F468467

General Info

Members Datasets Scaffolds Average Seq Length
605 266 1210 233

Family's Representative Sequence

Representative Sequence 3300009148|Ga0105243_10416626|Ga0105243_104166262
Length 249
Sequence LDEACGNPFWGTLATMATTLTWLGHAAFRIDTPAGTRIYVDPFLEGNPSCPDGEQSPERCDLVVLTHGHDDHVGDTLALAGRFSCPVVAQVELRGWLSTKGLDEDMSQSPNKGGTIRVGDVRITLTDANHSTSAFENGTFTYLGEPCGLVLRPDGGPSIYIAGDTNVFGDMALIRRLYAPDVAVLPIGDHFTMGPEEAAVAAELVGAPRVVPSHYGTFGLLTGTPDALRELLPDGVELVAPAPGETVEL

Samples

Sample ID Description Type Environment
1 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
2 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
67 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
68 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
159 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
160 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
161 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
162 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
163 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
164 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
165 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
166 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
167 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
168 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
169 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
170 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
171 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
172 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
173 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
174 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
176 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
177 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
178 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
179 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
180 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
181 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
182 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
183 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
184 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
185 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
186 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
187 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
188 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
189 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
190 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
191 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
192 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
193 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
194 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
195 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
196 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
197 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
198 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
199 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
200 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
201 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
202 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
203 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
204 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
205 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
206 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
207 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
208 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
209 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
210 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
211 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
212 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
213 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
214 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
215 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
216 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
