ga0207710_10146760 3300025900 Bacteria 1142
310 Ga0207688_10387038 3300025901 Bacteria 866
311 Ga0207680_10427392 3300025903 Bacteria 938
312 Ga0207680_10497401 3300025903 Unclassified 868
313 Ga0207699_10136911 3300025906 Bacteria 1605
314 Ga0207645_10145098 3300025907 Bacteria 1547
315 Ga0207645_10321884 3300025907 Bacteria 1031
316 Ga0207645_10462387 3300025907 Bacteria 857
317 Ga0207643_10086015 3300025908 Bacteria 1826
318 Ga0207643_10292498 3300025908 Bacteria 1012
319 Ga0207643_10611106 3300025908 Bacteria 702
320 Ga0207654_10199473 3300025911 Bacteria 1317
321 Ga0207707_10010391 3300025912 Bacteria 8078
322 Ga0207707_10043961 3300025912 Bacteria 3895
323 Ga0207707_10073652 3300025912 Bacteria 2978
324 Ga0207707_10147988 3300025912 Bacteria 2053
325 Ga0207707_10273185 3300025912 Bacteria 1465
326 Ga0207707_10367697 3300025912 Unclassified 1238
327 Ga0207707_10452911 3300025912 Bacteria 1098
328 Ga0207693_11183891 3300025915 Bacteria 577
329 Ga0207663_10270529 3300025916 Bacteria 1258
330 Ga0207660_10023251 3300025917 Bacteria 4185
331 Ga0207660_10037631 3300025917 Bacteria 3373
332 Ga0207660_10711198 3300025917 Bacteria 819
333 Ga0207662_10001842 3300025918 Bacteria 10423
334 Ga0207662_10027054 3300025918 Bacteria 3311
335 Ga0207662_10056810 3300025918 Bacteria 2338
336 Ga0207662_10960650 3300025918 Bacteria 606
337 Ga0207657_10020891 3300025919 Bacteria 6179
338 Ga0207657_10073934 3300025919 Unclassified 2879
339 Ga0207657_10422436 3300025919 Bacteria 1048
340 Ga0207649_10009278 3300025920 Bacteria 5381
341 Ga0207649_10033247 3300025920 Bacteria 3080
342 Ga0207649_10582031 3300025920 Bacteria 859
343 Ga0207649_10593421 3300025920 Bacteria 851
344 Ga0207652_10010249 3300025921 Bacteria 7543
345 Ga0207652_10020647 3300025921 Bacteria 5427
346 Ga0207652_10063107 3300025921 Bacteria 3203
347 Ga0207652_10314145 3300025921 Unclassified 1414
348 Ga0207652_10316543 3300025921 Bacteria 1409
349 Ga0207652_10321733 3300025921 Bacteria 1396
350 Ga0207652_10333269 3300025921 Bacteria 1370
351 Ga0207681_10717816 3300025923 Bacteria 832
352 Ga0207681_11797131 3300025923 Unclassified 511
353 Ga0207694_10104348 3300025924 Bacteria 2249
354 Ga0207694_10318769 3300025924 Bacteria 1283
355 Ga0207650_10002232 3300025925 Bacteria 13528
356 Ga0207650_10374887 3300025925 Bacteria 1174
357 Ga0207650_11471734 3300025925 Bacteria 579
358 Ga0207659_10005701 3300025926 Bacteria 7580
359 Ga0207659_10017807 3300025926 Bacteria 4647
360 Ga0207659_10181960 3300025926 Bacteria 1666
361 Ga0207659_10624629 3300025926 Bacteria 919
362 Ga0207687_10425343 3300025927 Bacteria 1097
363 Ga0207644_10333311 3300025931 Bacteria 1229
364 Ga0207690_10094585 3300025932 Bacteria 2120
365 Ga0207706_10091782 3300025933 Bacteria 2670
366 Ga0207706_10141402 3300025933 Bacteria 2117
367 Ga0207686_10079643 3300025934 Bacteria 2134
368 Ga0207686_10378199 3300025934 Bacteria 1073
369 Ga0207686_10473680 3300025934 Bacteria 967
370 Ga0207686_10556807 3300025934 Bacteria 897
371 Ga0207686_10799882 3300025934 Bacteria 756
372 Ga0207686_11179664 3300025934 Bacteria 626
373 Ga0207709_10407761 3300025935 Bacteria 1041
374 Ga0207670_10043069 3300025936 Bacteria 2979
375 Ga0207670_10086725 3300025936 Bacteria 2203
376 Ga0207670_10109331 3300025936 Bacteria 1989
377 Ga0207669_10135574 3300025937 Bacteria 1700
378 Ga0207704_10085135 3300025938 Bacteria 2057
379 Ga0207704_10094086 3300025938 Bacteria 1978
380 Ga0207704_10697792 3300025938 Bacteria 840
381 Ga0207704_11207977 3300025938 Bacteria 645
382 Ga0207691_10168942 3300025940 Bacteria 1916
383 Ga0207691_10438309 3300025940 Bacteria 1112
384 Ga0207691_10785357 3300025940 Bacteria 801
385 Ga0207691_11039575 3300025940 Unclassified 683
386 Ga0207691_11191170 3300025940 Bacteria 632
387 Ga0207711_10084797 3300025941 Bacteria 2774
388 Ga0207711_10086359 3300025941 Bacteria 2751
389 Ga0207711_10090672 3300025941 Bacteria 2687
390 Ga0207711_10403847 3300025941 Bacteria 1270
391 Ga0207711_11001379 3300025941 Bacteria 775
392 Ga0207689_10001224 3300025942 Bacteria 24670
393 Ga0207689_10038589 3300025942 Bacteria 3955
394 Ga0207689_11128317 3300025942 Bacteria 661
395 Ga0207661_10011105 3300025944 Bacteria 6510
396 Ga0207661_10148239 3300025944 Unclassified 2026
397 Ga0207661_10162694 3300025944 Bacteria 1937
398 Ga0207661_10183441 3300025944 Bacteria 1830
399 Ga0207661_10580333 3300025944 Bacteria 1028
400 Ga0207661_11151179 3300025944 Bacteria 714
401 Ga0207679_10003985 3300025945 Bacteria 9172
402 Ga0207679_10019893 3300025945 Bacteria 4522
403 Ga0207679_10023391 3300025945 Bacteria 4225
404 Ga0207679_10241310 3300025945 Unclassified 1531
405 Ga0207679_10286011 3300025945 Bacteria 1416
406 Ga0207679_10315835 3300025945 Bacteria 1351
407 Ga0207679_10442011 3300025945 Bacteria 1152
408 Ga0207679_10578223 3300025945 Bacteria 1010
409 Ga0207667_10687893 3300025949 Bacteria 1026
410 Ga0207712_10057052 3300025961 Bacteria 2753
411 Ga0207668_10811404 3300025972 Bacteria 829
412 Ga0207668_11000273 3300025972 Bacteria 747
413 Ga0207640_11125962 3300025981 Bacteria 695
414 Ga0207658_10061439 3300025986 Bacteria 2808
415 Ga0207658_10421764 3300025986 Bacteria 1177
416 Ga0207658_10475092 3300025986 Bacteria 1110
417 Ga0207658_11327189 3300025986 Bacteria 658
418 Ga0207658_12171896 3300025986 Bacteria 504
419 Ga0207677_10209732 3300026023 Bacteria 1555
420 Ga0207677_10863916 3300026023 Bacteria 814
421 Ga0207677_11189549 3300026023 Bacteria 697
422 Ga0207677_11395706 3300026023 Bacteria 645
423 Ga0207677_11928496 3300026023 Unclassified 549
424 Ga0207703_10256341 3300026035 Bacteria 1579
425 Ga0207703_10468496 3300026035 Bacteria 1179
426 Ga0207678_11817707 3300026067 Bacteria 533
427 Ga0207708_10077774 3300026075 Bacteria 2547
428 Ga0207708_10766770 3300026075 Bacteria 829
429 Ga0207702_10448078 3300026078 Bacteria 1252
430 Ga0207702_10587349 3300026078 Unclassified 1092
431 Ga0207641_10616640 3300026088 Bacteria 1063
432 Ga0207641_11079440 3300026088 Bacteria 801
433 Ga0207641_11454805 3300026088 Bacteria 687
434 Ga0207648_10028818 3300026089 Bacteria 4922
435 Ga0207648_10459543 3300026089 Bacteria 1160
436 Ga0207676_10003636 3300026095 Bacteria 10909
437 Ga0207676_10497953 3300026095 Bacteria 1157
438 Ga0207676_10906070 3300026095 Bacteria 865
439 Ga0207676_10969997 3300026095 Bacteria 836
440 Ga0207676_11773220 3300026095 Bacteria 616
441 Ga0207674_10000394 3300026116 Bacteria 56421
442 Ga0207674_10006676 3300026116 Bacteria 13554
443 Ga0207674_10130684 3300026116 Bacteria 2474
444 Ga0207674_10168694 3300026116 Bacteria 2142