217 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
218 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
219 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
220 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
221 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
236 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
237 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
238 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
239 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
240 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
241 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
242 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
243 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
244 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
245 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
246 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
247 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
248 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
249 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
250 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
253 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
254 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
255 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
256 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
257 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
258 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
259 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
260 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
261 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
262 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
263 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
264 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
265 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
266 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.17
Metatranscriptomes 0.83
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.66
Nodule 0
Rhizoplane 6.45
Rhizosphere 92.89
Stem 0
Stem Tuber 0
Unclassified 8.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105243_10416626 3300009148 Archaea 1251
2 ARSoilOldRDRAFT_c009932 3300000044 Bacteria 794
3 JGI24739J22299_10035832 3300001989 Bacteria 1679
4 JGI24743J22301_10005203 3300001991 Bacteria 2163
5 JGI24738J21930_10005569 3300002075 Bacteria 3004
6 JGI25406J46586_10040463 3300003203 Bacteria 1652
7 Ga0070658_10119662 3300005327 Bacteria 2188
8 Ga0070683_100031599 3300005329 Bacteria 4816
9 Ga0070683_100044042 3300005329 Bacteria 4114
10 Ga0070683_100045947 3300005329 Bacteria 4032
11 Ga0070683_100133958 3300005329 Bacteria 2346
12 Ga0070683_100225107 3300005329 Bacteria 1782
13 Ga0070683_100752793 3300005329 Bacteria 933
14 Ga0070670_100098812 3300005331 Bacteria 2512
15 Ga0070670_100293172 3300005331 Bacteria 1422
16 Ga0070670_100683416 3300005331 Archaea 922
17 Ga0068869_100144702 3300005334 Bacteria 1839
18 Ga0068869_100977688 3300005334 Unclassified 736
19 Ga0070680_100006280 3300005336 Bacteria 9019
20 Ga0070680_100062689 3300005336 Bacteria 3044
21 Ga0070682_100030833 3300005337 Bacteria 3240
22 Ga0070682_100059146 3300005337 Bacteria 2419
23 Ga0070682_100095936 3300005337 Bacteria 1948
24 Ga0070682_100454119 3300005337 Bacteria 982
25 Ga0070682_100455509 3300005337 Archaea 981
26 Ga0068868_100157542 3300005338 Bacteria 1873
27 Ga0068868_100281276 3300005338 Bacteria 1408
28 Ga0070660_100135498 3300005339 Bacteria 1973
29 Ga0070689_100334267 3300005340 Unclassified 1268
30 Ga0070691_10032236 3300005341 Bacteria 2461
31 Ga0070691_10088808 3300005341 Bacteria 1522
32 Ga0070661_100017514 3300005344 Bacteria 5085
33 Ga0070661_100168985 3300005344 Bacteria 1660
34 Ga0070668_100091866 3300005347 Bacteria 2394
35 Ga0070668_100103335 3300005347 Bacteria 2260
36 Ga0070675_100027707 3300005354 Bacteria 4555
37 Ga0070675_100069322 3300005354 Bacteria 2921
38 Ga0070674_100071031 3300005356 Archaea 2461
39 Ga0070674_100138997 3300005356 Bacteria 1821