445 Ga0207674_10305111 3300026116 Bacteria 1541
446 Ga0207674_10960990 3300026116 Unclassified 823
447 Ga0207674_11673789 3300026116 Bacteria 604
448 Ga0207675_100242376 3300026118 Bacteria 1742
449 Ga0207683_10061770 3300026121 Bacteria 3298
450 Ga0207683_10444693 3300026121 Bacteria 1195
451 Ga0207683_11345413 3300026121 Bacteria 661
452 Ga0207698_10837596 3300026142 Bacteria 924
453 Ga0207698_11312745 3300026142 Bacteria 738
454 Ga0207428_10132381 3300027907 Bacteria 1907
455 Ga0207428_11253714 3300027907 Bacteria 515
456 Ga0268266_10531015 3300028379 Bacteria 1126
457 Ga0268266_10533721 3300028379 Bacteria 1123
458 Ga0268265_10010077 3300028380 Bacteria 6380
459 Ga0268265_10206517 3300028380 Unclassified 1708
460 Ga0268265_11799124 3300028380 Unclassified 619
461 Ga0316182_1306717 3300030745 Bacteria 617
462 Ga0307408_101022114 3300031548 Bacteria 763
463 Ga0307405_10099939 3300031731 Bacteria 1943
464 Ga0307405_10716918 3300031731 Bacteria 830
465 Ga0307405_11260476 3300031731 Bacteria 642
466 Ga0307413_10538400 3300031824 Bacteria 945
467 Ga0307413_10970167 3300031824 Bacteria 726
468 Ga0307410_10419777 3300031852 Bacteria 1085
469 Ga0307410_11078754 3300031852 Bacteria 695
470 Ga0307410_11436386 3300031852 Bacteria 606
471 Ga0307410_11461286 3300031852 Unclassified 601
472 Ga0307407_10376002 3300031903 Bacteria 1013
473 Ga0307412_11073909 3300031911 Bacteria 715
474 Ga0307409_100347926 3300031995 Bacteria 1397
475 Ga0307409_100382375 3300031995 Unclassified 1339
476 Ga0307409_100545095 3300031995 Unclassified 1138
477 Ga0307416_100565957 3300032002 Bacteria 1212
478 Ga0307414_10540329 3300032004 Bacteria 1037
479 Ga0307414_10611656 3300032004 Bacteria 978
480 Ga0307411_11620321 3300032005 Bacteria 597
481 Ga0307415_100345439 3300032126 Bacteria 1250
482 Ga0307415_100989275 3300032126 Bacteria 781
483 Ga0373926_0006506 3300035083 Unclassified 3878
484 Ga0373944_0011683 3300035089 Bacteria 2409
485 Ga0373923_0245776 3300035111 Bacteria 837
486 Ga0373936_0078687 3300035113 Bacteria 1369
487 Ga0373945_0019274 3300035116 Bacteria 2328
488 Ga0373954_0093755 3300035118 Bacteria 1444
489 Ga0373956_0035157 3300035119 Bacteria 2209
490 Ga0373957_0123287 3300035120 Bacteria 1050
491 Ga0373960_0380476 3300035121 Unclassified 541
492 Ga0373943_0019920 3300035170 Bacteria 3090
493 Ga0373946_0054015 3300035171 Bacteria 1689
494 Ga0373955_0153702 3300035172 Bacteria 1355
495 Ga0373955_0774620 3300035172 Unclassified 589
496 Ga0373931_0056360 3300035691 Bacteria 2105
497 Ga0373931_0910652 3300035691 Bacteria 591
498 Ga0373935_0383147 3300035692 Bacteria 1007
499 Ga0373927_0037180 3300035695 Bacteria 3165
500 Ga0373933_0016869 3300035724 Bacteria 4092
501 Ga0373937_0003144 3300036401 Bacteria 13817
502 Ga0373937_0946075 3300036401 Bacteria 810
503 Ga0373925_0075295 3300037068 Bacteria 2557
504 Ga0395899_0883901 3300037312 Bacteria 546
505 Ga0395898_0855404 3300037466 Bacteria 849
506 Ga0395905_0014873 3300037471 Bacteria 7424
507 Ga0436364_1326811 3300037853 Unclassified 822
508 Ga0436364_1538124 3300037853 Bacteria 620
509 Ga0436365_0332039 3300039437 Bacteria 813
510 Ga0436365_0903494 3300039437 Bacteria 4671
511 Ga0436365_1658826 3300039437 Bacteria 2638
512 Ga0436365_1712124 3300039437 Bacteria 505
513 Ga0439439_0078607 3300041406 Bacteria 890
514 Ga0439433_0038658 3300041999 Bacteria 1107
515 Ga0466957_0627944 3300044842 Bacteria 754
516 Ga0451576_0265703 3300045051 Unclassified 1794
517 Ga0451576_0568451 3300045051 Bacteria 1191
518 Ga0466967_0202025 3300045976 Bacteria 1883
519 Ga0466967_1046235 3300045976 Bacteria 813
520 Ga0466967_1613402 3300045976 Unclassified 646
521 Ga0495629_0003877 3300046459 Bacteria 11273
522 Ga0495629_0026059 3300046459 Bacteria 4155
523 Ga0495638_0140170 3300046460 Bacteria 1412
524 Ga0495580_0129139 3300046472 Bacteria 1753
525 Ga0495582_0002255 3300046473 Bacteria 10786
526 Ga0495582_0006491 3300046473 Bacteria 6491
527 Ga0495639_0004673 3300046475 Bacteria 5881
528 Ga0495630_0001254 3300046517 Bacteria 17515
529 Ga0495652_0026933 3300046529 Bacteria 5071
530 Ga0495652_0196209 3300046529 Bacteria 1536
531 Ga0495665_0002999 3300046531 Bacteria 9120
532 Ga0495665_0148023 3300046531 Bacteria 1226
533 Ga0495587_0010185 3300046536 Bacteria 5994
534 Ga0495587_0146951 3300046536 Bacteria 1344
535 Ga0495598_0071128 3300046537 Unclassified 1096
536 Ga0495645_0023787 3300046543 Bacteria 4440
537 Ga0495667_0013948 3300046559 Bacteria 5426
538 Ga0495634_0601640 3300046642 Bacteria 638
539 Ga0495588_0140397 3300046674 Bacteria 1276
540 Ga0495588_0370394 3300046674 Bacteria 752
541 Ga0495599_0014419 3300046678 Bacteria 4894
542 Ga0495623_0014399 3300046679 Bacteria 5119
543 Ga0495658_0001632 3300046683 Bacteria 11659
544 Ga0495658_0935058 3300046683 Bacteria 554
545 Ga0495669_0197726 3300046684 Bacteria 960
546 Ga0495613_0009300 3300046689 Bacteria 7291
547 Ga0495670_0080203 3300046691 Bacteria 1662
548 Ga0495600_0090673 3300046809 Bacteria 1994
549 Ga0495581_0001399 3300047315 Bacteria 13344
550 Ga0495581_0497897 3300047315 Bacteria 708
551 Ga0495675_0047806 3300047444 Bacteria 2722
552 Ga0495684_0637605 3300047471 Bacteria 714
553 Ga0495593_0001390 3300047673 Bacteria 14168
554 Ga0495614_0000448 3300048089 Bacteria 16899
555 Ga0496104_0120976 3300048907 Bacteria 2514
556 Ga0496105_1127983 3300048908 Bacteria 581
557 Ga0496106_0491328 3300048909 Bacteria 986
558 Ga0496108_0031264 3300048911 Bacteria 4416
559 Ga0496108_0788912 3300048911 Bacteria 820
560 Ga0496109_1376888 3300048912 Bacteria 641
561 Ga0496111_0224052 3300048914 Unclassified 1397
562 Ga0496112_0002500 3300048915 Bacteria 14829
563 Ga0496112_0685557 3300048915 Bacteria 953
564 Ga0496113_0509129 3300048916 Bacteria 966
565 Ga0501297_056842 3300049520 Bacteria 589
566 Ga0501039_0218488 3300049575 Unclassified 1499
567 Ga0501040_0071152 3300049576 Unclassified 2401
568 Ga0501041_0065335 3300049577 Unclassified 2229
569 Ga0501042_0026256 3300049578 Bacteria 4094
570 Ga0501048_0068596 3300049582 Unclassified 2505
571 Ga0501071_0652538 3300049587 Bacteria 810
572 Ga0501072_1521465 3300049588 Unclassified 516
573 Ga0501073_1287659 3300049589 Unclassified 501
574 Ga0501075_0052923 3300049591 Unclassified 3053
575 Ga0501077_0436791 3300049593 Unclassified 838
576 Ga0501242_072049 3300049674 Bacteria 543
577 Ga0501259_130539 3300049688 Bacteria 606
578 Ga0501079_0039644 3300049741 Unclassified 3633
579 Ga0501079_0412289 3300049741 Bacteria 1060
580 Ga0501080_0790075 3300049742 Bacteria 833
581 Ga0501081_0030883 3300049743 Unclassified 3630
582 Ga0501081_0045593 3300049743 Bacteria 3011
583 Ga0501083_0551757 3300049744 Unclassified 750
584 Ga0501268_030357 3300049765 Bacteria 975
585 Ga0501269_037489 3300049766 Bacteria 638
586 Ga0501045_0041609 3300049824 Bacteria 3343
587 nmdc:mga06z11_105101_c1 3300050494 Unclassified 1555
588 nmdc:mga05p37_103157_c1 3300050507 Bacteria 3511
589 nmdc:mga05p37_181581_c1 3300050507 Bacteria 2559
590 nmdc:mga05p37_344200_c1 3300050507 Bacteria 1757
591 nmdc:mga09592_131205_c1 3300050508 Bacteria 2156
592 nmdc:mga09592_25009_c1 3300050508 Bacteria 4940
593 nmdc:mga0qj67_287285_c1 3300050509 Unclassified 1333
594 nmdc:mga0qj67_828125_c1 3300050509 Bacteria 732
595 nmdc:mga06r32_394734_c1 3300050510 Bacteria 1366
596 nmdc:mga08y16_55486_c1 3300050511 Bacteria 4139
597 nmdc:mga0n895_330717_c1 3300050512 Unclassified 1544
598 nmdc:mga0n895_557866_c1 3300050512 Bacteria 1151
599 Ga0495595_0642300 3300053084 Bacteria 543
600 Ga0500596_080974 3300053735 Bacteria 565
601 Ga0501084_0414800 3300054114 Bacteria 1138
602 Ga0501084_1427637 3300054114 Bacteria 580
603 Ga0590071_119630 3300059421 Bacteria 672
604 Ga0501082_0103629 3300060353 Unclassified 2461
605 Ga0530510_0083132 3300061734 Bacteria 2332

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005341 Ga0070691_10939351 Ga0070691_109393511 96
2 3300009094 Ga0111539_10115559 Ga0111539_101155593 96
3 3300009148 Ga0105243_11069245 Ga0105243_110692452 96
4 3300009177 Ga0105248_10844042 Ga0105248_108440421 96
5 3300009553 Ga0105249_10031359 Ga0105249_100313593 96
6 3300013308 Ga0157375_10010663 Ga0157375_100106632 96
7 3300014326 Ga0157380_10024401 Ga0157380_100244012 96
8 3300026095 Ga0207676_11773220 Ga0207676_117732201 101
9 3300006844 Ga0075428_100022057 Ga0075428_1000220574 103
10 3300006844 Ga0075428_102468747 Ga0075428_1024687471 103
11 3300009147 Ga0114129_11877327 Ga0114129_118773272 103
12 3300009147 Ga0114129_12294165 Ga0114129_122941652 103
13 3300046536 Ga0495587_0146951 Ga0495587_0146951_1018_1329 103
14 3300049593 Ga0501077_0436791 Ga0501077_0436791_292_603 103
15 3300049743 Ga0501081_0045593 Ga0501081_0045593_1412_1723 103
16 3300050507 nmdc:mga05p37_344200_c1 nmdc:mga05p37_344200_c1_51_362 103
17 3300054114 Ga0501084_0414800 Ga0501084_0414800_31_342 103
18 3300061734 Ga0530510_0083132 Ga0530510_0083132_1383_1694 103
19 3300005364 Ga0070673_100128225 Ga0070673_1001282252 107
20 3300005365 Ga0070688_100156501 Ga0070688_1001565013 107
21 3300005367 Ga0070667_100517931 Ga0070667_1005179312 107
22 3300005548 Ga0070665_101783690 Ga0070665_1017836902 107
23 3300005617 Ga0068859_100544055 Ga0068859_1005440552 107
24 3300005618 Ga0068864_101923877 Ga0068864_1019238771 107
25 3300005840 Ga0068870_10390273 Ga0068870_103902732 107
26 3300005841 Ga0068863_100839653 Ga0068863_1008396532 107
27 3300006931 Ga0097620_100544096 Ga0097620_1005440962 107
28 3300009176 Ga0105242_11463834 Ga0105242_114638341 107
29 3300013308 Ga0157375_10876025 Ga0157375_108760252 107
30 3300014745 Ga0157377_10402085 Ga0157377_104020852 107
31 3300025942 Ga0207689_11128317 Ga0207689_111283171 107
32 3300025972 Ga0207668_10811404 Ga0207668_108114042 107
33 3300025986 Ga0207658_10421764 Ga0207658_104217642 107
34 3300026088 Ga0207641_11079440 Ga0207641_110794402 107
35 3300035111 Ga0373923_0245776 Ga0373923_0245776_371_703 107
36 3300035118 Ga0373954_0093755 Ga0373954_0093755_535_867 107
37 3300035119 Ga0373956_0035157 Ga0373956_0035157_1189_1521 107
38 3300035120 Ga0373957_0123287 Ga0373957_0123287_556_888 107
39 3300035172 Ga0373955_0153702 Ga0373955_0153702_711_1043 107
40 3300035724 Ga0373933_0016869 Ga0373933_0016869_3596_3928 107
41 3300036401 Ga0373937_0003144 Ga0373937_0003144_9738_10070 107
42 3300046529 Ga0495652_0026933 Ga0495652_0026933_485_817 107
43 3300046536 Ga0495587_0010185 Ga0495587_0010185_1891_2223 107
44 3300046543 Ga0495645_0023787 Ga0495645_0023787_4021_4353 107
45 3300046559 Ga0495667_0013948 Ga0495667_0013948_1041_1373 107
46 3300046678 Ga0495599_0014419 Ga0495599_0014419_777_1109 107
47 3300046679 Ga0495623_0014399 Ga0495623_0014399_4111_4443 107
48 3300046809 Ga0495600_0090673 Ga0495600_0090673_1550_1882 107
49 3300047444 Ga0495675_0047806 Ga0495675_0047806_1863_2195 107
50 3300047471 Ga0495684_0637605 Ga0495684_0637605_121_453 107
51 3300053084 Ga0495595_0642300 Ga0495595_0642300_90_422 107
52 3300005471 Ga0070698_100238685 Ga0070698_1002386852 108
53 3300025940 Ga0207691_10438309 Ga0207691_104383092 108
54 3300005327 Ga0070658_10507288 Ga0070658_105072881 109
55 3300005329 Ga0070683_100550580 Ga0070683_1005505802 109
56 3300005330 Ga0070690_100030192 Ga0070690_1000301922 109
57 3300005331 Ga0070670_100054671 Ga0070670_1000546712 109
58 3300005334 Ga0068869_101885675 Ga0068869_1018856751 109
59 3300005335 Ga0070666_10332604 Ga0070666_103326042 109
60 3300005335 Ga0070666_10563851 Ga0070666_105638512 109
61 3300005336 Ga0070680_100365025 Ga0070680_1003650253 109
62 3300005337 Ga0070682_100133844 Ga0070682_1001338442 109
63 3300005339 Ga0070660_100071410 Ga0070660_1000714101 109
64 3300005340 Ga0070689_100014037 Ga0070689_1000140372 109
65 3300005340 Ga0070689_100301854 Ga0070689_1003018541 109
66 3300005343 Ga0070687_100031001 Ga0070687_1000310012 109
67 3300005344 Ga0070661_100003510 Ga0070661_1000035105 109
68 3300005344 Ga0070661_101136032 Ga0070661_1011360321 109
69 3300005345 Ga0070692_10281849 Ga0070692_102818492 109
70 3300005347 Ga0070668_101073635 Ga0070668_1010736351 109
71 3300005354 Ga0070675_100019195 Ga0070675_1000191953 109
72 3300005364 Ga0070673_100045583 Ga0070673_1000455832 109
73 3300005365 Ga0070688_100208587 Ga0070688_1002085872 109
74 3300005366 Ga0070659_100021345 Ga0070659_1000213452 109
75 3300005458 Ga0070681_10023567 Ga0070681_100235672 109
76 3300005458 Ga0070681_10053917 Ga0070681_100539172 109
77 3300005459 Ga0068867_101365879 Ga0068867_1013658791 109
78 3300005466 Ga0070685_10732072 Ga0070685_107320721 109
79 3300005468 Ga0070707_100600347 Ga0070707_1006003471 109
80 3300005530 Ga0070679_100302910 Ga0070679_1003029102 109
81 3300005530 Ga0070679_100762621 Ga0070679_1007626211 109
82 3300005535 Ga0070684_100009702 Ga0070684_1000097025 109
83 3300005543 Ga0070672_100412728 Ga0070672_1004127282 109
84 3300005544 Ga0070686_100860422 Ga0070686_1008604221 109
85 3300005577 Ga0068857_100050063 Ga0068857_1000500633 109
86 3300005614 Ga0068856_100889628 Ga0068856_1008896281 109
87 3300005616 Ga0068852_100896706 Ga0068852_1008967061 109
88 3300005617 Ga0068859_100068612 Ga0068859_1000686121 109