40 Ga0070673_100005153 3300005364 Bacteria 8337
41 Ga0070673_100007612 3300005364 Bacteria 7166
42 Ga0070659_100009185 3300005366 Bacteria 7254
43 Ga0070659_100010513 3300005366 Bacteria 6810
44 Ga0070659_100031388 3300005366 Bacteria 4114
45 Ga0070659_100064759 3300005366 Bacteria 2893
46 Ga0070659_100376391 3300005366 Bacteria 1195
47 Ga0070667_100298941 3300005367 Unclassified 1449
48 Ga0070701_10006182 3300005438 Bacteria 5020
49 Ga0070701_10019521 3300005438 Bacteria 3202
50 Ga0070701_10121580 3300005438 Bacteria 1472
51 Ga0070705_100001459 3300005440 Bacteria 12501
52 Ga0070705_100120696 3300005440 Bacteria 1692
53 Ga0070700_100057241 3300005441 Bacteria 2446
54 Ga0070700_100417384 3300005441 Bacteria 1013
55 Ga0070694_100330198 3300005444 Bacteria 1176
56 Ga0070694_100512866 3300005444 Bacteria 956
57 Ga0070663_100011865 3300005455 Bacteria 5491
58 Ga0070678_100000052 3300005456 Bacteria 40622
59 Ga0070678_100015082 3300005456 Bacteria 4899
60 Ga0070678_100261374 3300005456 Unclassified 1456
61 Ga0070662_100036282 3300005457 Bacteria 3486
62 Ga0070662_100060621 3300005457 Bacteria 2759
63 Ga0070681_10161743 3300005458 Bacteria 2163
64 Ga0068867_100554733 3300005459 Bacteria 996
65 Ga0070685_10007843 3300005466 Bacteria 5467
66 Ga0070685_10062379 3300005466 Bacteria 2185
67 Ga0070685_10283100 3300005466 Bacteria 1111
68 Ga0070698_100102616 3300005471 Unclassified 2830
69 Ga0070699_100070877 3300005518 Bacteria 3030
70 Ga0070699_100699930 3300005518 Bacteria 926
71 Ga0070679_100063253 3300005530 Bacteria 3689
72 Ga0070679_100071314 3300005530 Bacteria 3465
73 Ga0070679_100142937 3300005530 Unclassified 2371
74 Ga0070679_100208506 3300005530 Bacteria 1918
75 Ga0070679_100351783 3300005530 Bacteria 1421
76 Ga0070684_100009821 3300005535 Bacteria 7557
77 Ga0070684_100030081 3300005535 Bacteria 4611
78 Ga0070684_100105826 3300005535 Bacteria 2518
79 Ga0070684_100147719 3300005535 Bacteria 2128
80 Ga0070684_100173337 3300005535 Bacteria 1960
81 Ga0070684_100213617 3300005535 Bacteria 1758
82 Ga0070684_100399143 3300005535 Bacteria 1267
83 Ga0070697_100162445 3300005536 Bacteria 1887
84 Ga0068853_100012719 3300005539 Bacteria 6851
85 Ga0068853_100067239 3300005539 Bacteria 3113
86 Ga0068853_100088341 3300005539 Bacteria 2721
87 Ga0070672_100103175 3300005543 Bacteria 2316
88 Ga0070672_100158549 3300005543 Bacteria 1876
89 Ga0070686_100001674 3300005544 Bacteria 12387
90 Ga0070686_100146896 3300005544 Unclassified 1647
91 Ga0070686_100232857 3300005544 Bacteria 1337
92 Ga0070696_100152127 3300005546 Unclassified 1699
93 Ga0070696_100580628 3300005546 Bacteria 901
94 Ga0070693_100009212 3300005547 Bacteria 4905
95 Ga0070693_100016326 3300005547 Bacteria 3841
96 Ga0070693_100081932 3300005547 Bacteria 1926
97 Ga0070693_100164333 3300005547 Bacteria 1416
98 Ga0070665_100046359 3300005548 Bacteria 4367
99 Ga0070665_100103425 3300005548 Bacteria 2851
100 Ga0070704_100023046 3300005549 Bacteria 4059
101 Ga0070704_100296643 3300005549 Unclassified 1345
102 Ga0070704_100390061 3300005549 Bacteria 1185
103 Ga0068855_100033474 3300005563 Bacteria 6133
104 Ga0070664_100061110 3300005564 Bacteria 3210
105 Ga0070664_100071615 3300005564 Bacteria 2971
106 Ga0070664_100096048 3300005564 Bacteria 2571
107 Ga0070664_100603663 3300005564 Unclassified 1018
108 Ga0068857_100030114 3300005577 Bacteria 4789
109 Ga0068857_100156668 3300005577 Bacteria 2065
110 Ga0068854_100066826 3300005578 Bacteria 2617
111 Ga0068854_100137398 3300005578 Bacteria 1872
112 Ga0068856_100032298 3300005614 Bacteria 5125
113 Ga0068856_100094815 3300005614 Bacteria 2972
114 Ga0070702_100044763 3300005615 Bacteria 2500
115 Ga0070702_100052912 3300005615 Bacteria 2330
116 Ga0070702_100058184 3300005615 Bacteria 2238
117 Ga0070702_100105698 3300005615 Bacteria 1735
118 Ga0070702_100223072 3300005615 Bacteria 1261
119 Ga0068852_100558112 3300005616 Archaea 1146
120 Ga0068859_100094205 3300005617 Bacteria 3047
121 Ga0068864_100019754 3300005618 Bacteria 5634
122 Ga0068866_10008968 3300005718 Bacteria 4235