89 3300005618 Ga0068864_100642562 Ga0068864_1006425622 109
90 3300005834 Ga0068851_10027563 Ga0068851_100275632 109
91 3300005840 Ga0068870_10095415 Ga0068870_100954152 109
92 3300005842 Ga0068858_100142831 Ga0068858_1001428312 109
93 3300005843 Ga0068860_102052268 Ga0068860_1020522682 109
94 3300006237 Ga0097621_100715762 Ga0097621_1007157622 109
95 3300006844 Ga0075428_100200113 Ga0075428_1002001133 109
96 3300006847 Ga0075431_100105725 Ga0075431_1001057253 109
97 3300006871 Ga0075434_100013484 Ga0075434_1000134843 109
98 3300006881 Ga0068865_100434577 Ga0068865_1004345772 109
99 3300006931 Ga0097620_100068610 Ga0097620_1000686101 109
100 3300007076 Ga0075435_100812627 Ga0075435_1008126272 109
101 3300009148 Ga0105243_10584989 Ga0105243_105849892 109
102 3300009176 Ga0105242_10716290 Ga0105242_107162902 109
103 3300009177 Ga0105248_10900805 Ga0105248_109008052 109
104 3300013308 Ga0157375_12504930 Ga0157375_125049301 109
105 3300017792 Ga0163161_10290839 Ga0163161_102908392 109
106 3300025908 Ga0207643_10292498 Ga0207643_102924981 109
107 3300025912 Ga0207707_10010391 Ga0207707_100103912 109
108 3300025912 Ga0207707_10273185 Ga0207707_102731852 109
109 3300025918 Ga0207662_10001842 Ga0207662_100018426 109
110 3300025919 Ga0207657_10073934 Ga0207657_100739341 109
111 3300025920 Ga0207649_10009278 Ga0207649_100092783 109
112 3300025921 Ga0207652_10316543 Ga0207652_103165432 109
113 3300025921 Ga0207652_10333269 Ga0207652_103332692 109
114 3300025925 Ga0207650_10002232 Ga0207650_100022327 109
115 3300025926 Ga0207659_10017807 Ga0207659_100178072 109
116 3300025932 Ga0207690_10094585 Ga0207690_100945852 109
117 3300025936 Ga0207670_10109331 Ga0207670_101093311 109
118 3300025938 Ga0207704_10697792 Ga0207704_106977921 109
119 3300025941 Ga0207711_10084797 Ga0207711_100847972 109
120 3300025941 Ga0207711_11001379 Ga0207711_110013792 109
121 3300025944 Ga0207661_10162694 Ga0207661_101626942 109
122 3300025945 Ga0207679_10003985 Ga0207679_100039852 109
123 3300025972 Ga0207668_11000273 Ga0207668_110002732 109
124 3300025981 Ga0207640_11125962 Ga0207640_111259622 109
125 3300025986 Ga0207658_10475092 Ga0207658_104750922 109
126 3300026035 Ga0207703_10256341 Ga0207703_102563412 109
127 3300026078 Ga0207702_10587349 Ga0207702_105873492 109
128 3300026088 Ga0207641_11454805 Ga0207641_114548052 109
129 3300026095 Ga0207676_10969997 Ga0207676_109699972 109
130 3300026116 Ga0207674_10000394 Ga0207674_100003943 109
131 3300026142 Ga0207698_10837596 Ga0207698_108375961 109
132 3300031903 Ga0307407_10376002 Ga0307407_103760022 109
133 3300031995 Ga0307409_100545095 Ga0307409_1005450952 109
134 3300037853 Ga0436364_1326811 Ga0436364_1326811_404_748 109
135 3300039437 Ga0436365_0903494 Ga0436365_0903494_1795_2139 109
136 3300039437 Ga0436365_1712124 Ga0436365_1712124_18_362 109
137 3300046529 Ga0495652_0196209 Ga0495652_0196209_185_517 109
138 3300046691 Ga0495670_0080203 Ga0495670_0080203_213_542 109
139 3300048911 Ga0496108_0788912 Ga0496108_0788912_372_701 109
140 3300048912 Ga0496109_1376888 Ga0496109_1376888_260_589 109
141 3300048915 Ga0496112_0685557 Ga0496112_0685557_368_697 109
142 3300005439 Ga0070711_100742921 Ga0070711_1007429212 110
143 3300005458 Ga0070681_10718209 Ga0070681_107182092 110
144 3300014325 Ga0163163_10685658 Ga0163163_106856582 110
145 3300025912 Ga0207707_10452911 Ga0207707_104529112 110
146 3300025916 Ga0207663_10270529 Ga0207663_102705291 110
147 3300035172 Ga0373955_0774620 Ga0373955_0774620_38_370 110
148 3300036401 Ga0373937_0946075 Ga0373937_0946075_65_406 110
149 3300046459 Ga0495629_0003877 Ga0495629_0003877_4519_4860 110
150 3300046473 Ga0495582_0006491 Ga0495582_0006491_44_385 110
151 3300046531 Ga0495665_0148023 Ga0495665_0148023_621_962 110
152 3300046642 Ga0495634_0601640 Ga0495634_0601640_293_625 110
153 3300046683 Ga0495658_0935058 Ga0495658_0935058_180_521 110
154 3300049741 Ga0501079_0412289 Ga0501079_0412289_588_920 110
155 3300053735 Ga0500596_080974 Ga0500596_080974_188_526 110
156 3300005288 Ga0065714_10334836 Ga0065714_103348361 111
157 3300005290 Ga0065712_10150657 Ga0065712_101506572 111
158 3300005328 Ga0070676_10986139 Ga0070676_109861391 111
159 3300005329 Ga0070683_100000397 Ga0070683_10000039710 111
160 3300005329 Ga0070683_100118677 Ga0070683_1001186772 111
161 3300005329 Ga0070683_100128940 Ga0070683_1001289402 111
162 3300005329 Ga0070683_100186309 Ga0070683_1001863092 111
163 3300005329 Ga0070683_100491843 Ga0070683_1004918432 111
164 3300005329 Ga0070683_100784860 Ga0070683_1007848602 111
165 3300005330 Ga0070690_100011574 Ga0070690_1000115743 111
166 3300005330 Ga0070690_100022311 Ga0070690_1000223112 111
167 3300005331 Ga0070670_100008704 Ga0070670_1000087042 111
168 3300005331 Ga0070670_100443381 Ga0070670_1004433812 111
169 3300005331 Ga0070670_101210081 Ga0070670_1012100811 111
170 3300005331 Ga0070670_101229458 Ga0070670_1012294581 111
171 3300005333 Ga0070677_10742518 Ga0070677_107425181 111
172 3300005334 Ga0068869_100012820 Ga0068869_1000128201 111
173 3300005334 Ga0068869_100084552 Ga0068869_1000845522 111
174 3300005335 Ga0070666_10642669 Ga0070666_106426692 111
175 3300005335 Ga0070666_10695871 Ga0070666_106958712 111
176 3300005336 Ga0070680_100145278 Ga0070680_1001452782 111
177 3300005336 Ga0070680_100182186 Ga0070680_1001821862 111
178 3300005337 Ga0070682_100002879 Ga0070682_10000287910 111
179 3300005337 Ga0070682_100192666 Ga0070682_1001926662 111
180 3300005338 Ga0068868_100376293 Ga0068868_1003762932 111
181 3300005338 Ga0068868_101251479 Ga0068868_1012514792 111
182 3300005339 Ga0070660_100105209 Ga0070660_1001052092 111
183 3300005340 Ga0070689_100043089 Ga0070689_1000430893 111
184 3300005343 Ga0070687_100258414 Ga0070687_1002584141 111
185 3300005344 Ga0070661_100032444 Ga0070661_1000324445 111
186 3300005345 Ga0070692_10146398 Ga0070692_101463982 111
187 3300005347 Ga0070668_100196206 Ga0070668_1001962062 111
188 3300005353 Ga0070669_100345512 Ga0070669_1003455122 111
189 3300005353 Ga0070669_100890319 Ga0070669_1008903192 111
190 3300005353 Ga0070669_101982180 Ga0070669_1019821801 111
191 3300005354 Ga0070675_100156897 Ga0070675_1001568972 111
192 3300005354 Ga0070675_100174951 Ga0070675_1001749511 111
193 3300005354 Ga0070675_100282922 Ga0070675_1002829222 111
194 3300005354 Ga0070675_100370794 Ga0070675_1003707942 111
195 3300005354 Ga0070675_100457091 Ga0070675_1004570911 111
196 3300005354 Ga0070675_100569405 Ga0070675_1005694052 111
197 3300005354 Ga0070675_102094061 Ga0070675_1020940612 111
198 3300005355 Ga0070671_100403031 Ga0070671_1004030312 111
199 3300005355 Ga0070671_101436784 Ga0070671_1014367841 111
200 3300005356 Ga0070674_101668657 Ga0070674_1016686571 111
201 3300005364 Ga0070673_100361329 Ga0070673_1003613292 111
202 3300005364 Ga0070673_100599368 Ga0070673_1005993682 111
203 3300005365 Ga0070688_101334432 Ga0070688_1013344321 111
204 3300005366 Ga0070659_100032698 Ga0070659_1000326982 111
205 3300005366 Ga0070659_100054972 Ga0070659_1000549721 111
206 3300005367 Ga0070667_100052574 Ga0070667_1000525742 111
207 3300005367 Ga0070667_100393735 Ga0070667_1003937352 111
208 3300005367 Ga0070667_101400693 Ga0070667_1014006931 111
209 3300005406 Ga0070703_10289507 Ga0070703_102895071 111
210 3300005435 Ga0070714_102510790 Ga0070714_1025107901 111
211 3300005437 Ga0070710_10827708 Ga0070710_108277081 111
212 3300005438 Ga0070701_10147152 Ga0070701_101471522 111
213 3300005441 Ga0070700_100805666 Ga0070700_1008056662 111
214 3300005444 Ga0070694_100672240 Ga0070694_1006722401 111
215 3300005455 Ga0070663_102142797 Ga0070663_1021427971 111
216 3300005456 Ga0070678_100357791 Ga0070678_1003577912 111
217 3300005456 Ga0070678_101207024 Ga0070678_1012070241 111
218 3300005457 Ga0070662_100039730 Ga0070662_1000397302 111
219 3300005457 Ga0070662_100146976 Ga0070662_1001469763 111
220 3300005458 Ga0070681_10005421 Ga0070681_100054217 111
221 3300005458 Ga0070681_10014161 Ga0070681_100141615 111
222 3300005458 Ga0070681_10035575 Ga0070681_100355756 111
223 3300005458 Ga0070681_10062326 Ga0070681_100623262 111
224 3300005458 Ga0070681_10124064 Ga0070681_101240642 111
225 3300005459 Ga0068867_100872029 Ga0068867_1008720291 111
226 3300005459 Ga0068867_100920778 Ga0068867_1009207782 111
227 3300005466 Ga0070685_10094419 Ga0070685_100944192 111
228 3300005466 Ga0070685_10113558 Ga0070685_101135582 111
229 3300005530 Ga0070679_100027827 Ga0070679_1000278278 111
230 3300005530 Ga0070679_100135487 Ga0070679_1001354871 111
231 3300005530 Ga0070679_100196255 Ga0070679_1001962552 111
232 3300005530 Ga0070679_100608202 Ga0070679_1006082022 111
233 3300005530 Ga0070679_100956427 Ga0070679_1009564271 111
234 3300005535 Ga0070684_100002124 Ga0070684_1000021246 111
235 3300005535 Ga0070684_100021443 Ga0070684_1000214432 111
236 3300005535 Ga0070684_100069824 Ga0070684_1000698242 111
237 3300005535 Ga0070684_100073445 Ga0070684_1000734452 111
238 3300005535 Ga0070684_100163363 Ga0070684_1001633632 111
239 3300005543 Ga0070672_100080941 Ga0070672_1000809412 111
240 3300005543 Ga0070672_100123371 Ga0070672_1001233712 111
241 3300005543 Ga0070672_100757868 Ga0070672_1007578682 111
242 3300005543 Ga0070672_100819076 Ga0070672_1008190762 111
243 3300005544 Ga0070686_100373998 Ga0070686_1003739983 111
244 3300005546 Ga0070696_100000091 Ga0070696_10000009130 111
245 3300005547 Ga0070693_100005288 Ga0070693_1000052886 111
246 3300005547 Ga0070693_100054905 Ga0070693_1000549052 111
247 3300005547 Ga0070693_100094296 Ga0070693_1000942962 111
248 3300005547 Ga0070693_100189337 Ga0070693_1001893372 111
249 3300005548 Ga0070665_100480897 Ga0070665_1004808972 111
250 3300005563 Ga0068855_102541746 Ga0068855_1025417461 111
251 3300005564 Ga0070664_100040858 Ga0070664_1000408583 111
252 3300005564 Ga0070664_100044326 Ga0070664_1000443263 111
253 3300005564 Ga0070664_100084312 Ga0070664_1000843122 111
254 3300005564 Ga0070664_100113459 Ga0070664_1001134592 111
255 3300005564 Ga0070664_100117072 Ga0070664_1001170722 111
256 3300005577 Ga0068857_100012441 Ga0068857_1000124412 111
257 3300005577 Ga0068857_100081828 Ga0068857_1000818282 111
258 3300005577 Ga0068857_100284974 Ga0068857_1002849742 111
259 3300005577 Ga0068857_100694042 Ga0068857_1006940422 111
260 3300005577 Ga0068857_102528520 Ga0068857_1025285201 111
261 3300005578 Ga0068854_102045710 Ga0068854_1020457102 111
262 3300005614 Ga0068856_100098099 Ga0068856_1000980992 111
263 3300005615 Ga0070702_101056571 Ga0070702_1010565711 111
264 3300005616 Ga0068852_100057164 Ga0068852_1000571642 111
265 3300005616 Ga0068852_102099570 Ga0068852_1020995701 111
266 3300005617 Ga0068859_100012899 Ga0068859_1000128999 111
267 3300005617 Ga0068859_101103483 Ga0068859_1011034832 111
268 3300005617 Ga0068859_101209848 Ga0068859_1012098482 111
269 3300005618 Ga0068864_100145945 Ga0068864_1001459451 111
270 3300005618 Ga0068864_100274761 Ga0068864_1002747612 111
271 3300005618 Ga0068864_102499530 Ga0068864_1024995301 111
272 3300005718 Ga0068866_10169061 Ga0068866_101690611 111
273 3300005719 Ga0068861_100209594 Ga0068861_1002095942 111
274 3300005719 Ga0068861_101418634 Ga0068861_1014186342 111
275 3300005719 Ga0068861_102018286 Ga0068861_1020182862 111
276 3300005834 Ga0068851_10389920 Ga0068851_103899201 111
277 3300005840 Ga0068870_10023943 Ga0068870_100239432 111
278 3300005840 Ga0068870_10067451 Ga0068870_100674514 111
279 3300005840 Ga0068870_10326050 Ga0068870_103260502 111
280 3300005840 Ga0068870_10490680 Ga0068870_104906801 111
281 3300005841 Ga0068863_100085116 Ga0068863_1000851162 111
282 3300005841 Ga0068863_100580198 Ga0068863_1005801981 111
283 3300005842 Ga0068858_100013502 Ga0068858_1000135022 111
284 3300005842 Ga0068858_101691433 Ga0068858_1016914331 111
285 3300005843 Ga0068860_100161200 Ga0068860_1001612001 111
286 3300005843 Ga0068860_101028858 Ga0068860_1010288582 111
287 3300005844 Ga0068862_100022773 Ga0068862_1000227732 111
288 3300005844 Ga0068862_100055358 Ga0068862_1000553582 111
289 3300005937 Ga0081455_10155791 Ga0081455_101557913 111
290 3300006178 Ga0075367_10017173 Ga0075367_100171732 111
291 3300006237 Ga0097621_100070749 Ga0097621_1000707496 111
292 3300006237 Ga0097621_100903686 Ga0097621_1009036862 111
293 3300006358 Ga0068871_100027068 Ga0068871_1000270682 111
294 3300006358 Ga0068871_100981580 Ga0068871_1009815801 111
295 3300006844 Ga0075428_100052361 Ga0075428_1000523614 111
296 3300006846 Ga0075430_100376347 Ga0075430_1003763472 111
297 3300006847 Ga0075431_100038235 Ga0075431_1000382352 111
298 3300006852 Ga0075433_10747488 Ga0075433_107474881 111
299 3300006871 Ga0075434_100335165 Ga0075434_1003351652 111
300 3300006871 Ga0075434_100499355 Ga0075434_1004993552 111
301 3300006871 Ga0075434_100618975 Ga0075434_1006189752 111
302 3300006880 Ga0075429_100004287 Ga0075429_1000042874 111
303 3300006880 Ga0075429_100022694 Ga0075429_1000226942 111
304 3300006880 Ga0075429_101597988 Ga0075429_1015979881 111
305 3300006881 Ga0068865_100190954 Ga0068865_1001909542 111
306 3300006881 Ga0068865_100592729 Ga0068865_1005927292 111