123 Ga0068866_10076202 3300005718 Bacteria 1788
124 Ga0068866_10157838 3300005718 Unclassified 1320
125 Ga0068866_10357162 3300005718 Bacteria 930
126 Ga0068861_100028780 3300005719 Bacteria 4056
127 Ga0068851_10009084 3300005834 Bacteria 4613
128 Ga0068870_10016192 3300005840 Bacteria 3556
129 Ga0068870_10059327 3300005840 Bacteria 2051
130 Ga0068863_100110603 3300005841 Bacteria 2616
131 Ga0068858_100047996 3300005842 Bacteria 3958
132 Ga0068858_100206649 3300005842 Bacteria 1858
133 Ga0068858_100230765 3300005842 Unclassified 1755
134 Ga0068860_100027023 3300005843 Bacteria 5530
135 Ga0068860_100446760 3300005843 Bacteria 1285
136 Ga0068862_100131730 3300005844 Bacteria 2212
137 Ga0081455_10013098 3300005937 Bacteria 8220
138 Ga0081455_10026506 3300005937 Bacteria 5327
139 Ga0081455_10411539 3300005937 Unclassified 935
140 Ga0081538_10031464 3300005981 Bacteria 3578
141 Ga0081539_10000200 3300005985 Bacteria 139291
142 Ga0075364_10020761 3300006051 Unclassified 4133
143 Ga0075364_10149290 3300006051 Bacteria 1575
144 Ga0075432_10018362 3300006058 Bacteria 2386
145 Ga0070715_10019378 3300006163 Bacteria 2609
146 Ga0097621_100026124 3300006237 Bacteria 4577
147 Ga0068871_100046109 3300006358 Bacteria 3510
148 Ga0068871_100314221 3300006358 Bacteria 1378
149 Ga0068871_100506477 3300006358 Archaea 1089
150 Ga0075428_100260262 3300006844 Bacteria 1868
151 Ga0075428_100469626 3300006844 Archaea 1347
152 Ga0075431_100713536 3300006847 Bacteria 980
153 Ga0075433_10118193 3300006852 Bacteria 2353
154 Ga0075433_10924960 3300006852 Bacteria 760
155 Ga0068865_100008991 3300006881 Bacteria 6181
156 Ga0068865_100031732 3300006881 Bacteria 3524
157 Ga0097620_100094200 3300006931 Bacteria 3047
158 Ga0105240_10245173 3300009093 Bacteria 2075
159 Ga0111539_10157964 3300009094 Bacteria 2653
160 Ga0111539_10833348 3300009094 Bacteria 1073
161 Ga0105245_10023597 3300009098 Bacteria 5400
162 Ga0105245_10046418 3300009098 Bacteria 3882
163 Ga0105245_10070046 3300009098 Bacteria 3181
164 Ga0105245_10143776 3300009098 Bacteria 2249
165 Ga0105245_10978751 3300009098 Bacteria 890
166 Ga0114129_10038780 3300009147 Bacteria 6716
167 Ga0114129_10131500 3300009147 Unclassified 3436
168 Ga0114129_11421874 3300009147 Bacteria 855
169 Ga0114129_11518467 3300009147 Unclassified 822
170 Ga0105243_10007909 3300009148 Bacteria 8165
171 Ga0105243_10009015 3300009148 Bacteria 7623
172 Ga0105243_10023935 3300009148 Bacteria 4654
173 Ga0105243_10097084 3300009148 Bacteria 2439
174 Ga0105243_10164351 3300009148 Bacteria 1917
175 Ga0105241_10100207 3300009174 Bacteria 2302
176 Ga0105241_10159922 3300009174 Bacteria 1851
177 Ga0105242_10009065 3300009176 Bacteria 7645
178 Ga0105242_10040774 3300009176 Bacteria 3742
179 Ga0105242_10557308 3300009176 Bacteria 1100
180 Ga0105242_11187675 3300009176 Archaea 781
181 Ga0105248_10015219 3300009177 Bacteria 8476
182 Ga0105248_10024950 3300009177 Bacteria 6645
183 Ga0105248_10045330 3300009177 Bacteria 4932
184 Ga0105248_11043442 3300009177 Bacteria 924
185 Ga0105237_10390820 3300009545 Unclassified 1396
186 Ga0105238_10160285 3300009551 Bacteria 2225
187 Ga0105238_10252584 3300009551 Unclassified 1742
188 Ga0105249_10085675 3300009553 Bacteria 2937
189 Ga0105249_10641698 3300009553 Bacteria 1119
190 Ga0105249_10687761 3300009553 Unclassified 1082
191 Ga0105239_10031030 3300010375 Bacteria 5879
192 Ga0105239_10250057 3300010375 Bacteria 1991
193 Ga0105246_10008656 3300011119 Bacteria 6257
194 Ga0105246_10111951 3300011119 Bacteria 2007
195 Ga0157371_10029676 3300013102 Bacteria 3952
196 Ga0157371_10137294 3300013102 Bacteria 1741
197 Ga0157369_10013890 3300013105 Bacteria 9097
198 Ga0157369_10102394 3300013105 Bacteria 3052
199 Ga0157378_10001752 3300013297 Bacteria 19468
200 Ga0163162_10259427 3300013306 Bacteria 1870
201 Ga0157372_10049404 3300013307 Bacteria 4677
202 Ga0157372_10124270 3300013307 Bacteria 2966
203 Ga0157372_10287824 3300013307 Bacteria 1911
204 Ga0157375_10064949 3300013308 Bacteria 3636
205 Ga0157375_10072916 3300013308 Bacteria 3451