307 3300006881 Ga0068865_100598421 Ga0068865_1005984212 111
308 3300006881 Ga0068865_100931579 Ga0068865_1009315792 111
309 3300006931 Ga0097620_100012901 Ga0097620_1000129019 111
310 3300006931 Ga0097620_101103529 Ga0097620_1011035292 111
311 3300006931 Ga0097620_101127150 Ga0097620_1011271501 111
312 3300006931 Ga0097620_101209893 Ga0097620_1012098932 111
313 3300009094 Ga0111539_10392128 Ga0111539_103921281 111
314 3300009094 Ga0111539_10795929 Ga0111539_107959292 111
315 3300009094 Ga0111539_11345017 Ga0111539_113450172 111
316 3300009098 Ga0105245_10006625 Ga0105245_1000662511 111
317 3300009098 Ga0105245_10175458 Ga0105245_101754582 111
318 3300009098 Ga0105245_10211751 Ga0105245_102117512 111
319 3300009098 Ga0105245_10294318 Ga0105245_102943183 111
320 3300009098 Ga0105245_10964767 Ga0105245_109647671 111
321 3300009098 Ga0105245_11904924 Ga0105245_119049241 111
322 3300009101 Ga0105247_10446550 Ga0105247_104465502 111
323 3300009101 Ga0105247_10715659 Ga0105247_107156592 111
324 3300009101 Ga0105247_11403825 Ga0105247_114038252 111
325 3300009147 Ga0114129_10085612 Ga0114129_100856122 111
326 3300009147 Ga0114129_10310051 Ga0114129_103100512 111
327 3300009148 Ga0105243_10082332 Ga0105243_100823322 111
328 3300009148 Ga0105243_12484387 Ga0105243_124843871 111
329 3300009174 Ga0105241_10003972 Ga0105241_1000397215 111
330 3300009174 Ga0105241_10609190 Ga0105241_106091902 111
331 3300009176 Ga0105242_10085925 Ga0105242_100859253 111
332 3300009176 Ga0105242_10243769 Ga0105242_102437692 111
333 3300009176 Ga0105242_11369293 Ga0105242_113692932 111
334 3300009177 Ga0105248_10197420 Ga0105248_101974202 111
335 3300009177 Ga0105248_11036632 Ga0105248_110366322 111
336 3300009177 Ga0105248_11552022 Ga0105248_115520222 111
337 3300009177 Ga0105248_12054343 Ga0105248_120543432 111
338 3300009545 Ga0105237_10213937 Ga0105237_102139372 111
339 3300009545 Ga0105237_10504184 Ga0105237_105041841 111
340 3300009551 Ga0105238_10155484 Ga0105238_101554842 111
341 3300009551 Ga0105238_10304346 Ga0105238_103043463 111
342 3300009551 Ga0105238_10477572 Ga0105238_104775722 111
343 3300009553 Ga0105249_10131720 Ga0105249_101317202 111
344 3300009553 Ga0105249_10714102 Ga0105249_107141021 111
345 3300010375 Ga0105239_11704893 Ga0105239_117048932 111
346 3300011119 Ga0105246_10047589 Ga0105246_100475892 111
347 3300011119 Ga0105246_10293128 Ga0105246_102931282 111
348 3300013102 Ga0157371_10007749 Ga0157371_1000774911 111
349 3300013102 Ga0157371_10047491 Ga0157371_100474913 111
350 3300013105 Ga0157369_10358966 Ga0157369_103589661 111
351 3300013105 Ga0157369_10760826 Ga0157369_107608262 111
352 3300013105 Ga0157369_12471710 Ga0157369_124717101 111
353 3300013296 Ga0157374_10721347 Ga0157374_107213471 111
354 3300013296 Ga0157374_10990862 Ga0157374_109908622 111
355 3300013297 Ga0157378_10391768 Ga0157378_103917682 111
356 3300013306 Ga0163162_10286087 Ga0163162_102860872 111
357 3300013306 Ga0163162_10767207 Ga0163162_107672072 111
358 3300013307 Ga0157372_10096471 Ga0157372_100964712 111
359 3300013307 Ga0157372_10439388 Ga0157372_104393881 111
360 3300013307 Ga0157372_10491108 Ga0157372_104911081 111
361 3300013307 Ga0157372_10847238 Ga0157372_108472381 111
362 3300013307 Ga0157372_10919230 Ga0157372_109192302 111
363 3300013307 Ga0157372_12599545 Ga0157372_125995452 111
364 3300013308 Ga0157375_10064241 Ga0157375_100642412 111
365 3300013308 Ga0157375_10245359 Ga0157375_102453592 111
366 3300013308 Ga0157375_10266493 Ga0157375_102664932 111
367 3300013308 Ga0157375_11214131 Ga0157375_112141312 111
368 3300014325 Ga0163163_10005137 Ga0163163_100051372 111
369 3300014325 Ga0163163_10376362 Ga0163163_103763622 111
370 3300014325 Ga0163163_11391365 Ga0163163_113913651 111
371 3300014325 Ga0163163_12939761 Ga0163163_129397611 111
372 3300014326 Ga0157380_10081761 Ga0157380_100817611 111
373 3300014745 Ga0157377_10000839 Ga0157377_1000083912 111
374 3300014745 Ga0157377_10749997 Ga0157377_107499972 111
375 3300014968 Ga0157379_12042109 Ga0157379_120421092 111
376 3300014969 Ga0157376_10011794 Ga0157376_100117942 111
377 3300014969 Ga0157376_10828504 Ga0157376_108285042 111
378 3300014969 Ga0157376_10859051 Ga0157376_108590512 111
379 3300017792 Ga0163161_10083452 Ga0163161_100834522 111
380 3300021388 Ga0213875_10461425 Ga0213875_104614252 111
381 3300025321 Ga0207656_10075212 Ga0207656_100752121 111
382 3300025321 Ga0207656_10247428 Ga0207656_102474282 111
383 3300025893 Ga0207682_10344654 Ga0207682_103446541 111
384 3300025899 Ga0207642_10732565 Ga0207642_107325652 111
385 3300025900 Ga0207710_10146760 Ga0207710_101467602 111
386 3300025901 Ga0207688_10387038 Ga0207688_103870382 111
387 3300025903 Ga0207680_10427392 Ga0207680_104273922 111
388 3300025903 Ga0207680_10497401 Ga0207680_104974011 111
389 3300025906 Ga0207699_10136911 Ga0207699_101369112 111
390 3300025907 Ga0207645_10145098 Ga0207645_101450982 111
391 3300025907 Ga0207645_10321884 Ga0207645_103218842 111
392 3300025907 Ga0207645_10462387 Ga0207645_104623872 111
393 3300025908 Ga0207643_10086015 Ga0207643_100860152 111
394 3300025908 Ga0207643_10611106 Ga0207643_106111061 111
395 3300025911 Ga0207654_10199473 Ga0207654_101994732 111
396 3300025912 Ga0207707_10043961 Ga0207707_100439612 111
397 3300025912 Ga0207707_10073652 Ga0207707_100736522 111
398 3300025912 Ga0207707_10147988 Ga0207707_101479882 111
399 3300025912 Ga0207707_10367697 Ga0207707_103676971 111
400 3300025915 Ga0207693_11183891 Ga0207693_111838911 111
401 3300025917 Ga0207660_10023251 Ga0207660_100232512 111
402 3300025917 Ga0207660_10037631 Ga0207660_100376312 111
403 3300025917 Ga0207660_10711198 Ga0207660_107111982 111
404 3300025918 Ga0207662_10027054 Ga0207662_100270542 111
405 3300025918 Ga0207662_10056810 Ga0207662_100568101 111
406 3300025918 Ga0207662_10960650 Ga0207662_109606501 111
407 3300025919 Ga0207657_10020891 Ga0207657_100208913 111
408 3300025919 Ga0207657_10422436 Ga0207657_104224361 111
409 3300025920 Ga0207649_10033247 Ga0207649_100332476 111
410 3300025920 Ga0207649_10582031 Ga0207649_105820312 111
411 3300025920 Ga0207649_10593421 Ga0207649_105934212 111
412 3300025921 Ga0207652_10010249 Ga0207652_100102493 111
413 3300025921 Ga0207652_10020647 Ga0207652_100206472 111
414 3300025921 Ga0207652_10063107 Ga0207652_100631072 111
415 3300025921 Ga0207652_10314145 Ga0207652_103141451 111
416 3300025921 Ga0207652_10321733 Ga0207652_103217332 111
417 3300025923 Ga0207681_10717816 Ga0207681_107178162 111
418 3300025923 Ga0207681_11797131 Ga0207681_117971311 111
419 3300025924 Ga0207694_10104348 Ga0207694_101043483 111
420 3300025924 Ga0207694_10318769 Ga0207694_103187691 111
421 3300025925 Ga0207650_10374887 Ga0207650_103748872 111
422 3300025925 Ga0207650_11471734 Ga0207650_114717341 111
423 3300025926 Ga0207659_10005701 Ga0207659_100057019 111
424 3300025926 Ga0207659_10181960 Ga0207659_101819602 111
425 3300025926 Ga0207659_10624629 Ga0207659_106246291 111
426 3300025927 Ga0207687_10425343 Ga0207687_104253432 111
427 3300025931 Ga0207644_10333311 Ga0207644_103333113 111
428 3300025933 Ga0207706_10091782 Ga0207706_100917822 111
429 3300025933 Ga0207706_10141402 Ga0207706_101414022 111
430 3300025934 Ga0207686_10079643 Ga0207686_100796432 111
431 3300025934 Ga0207686_10378199 Ga0207686_103781992 111
432 3300025934 Ga0207686_10473680 Ga0207686_104736802 111
433 3300025934 Ga0207686_10556807 Ga0207686_105568071 111
434 3300025934 Ga0207686_10799882 Ga0207686_107998822 111
435 3300025934 Ga0207686_11179664 Ga0207686_111796642 111
436 3300025935 Ga0207709_10407761 Ga0207709_104077612 111
437 3300025936 Ga0207670_10043069 Ga0207670_100430691 111
438 3300025936 Ga0207670_10086725 Ga0207670_100867252 111
439 3300025937 Ga0207669_10135574 Ga0207669_101355742 111
440 3300025938 Ga0207704_10085135 Ga0207704_100851352 111
441 3300025938 Ga0207704_10094086 Ga0207704_100940862 111
442 3300025938 Ga0207704_11207977 Ga0207704_112079771 111
443 3300025940 Ga0207691_10168942 Ga0207691_101689422 111
444 3300025940 Ga0207691_10785357 Ga0207691_107853571 111
445 3300025940 Ga0207691_11039575 Ga0207691_110395752 111
446 3300025940 Ga0207691_11191170 Ga0207691_111911702 111
447 3300025941 Ga0207711_10086359 Ga0207711_100863592 111
448 3300025941 Ga0207711_10090672 Ga0207711_100906722 111
449 3300025941 Ga0207711_10403847 Ga0207711_104038472 111
450 3300025942 Ga0207689_10001224 Ga0207689_1000122417 111
451 3300025942 Ga0207689_10038589 Ga0207689_100385892 111
452 3300025944 Ga0207661_10011105 Ga0207661_100111051 111
453 3300025944 Ga0207661_10148239 Ga0207661_101482392 111
454 3300025944 Ga0207661_10183441 Ga0207661_101834411 111
455 3300025944 Ga0207661_10580333 Ga0207661_105803332 111
456 3300025944 Ga0207661_11151179 Ga0207661_111511792 111
457 3300025945 Ga0207679_10019893 Ga0207679_100198933 111
458 3300025945 Ga0207679_10023391 Ga0207679_100233912 111
459 3300025945 Ga0207679_10241310 Ga0207679_102413102 111
460 3300025945 Ga0207679_10286011 Ga0207679_102860111 111
461 3300025945 Ga0207679_10315835 Ga0207679_103158352 111
462 3300025945 Ga0207679_10442011 Ga0207679_104420112 111
463 3300025945 Ga0207679_10578223 Ga0207679_105782232 111
464 3300025949 Ga0207667_10687893 Ga0207667_106878932 111
465 3300025961 Ga0207712_10057052 Ga0207712_100570522 111
466 3300025986 Ga0207658_10061439 Ga0207658_100614392 111
467 3300025986 Ga0207658_11327189 Ga0207658_113271891 111
468 3300025986 Ga0207658_12171896 Ga0207658_121718961 111
469 3300026023 Ga0207677_10209732 Ga0207677_102097322 111
470 3300026023 Ga0207677_10863916 Ga0207677_108639161 111
471 3300026023 Ga0207677_11189549 Ga0207677_111895492 111
472 3300026023 Ga0207677_11395706 Ga0207677_113957062 111
473 3300026023 Ga0207677_11928496 Ga0207677_119284962 111
474 3300026035 Ga0207703_10468496 Ga0207703_104684962 111
475 3300026067 Ga0207678_11817707 Ga0207678_118177071 111
476 3300026075 Ga0207708_10077774 Ga0207708_100777743 111
477 3300026075 Ga0207708_10766770 Ga0207708_107667701 111
478 3300026078 Ga0207702_10448078 Ga0207702_104480782 111
479 3300026088 Ga0207641_10616640 Ga0207641_106166401 111
480 3300026089 Ga0207648_10028818 Ga0207648_100288182 111
481 3300026089 Ga0207648_10459543 Ga0207648_104595432 111
482 3300026095 Ga0207676_10003636 Ga0207676_100036369 111
483 3300026095 Ga0207676_10497953 Ga0207676_104979532 111
484 3300026095 Ga0207676_10906070 Ga0207676_109060702 111
485 3300026116 Ga0207674_10006676 Ga0207674_100066762 111
486 3300026116 Ga0207674_10130684 Ga0207674_101306842 111
487 3300026116 Ga0207674_10168694 Ga0207674_101686941 111
488 3300026116 Ga0207674_10305111 Ga0207674_103051112 111
489 3300026116 Ga0207674_10960990 Ga0207674_109609902 111
490 3300026116 Ga0207674_11673789 Ga0207674_116737892 111
491 3300026118 Ga0207675_100242376 Ga0207675_1002423762 111
492 3300026121 Ga0207683_10061770 Ga0207683_100617702 111
493 3300026121 Ga0207683_10444693 Ga0207683_104446931 111
494 3300026121 Ga0207683_11345413 Ga0207683_113454131 111
495 3300026142 Ga0207698_11312745 Ga0207698_113127452 111
496 3300027907 Ga0207428_10132381 Ga0207428_101323812 111
497 3300027907 Ga0207428_11253714 Ga0207428_112537141 111
498 3300028379 Ga0268266_10531015 Ga0268266_105310152 111
499 3300028379 Ga0268266_10533721 Ga0268266_105337211 111
500 3300028380 Ga0268265_10010077 Ga0268265_100100776 111
501 3300028380 Ga0268265_10206517 Ga0268265_102065173 111
502 3300028380 Ga0268265_11799124 Ga0268265_117991242 111
503 3300030745 Ga0316182_1306717 Ga0316182_13067172 111
504 3300031548 Ga0307408_101022114 Ga0307408_1010221142 111
505 3300031731 Ga0307405_10099939 Ga0307405_100999392 111
506 3300031731 Ga0307405_10716918 Ga0307405_107169182 111
507 3300031731 Ga0307405_11260476 Ga0307405_112604762 111
508 3300031824 Ga0307413_10538400 Ga0307413_105384002 111
509 3300031824 Ga0307413_10970167 Ga0307413_109701671 111
510 3300031852 Ga0307410_10419777 Ga0307410_104197772 111
511 3300031852 Ga0307410_11078754 Ga0307410_110787542 111
512 3300031852 Ga0307410_11436386 Ga0307410_114363862 111
513 3300031852 Ga0307410_11461286 Ga0307410_114612861 111
514 3300031911 Ga0307412_11073909 Ga0307412_110739091 111
515 3300031995 Ga0307409_100347926 Ga0307409_1003479262 111
516 3300031995 Ga0307409_100382375 Ga0307409_1003823752 111
517 3300032002 Ga0307416_100565957 Ga0307416_1005659572 111
518 3300032004 Ga0307414_10540329 Ga0307414_105403292 111
519 3300032004 Ga0307414_10611656 Ga0307414_106116562 111
520 3300032005 Ga0307411_11620321 Ga0307411_116203212 111
521 3300032126 Ga0307415_100345439 Ga0307415_1003454392 111
522 3300032126 Ga0307415_100989275 Ga0307415_1009892752 111
523 3300035083 Ga0373926_0006506 Ga0373926_0006506_49_399 111
524 3300035089 Ga0373944_0011683 Ga0373944_0011683_759_1109 111
525 3300035113 Ga0373936_0078687 Ga0373936_0078687_815_1165 111
526 3300035116 Ga0373945_0019274 Ga0373945_0019274_1010_1360 111
527 3300035121 Ga0373960_0380476 Ga0373960_0380476_97_432 111
528 3300035170 Ga0373943_0019920 Ga0373943_0019920_2185_2535 111
529 3300035171 Ga0373946_0054015 Ga0373946_0054015_392_742 111