206 Ga0157375_10080233 3300013308 Bacteria 3300
207 Ga0157375_10654906 3300013308 Bacteria 1206
208 Ga0163163_10245031 3300014325 Archaea 1842
209 Ga0157380_10000820 3300014326 Bacteria 19481
210 Ga0157380_10573076 3300014326 Archaea 1112
211 Ga0182008_10197189 3300014497 Bacteria 1023
212 Ga0157377_10005680 3300014745 Bacteria 5879
213 Ga0157377_10009457 3300014745 Bacteria 4782
214 Ga0157377_10015087 3300014745 Bacteria 3943
215 Ga0157377_10111314 3300014745 Bacteria 1646
216 Ga0157377_10406336 3300014745 Unclassified 929
217 Ga0157379_10009631 3300014968 Bacteria 8410
218 Ga0157379_10059591 3300014968 Bacteria 3413
219 Ga0157379_10094192 3300014968 Bacteria 2687
220 Ga0157376_10014368 3300014969 Bacteria 5941
221 Ga0157376_10036180 3300014969 Bacteria 3998
222 Ga0157376_10211245 3300014969 Bacteria 1792
223 Ga0163161_10053935 3300017792 Bacteria 2916
224 Ga0206351_10482556 3300020077 Bacteria 868
225 Ga0206350_11107442 3300020080 Bacteria 889
226 Ga0206354_11183149 3300020081 Bacteria 1559
227 Ga0206353_10994781 3300020082 Bacteria 956
228 Ga0206353_11119996 3300020082 Bacteria 6428
229 Ga0207653_10066552 3300025885 Bacteria 1224
230 Ga0207642_10005610 3300025899 Bacteria 4108
231 Ga0207688_10001403 3300025901 Bacteria 12559
232 Ga0207688_10006162 3300025901 Bacteria 6527
233 Ga0207688_10194107 3300025901 Bacteria 1215
234 Ga0207680_10288812 3300025903 Unclassified 1141
235 Ga0207647_10199761 3300025904 Bacteria 1157
236 Ga0207685_10280871 3300025905 Bacteria 817
237 Ga0207645_10023350 3300025907 Unclassified 4020
238 Ga0207643_10033044 3300025908 Bacteria 2894
239 Ga0207643_10114507 3300025908 Bacteria 1591
240 Ga0207705_10065729 3300025909 Bacteria 2622
241 Ga0207707_10238996 3300025912 Unclassified 1579
242 Ga0207707_10253793 3300025912 Bacteria 1527
243 Ga0207695_10056425 3300025913 Bacteria 4086
244 Ga0207660_10049258 3300025917 Bacteria 2985
245 Ga0207662_10067432 3300025918 Bacteria 2158
246 Ga0207662_10107962 3300025918 Bacteria 1732
247 Ga0207657_10001010 3300025919 Bacteria 29952
248 Ga0207657_10059901 3300025919 Bacteria 3269
249 Ga0207657_10186079 3300025919 Bacteria 1677
250 Ga0207657_10265952 3300025919 Unclassified 1364
251 Ga0207649_10034246 3300025920 Bacteria 3041
252 Ga0207649_10035028 3300025920 Bacteria 3013
253 Ga0207649_10166286 3300025920 Bacteria 1532
254 Ga0207652_10064630 3300025921 Bacteria 3166
255 Ga0207694_10155637 3300025924 Bacteria 1843
256 Ga0207694_10297908 3300025924 Bacteria 1327
257 Ga0207650_10096434 3300025925 Unclassified 2269
258 Ga0207650_10112424 3300025925 Bacteria 2110
259 Ga0207687_10008752 3300025927 Bacteria 6614
260 Ga0207687_10102095 3300025927 Bacteria 2112
261 Ga0207687_10136027 3300025927 Bacteria 1859
262 Ga0207690_10069688 3300025932 Bacteria 2420
263 Ga0207706_10023980 3300025933 Bacteria 5474
264 Ga0207706_10033910 3300025933 Bacteria 4544
265 Ga0207706_10039259 3300025933 Bacteria 4196
266 Ga0207706_10051168 3300025933 Bacteria 3649
267 Ga0207686_10074483 3300025934 Bacteria 2194
268 Ga0207686_10159028 3300025934 Bacteria 1581
269 Ga0207686_10178591 3300025934 Bacteria 1503
270 Ga0207686_10247646 3300025934 Bacteria 1300
271 Ga0207686_10316933 3300025934 Unclassified 1164
272 Ga0207709_10022156 3300025935 Bacteria 3601
273 Ga0207709_10022551 3300025935 Bacteria 3572
274 Ga0207709_10023219 3300025935 Bacteria 3528
275 Ga0207709_10083159 3300025935 Bacteria 2069
276 Ga0207709_10274812 3300025935 Bacteria 1242
277 Ga0207669_10019183 3300025937 Bacteria 3554
278 Ga0207669_10198467 3300025937 Bacteria 1454
279 Ga0207704_10029907 3300025938 Bacteria 3046
280 Ga0207704_10710805 3300025938 Bacteria 833
281 Ga0207665_10391597 3300025939 Bacteria 1056
282 Ga0207691_10010456 3300025940 Bacteria 8903
283 Ga0207691_10026609 3300025940 Bacteria 5428
284 Ga0207691_10096134 3300025940 Bacteria 2649
285 Ga0207691_10513083 3300025940 Bacteria 1018
286 Ga0207711_10023268 3300025941 Bacteria 5185
287 Ga0207711_10123290 3300025941 Bacteria 2316
288 Ga0207711_10222058 3300025941 Bacteria 1728
289 Ga0207711_10409906 3300025941 Unclassified 1260