530 3300035691 Ga0373931_0056360 Ga0373931_0056360_226_561 111
531 3300035691 Ga0373931_0910652 Ga0373931_0910652_233_568 111
532 3300035692 Ga0373935_0383147 Ga0373935_0383147_46_396 111
533 3300035695 Ga0373927_0037180 Ga0373927_0037180_1539_1889 111
534 3300037068 Ga0373925_0075295 Ga0373925_0075295_2186_2536 111
535 3300037312 Ga0395899_0883901 Ga0395899_0883901_102_437 111
536 3300037466 Ga0395898_0855404 Ga0395898_0855404_458_793 111
537 3300037471 Ga0395905_0014873 Ga0395905_0014873_5338_5673 111
538 3300037853 Ga0436364_1538124 Ga0436364_1538124_128_463 111
539 3300039437 Ga0436365_0332039 Ga0436365_0332039_105_440 111
540 3300039437 Ga0436365_1658826 Ga0436365_1658826_1744_2079 111
541 3300041406 Ga0439439_0078607 Ga0439439_0078607_221_556 111
542 3300041999 Ga0439433_0038658 Ga0439433_0038658_67_402 111
543 3300044842 Ga0466957_0627944 Ga0466957_0627944_148_498 111
544 3300045051 Ga0451576_0265703 Ga0451576_0265703_934_1269 111
545 3300045051 Ga0451576_0568451 Ga0451576_0568451_831_1166 111
546 3300045976 Ga0466967_0202025 Ga0466967_0202025_343_678 111
547 3300045976 Ga0466967_1046235 Ga0466967_1046235_294_629 111
548 3300045976 Ga0466967_1613402 Ga0466967_1613402_103_453 111
549 3300046459 Ga0495629_0026059 Ga0495629_0026059_3177_3527 111
550 3300046460 Ga0495638_0140170 Ga0495638_0140170_721_1056 111
551 3300046472 Ga0495580_0129139 Ga0495580_0129139_275_625 111
552 3300046473 Ga0495582_0002255 Ga0495582_0002255_331_681 111
553 3300046475 Ga0495639_0004673 Ga0495639_0004673_1976_2326 111
554 3300046517 Ga0495630_0001254 Ga0495630_0001254_4178_4528 111
555 3300046531 Ga0495665_0002999 Ga0495665_0002999_1879_2229 111
556 3300046537 Ga0495598_0071128 Ga0495598_0071128_161_496 111
557 3300046674 Ga0495588_0140397 Ga0495588_0140397_857_1192 111
558 3300046674 Ga0495588_0370394 Ga0495588_0370394_113_448 111
559 3300046683 Ga0495658_0001632 Ga0495658_0001632_7138_7488 111
560 3300046684 Ga0495669_0197726 Ga0495669_0197726_25_360 111
561 3300046689 Ga0495613_0009300 Ga0495613_0009300_6146_6496 111
562 3300047315 Ga0495581_0001399 Ga0495581_0001399_5600_5950 111
563 3300047315 Ga0495581_0497897 Ga0495581_0497897_45_395 111
564 3300047673 Ga0495593_0001390 Ga0495593_0001390_8423_8773 111
565 3300048089 Ga0495614_0000448 Ga0495614_0000448_1835_2185 111
566 3300048907 Ga0496104_0120976 Ga0496104_0120976_878_1213 111
567 3300048908 Ga0496105_1127983 Ga0496105_1127983_69_404 111
568 3300048909 Ga0496106_0491328 Ga0496106_0491328_600_935 111
569 3300048911 Ga0496108_0031264 Ga0496108_0031264_153_488 111
570 3300048914 Ga0496111_0224052 Ga0496111_0224052_637_972 111
571 3300048915 Ga0496112_0002500 Ga0496112_0002500_13013_13348 111
572 3300048916 Ga0496113_0509129 Ga0496113_0509129_131_466 111
573 3300049520 Ga0501297_056842 Ga0501297_056842_240_575 111
574 3300049575 Ga0501039_0218488 Ga0501039_0218488_13_348 111
575 3300049576 Ga0501040_0071152 Ga0501040_0071152_394_729 111
576 3300049577 Ga0501041_0065335 Ga0501041_0065335_860_1195 111
577 3300049578 Ga0501042_0026256 Ga0501042_0026256_2504_2839 111
578 3300049582 Ga0501048_0068596 Ga0501048_0068596_127_462 111
579 3300049587 Ga0501071_0652538 Ga0501071_0652538_33_368 111
580 3300049588 Ga0501072_1521465 Ga0501072_1521465_53_388 111
581 3300049589 Ga0501073_1287659 Ga0501073_1287659_144_479 111
582 3300049591 Ga0501075_0052923 Ga0501075_0052923_1668_2003 111
583 3300049674 Ga0501242_072049 Ga0501242_072049_48_383 111
584 3300049688 Ga0501259_130539 Ga0501259_130539_93_428 111
585 3300049741 Ga0501079_0039644 Ga0501079_0039644_1545_1880 111
586 3300049742 Ga0501080_0790075 Ga0501080_0790075_113_448 111
587 3300049743 Ga0501081_0030883 Ga0501081_0030883_804_1139 111
588 3300049744 Ga0501083_0551757 Ga0501083_0551757_75_410 111
589 3300049765 Ga0501268_030357 Ga0501268_030357_209_544 111
590 3300049766 Ga0501269_037489 Ga0501269_037489_280_615 111
591 3300049824 Ga0501045_0041609 Ga0501045_0041609_2353_2688 111
592 3300050494 nmdc:mga06z11_105101_c1 nmdc:mga06z11_105101_c1_1204_1539 111
593 3300050507 nmdc:mga05p37_103157_c1 nmdc:mga05p37_103157_c1_1140_1475 111
594 3300050507 nmdc:mga05p37_181581_c1 nmdc:mga05p37_181581_c1_349_684 111
595 3300050508 nmdc:mga09592_131205_c1 nmdc:mga09592_131205_c1_848_1186 111
596 3300050508 nmdc:mga09592_25009_c1 nmdc:mga09592_25009_c1_2949_3284 111
597 3300050509 nmdc:mga0qj67_287285_c1 nmdc:mga0qj67_287285_c1_437_772 111
598 3300050509 nmdc:mga0qj67_828125_c1 nmdc:mga0qj67_828125_c1_229_567 111
599 3300050510 nmdc:mga06r32_394734_c1 nmdc:mga06r32_394734_c1_334_672 111
600 3300050511 nmdc:mga08y16_55486_c1 nmdc:mga08y16_55486_c1_1803_2138 111
601 3300050512 nmdc:mga0n895_330717_c1 nmdc:mga0n895_330717_c1_564_914 111
602 3300050512 nmdc:mga0n895_557866_c1 nmdc:mga0n895_557866_c1_237_572 111
603 3300054114 Ga0501084_1427637 Ga0501084_1427637_169_504 111
604 3300059421 Ga0590071_119630 Ga0590071_119630_182_517 111
605 3300060353 Ga0501082_0103629 Ga0501082_0103629_1518_1853 111

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

32

106

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xma-assembly1.cif.gz_B-2 structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9249 8 105
3hhh-assembly1.cif.gz_B crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.9246 6 109
1xma-assembly1.cif.gz_A structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9195 8 105
3hhh-assembly1.cif.gz_A crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.9143 6 109
6abq-assembly1.cif.gz_A crystal structure of transcription factor from listeria monocytogenes 0.9133 7 107
ID Description Score Start End Superfamily
af_Q9SU39_105_239_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9588 66 81 3.40.50.1000
1xmaA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9195 8 105 1.10.10.10
af_I6X7F9_1_101_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9194 11 109 1.10.10.10
5zqhA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.894 9 109 1.10.10.10
3l7wA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8935 14 108 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2V9ELH6-F1-model_v4 PadR family transcriptional regulator 0.9968 11 109
AF-A0A2V9Y9M6-F1-model_v4 PadR family transcriptional regulator 0.9964 12 108
AF-A0A7V0Y414-F1-model_v4 PadR family transcriptional regulator 0.9964 12 110
AF-A0A2V8EA09-F1-model_v4 PadR family transcriptional regulator 0.9954 7 89
AF-A0A2E8EBH7-F1-model_v4 PadR family transcriptional regulator 0.9953 11 109

Feature Viewer

pLDDT pTM Quality
90.09 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map