290 Ga0207711_10543187 3300025941 Archaea 1084
291 Ga0207689_10047479 3300025942 Bacteria 3544
292 Ga0207661_10002116 3300025944 Bacteria 13667
293 Ga0207661_10102126 3300025944 Bacteria 2410
294 Ga0207661_10117674 3300025944 Bacteria 2258
295 Ga0207661_10123419 3300025944 Bacteria 2209
296 Ga0207661_10259337 3300025944 Bacteria 1548
297 Ga0207661_10391893 3300025944 Bacteria 1258
298 Ga0207679_10135944 3300025945 Bacteria 1979
299 Ga0207679_10240673 3300025945 Bacteria 1533
300 Ga0207679_10303011 3300025945 Bacteria 1378
301 Ga0207679_10356303 3300025945 Unclassified 1277
302 Ga0207667_10285817 3300025949 Unclassified 1685
303 Ga0207667_10649629 3300025949 Bacteria 1060
304 Ga0207651_10042627 3300025960 Bacteria 3022
305 Ga0207712_10049006 3300025961 Bacteria 2941
306 Ga0207712_10336470 3300025961 Bacteria 1250
307 Ga0207668_10082938 3300025972 Bacteria 2331
308 Ga0207640_10076045 3300025981 Bacteria 2278
309 Ga0207658_10059380 3300025986 Bacteria 2850
310 Ga0207677_10233022 3300026023 Bacteria 1484
311 Ga0207677_10438266 3300026023 Bacteria 1117
312 Ga0207677_10571710 3300026023 Bacteria 988
313 Ga0207703_10108622 3300026035 Bacteria 2363
314 Ga0207703_10742213 3300026035 Archaea 935
315 Ga0207639_10066505 3300026041 Bacteria 2802
316 Ga0207639_10070000 3300026041 Bacteria 2739
317 Ga0207639_10204830 3300026041 Bacteria 1694
318 Ga0207639_10568360 3300026041 Archaea 1043
319 Ga0207678_10025385 3300026067 Bacteria 5173
320 Ga0207678_10482932 3300026067 Bacteria 1079
321 Ga0207708_10026938 3300026075 Bacteria 4353
322 Ga0207708_10029313 3300026075 Bacteria 4171
323 Ga0207708_10210356 3300026075 Unclassified 1555
324 Ga0207708_10405516 3300026075 Bacteria 1128
325 Ga0207702_10094097 3300026078 Bacteria 2630
326 Ga0207702_10115772 3300026078 Bacteria 2391
327 Ga0207641_10324022 3300026088 Unclassified 1462
328 Ga0207648_10023616 3300026089 Bacteria 5505
329 Ga0207648_10043885 3300026089 Bacteria 3924
330 Ga0207648_10082064 3300026089 Bacteria 2811
331 Ga0207648_10194353 3300026089 Bacteria 1799
332 Ga0207648_10523448 3300026089 Bacteria 1087
333 Ga0207648_10592160 3300026089 Archaea 1021
334 Ga0207674_10017040 3300026116 Bacteria 7931
335 Ga0207674_10027394 3300026116 Bacteria 6028
336 Ga0207674_10248810 3300026116 Bacteria 1724
337 Ga0207674_10332750 3300026116 Bacteria 1468
338 Ga0207674_10653180 3300026116 Unclassified 1016
339 Ga0207675_100014934 3300026118 Bacteria 7249
340 Ga0207675_100129978 3300026118 Bacteria 2388
341 Ga0207683_10000088 3300026121 Bacteria 72940
342 Ga0207683_10003610 3300026121 Bacteria 13485
343 Ga0207683_10016673 3300026121 Bacteria 6252
344 Ga0207683_10205089 3300026121 Bacteria 1793
345 Ga0207683_10346410 3300026121 Bacteria 1363
346 Ga0207698_10073734 3300026142 Bacteria 2719
347 Ga0207698_10559089 3300026142 Bacteria 1123
348 Ga0207698_10629085 3300026142 Archaea 1061
349 Ga0207428_10000244 3300027907 Bacteria 74209
350 Ga0207428_10050859 3300027907 Bacteria 3313
351 Ga0207428_10149851 3300027907 Bacteria 1776
352 Ga0268266_10067580 3300028379 Bacteria 3094
353 Ga0268265_10132980 3300028380 Bacteria 2071
354 Ga0268265_10615168 3300028380 Bacteria 1040
355 Ga0268264_10104619 3300028381 Bacteria 2467
356 Ga0265319_1015620 3300028563 Bacteria 2938
357 Ga0265318_10008787 3300028577 Bacteria 4474
358 Ga0265338_10070748 3300028800 Bacteria 2989
359 Ga0265320_10014826 3300031240 Bacteria 4421
360 Ga0265320_10070740 3300031240 Bacteria 1645
361 Ga0265320_10100366 3300031240 Bacteria 1333
362 Ga0265340_10076615 3300031247 Bacteria 1579
363 Ga0307408_100223764 3300031548 Unclassified 1537
364 Ga0265313_10107135 3300031595 Unclassified 1233
365 Ga0307405_10388174 3300031731 Bacteria 1089
366 Ga0307410_10543068 3300031852 Bacteria 962
367 Ga0307406_10818474 3300031901 Bacteria 787
368 Ga0307407_10095402 3300031903 Bacteria 1834
369 Ga0307409_100060552 3300031995 Bacteria 2953
370 Ga0373938_0035511 3300034957 Bacteria 1087
371 Ga0373954_0053157 3300035118 Bacteria 1904
372 Ga0373960_0002607 3300035121 Bacteria 4073
373 Ga0373931_0101830 3300035691 Bacteria 1616
374 Ga0373925_0187262 3300037068 Bacteria 1641
375 Ga0395900_0219544 3300037418 Unclassified 1917
376 Ga0395898_0406647 3300037466 Bacteria 1298
377 Ga0395901_0454210 3300038443 Bacteria 1310
378 Ga0395901_0790099 3300038443 Unclassified 939
379 Ga0451807_1742402 3300041486 Bacteria 1223
380 Ga0439445_0062318 3300042004 Bacteria 1022
381 Ga0439448_0113386 3300042005 Bacteria 927
382 Ga0439432_104426 3300042006 Bacteria 846
383 Ga0439449_0079620 3300042007 Bacteria 1208
384 Ga0439462_0007795 3300042015 Bacteria 2687
385 Ga0450914_000276 3300042118 Bacteria 2128
386 Ga0450906_012059 3300042145 Bacteria 1606
387 Ga0439446_0001483 3300042156 Bacteria 5361
388 Ga0439459_0020854 3300042438 Bacteria 1254
389 Ga0466966_0013574 3300044684 Bacteria 5391
390 Ga0466961_0040354 3300044693 Bacteria 2993
391 Ga0466961_0218860 3300044693 Bacteria 1174
392 Ga0466963_0108183 3300044694 Bacteria 1907
393 Ga0466963_0256828 3300044694 Unclassified 1227
394 Ga0466957_0396843 3300044842 Bacteria 943
395 Ga0466959_0040893 3300045049 Bacteria 3424
396 Ga0466967_0256603 3300045976 Bacteria 1672
397 Ga0466967_0440093 3300045976 Bacteria 1273
398 Ga0495603_0006748 3300046455 Bacteria 6889
399 Ga0495603_0030234 3300046455 Bacteria 3263
400 Ga0495603_0086270 3300046455 Bacteria 1837
401 Ga0495641_0090870 3300046461 Bacteria 1364
402 Ga0495582_0122111 3300046473 Unclassified 1468
403 Ga0495596_0144180 3300046500 Unclassified 925
404 Ga0495637_0093037 3300046520 Bacteria 1187
405 Ga0495644_0091114 3300046523 Unclassified 1151
406 Ga0495656_0013806 3300046615 Bacteria 3014
407 Ga0495634_0188294 3300046642 Bacteria 1289
408 Ga0495659_0175426 3300046664 Unclassified 871
409 Ga0495658_0157095 3300046683 Bacteria 1400
410 Ga0495604_0315596 3300047317 Bacteria 1046
411 Ga0495602_0523589 3300048088 Bacteria 825
412 Ga0496100_0083321 3300048903 Bacteria 2165
413 Ga0496101_0001935 3300048904 Bacteria 12535
414 Ga0496101_0116460 3300048904 Bacteria 2016
415 Ga0496102_0262912 3300048905 Unclassified 1627
416 Ga0496102_0309936 3300048905 Bacteria 1487
417 Ga0496103_0016856 3300048906 Bacteria 4363
418 Ga0496104_0075582 3300048907 Bacteria 3208
419 Ga0496105_0001655 3300048908 Bacteria 15880
420 Ga0496105_0110301 3300048908 Bacteria 2271
421 Ga0496105_0465631 3300048908 Unclassified 996
422 Ga0496106_0067900 3300048909 Bacteria 2719
423 Ga0496106_0236419 3300048909 Archaea 1460
424 Ga0496107_0011271 3300048910 Bacteria 6221
425 Ga0496107_0241251 3300048910 Archaea 1345
426 Ga0496108_0009092 3300048911 Bacteria 8046
427 Ga0496108_0024449 3300048911 Bacteria 4973
428 Ga0496108_0063926 3300048911 Bacteria 3099
429 Ga0496108_0213713 3300048911 Bacteria 1674
430 Ga0496109_0008352 3300048912 Bacteria 8797
431 Ga0496109_0128506 3300048912 Bacteria 2364
432 Ga0496109_0293917 3300048912 Bacteria 1532
433 Ga0496110_0013159 3300048913 Bacteria 6831
434 Ga0496110_0060184 3300048913 Bacteria 3349
435 Ga0496110_0074971 3300048913 Bacteria 3006
436 Ga0496110_0084249 3300048913 Bacteria 2837
437 Ga0496111_0002857 3300048914 Bacteria 10543
438 Ga0496111_0023990 3300048914 Bacteria 4288
439 Ga0496111_0122453 3300048914 Unclassified 1921
440 Ga0496112_0020518 3300048915 Bacteria 6265
441 Ga0496112_0414650 3300048915 Archaea 1286
442 Ga0496112_0900082 3300048915 Bacteria 807
443 Ga0496113_0053237 3300048916 Bacteria 3026
444 Ga0496114_0035638 3300048917 Bacteria 4109
445 Ga0496114_0079772 3300048917 Bacteria 2764
446 Ga0496114_0087087 3300048917 Bacteria 2648
447 Ga0496114_0138237 3300048917 Bacteria 2107
448 Ga0496114_0411360 3300048917 Bacteria 1198
449 Ga0496114_0418944 3300048917 Bacteria 1186
450 Ga0501031_0015535 3300049568 Bacteria 4942
451 Ga0501031_0026848 3300049568 Bacteria 3753
452 Ga0501031_0052869 3300049568 Bacteria 2646
453 Ga0501032_0031634 3300049569 Bacteria 3627
454 Ga0501032_0063572 3300049569 Bacteria 2471
455 Ga0501032_0180072 3300049569 Bacteria 1384
456 Ga0501033_0022921 3300049570 Bacteria 4707
457 Ga0501033_0050721 3300049570 Bacteria 3077
458 Ga0501033_0152906 3300049570 Bacteria 1664
459 Ga0501034_0068007 3300049571 Bacteria 3574
460 Ga0501034_0186625 3300049571 Bacteria 2037
461 Ga0501036_0002878 3300049572 Bacteria 13648
462 Ga0501036_0007924 3300049572 Bacteria 8692
463 Ga0501036_0024789 3300049572 Bacteria 5058
464 Ga0501036_0176644 3300049572 Bacteria 1798
465 Ga0501037_0071846 3300049573 Bacteria 2517
466 Ga0501037_0141275 3300049573 Bacteria 1723
467 Ga0501038_0022126 3300049574 Bacteria 5699
468 Ga0501038_0037681 3300049574 Bacteria 4238
469 Ga0501038_0099779 3300049574 Bacteria 2420
470 Ga0501038_0271444 3300049574 Bacteria 1337
471 Ga0501039_0003065 3300049575 Bacteria 12496
472 Ga0501039_0008700 3300049575 Bacteria 7728
473 Ga0501039_0011656 3300049575 Bacteria 6695
474 Ga0501039_0052617 3300049575 Bacteria 3150
475 Ga0501039_0077813 3300049575 Bacteria 2579
476 Ga0501039_0165130 3300049575 Bacteria 1741
477 Ga0501039_0173222 3300049575 Archaea 1697
478 Ga0501040_0006377 3300049576 Bacteria 7656
479 Ga0501040_0015305 3300049576 Bacteria 5071
480 Ga0501040_0510060 3300049576 Bacteria 867
481 Ga0501041_0009685 3300049577 Bacteria 5678
482 Ga0501041_0014045 3300049577 Bacteria 4753
483 Ga0501041_0032310 3300049577 Bacteria 3163
484 Ga0501041_0073589 3300049577 Bacteria 2099
485 Ga0501041_0196945 3300049577 Bacteria 1262
486 Ga0501042_0005099 3300049578 Bacteria 8427
487 Ga0501042_0022473 3300049578 Bacteria 4406
488 Ga0501042_0046879 3300049578 Bacteria 3081
489 Ga0501042_0091668 3300049578 Bacteria 2181
490 Ga0501042_0617039 3300049578 Archaea 788
491 Ga0501043_0194724 3300049579 Bacteria 1575
492 Ga0501043_0203376 3300049579 Bacteria 1536
493 Ga0501046_0017152 3300049580 Bacteria 6051
494 Ga0501046_0019020 3300049580 Bacteria 5701
495 Ga0501046_0020889 3300049580 Bacteria 5407
496 Ga0501046_0089731 3300049580 Bacteria 2365
497 Ga0501046_0184611 3300049580 Bacteria 1558
498 Ga0501048_0038176 3300049582 Bacteria 3447
499 Ga0501048_0120565 3300049582 Bacteria 1853
500 Ga0501067_0000374 3300049583 Bacteria 24367
501 Ga0501067_0170092 3300049583 Unclassified 1214
502 Ga0501068_0007668 3300049584 Bacteria 5972
503 Ga0501068_0012680 3300049584 Bacteria 4784
504 Ga0501068_0038057 3300049584 Bacteria 2880
505 Ga0501069_0012844 3300049585 Bacteria 4459
506 Ga0501069_0053764 3300049585 Bacteria 2242
507 Ga0501070_0019174 3300049586 Bacteria 5737
508 Ga0501070_0231463 3300049586 Archaea 1514
509 Ga0501070_0481720 3300049586 Bacteria 998
510 Ga0501071_0005923 3300049587 Bacteria 7909
511 Ga0501071_0096896 3300049587 Bacteria 2171
512 Ga0501071_0117140 3300049587 Bacteria 1972
513 Ga0501071_0233063 3300049587 Unclassified 1387
514 Ga0501072_0002327 3300049588 Bacteria 14252
515 Ga0501072_0003758 3300049588 Bacteria 11459
516 Ga0501072_0007152 3300049588 Bacteria 8467
517 Ga0501072_0033001 3300049588 Bacteria 4055
518 Ga0501073_0046682 3300049589 Bacteria 3045
519 Ga0501073_0085238 3300049589 Bacteria 2198
520 Ga0501073_0097732 3300049589 Bacteria 2039
521 Ga0501073_0311730 3300049589 Bacteria 1085
522 Ga0501074_0019343 3300049590 Bacteria 4947
523 Ga0501074_0031823 3300049590 Bacteria 3822
524 Ga0501074_0049329 3300049590 Bacteria 3039
525 Ga0501074_0095028 3300049590 Bacteria 2134
526 Ga0501074_0160941 3300049590 Bacteria 1603
527 Ga0501075_0004047 3300049591 Bacteria 9893
528 Ga0501075_0011797 3300049591 Bacteria 6196
529 Ga0501075_0019900 3300049591 Bacteria 4874
530 Ga0501075_0033917 3300049591 Bacteria 3798
531 Ga0501075_0176841 3300049591 Bacteria 1628
532 Ga0501075_0182154 3300049591 Bacteria 1602
533 Ga0501075_0199524 3300049591 Bacteria 1526
534 Ga0501076_0002568 3300049592 Bacteria 12484
535 Ga0501076_0003503 3300049592 Bacteria 11030
536 Ga0501076_0016358 3300049592 Bacteria 5624
537 Ga0501076_0083280 3300049592 Bacteria 2569
538 Ga0501076_0260446 3300049592 Bacteria 1420
539 Ga0501076_0263385 3300049592 Bacteria 1411
540 Ga0501077_0001034 3300049593 Bacteria 16812
541 Ga0501077_0002923 3300049593 Bacteria 10251
542 Ga0501077_0011255 3300049593 Bacteria 5583
543 Ga0501077_0067603 3300049593 Bacteria 2265
544 Ga0501077_0125267 3300049593 Unclassified 1628
545 Ga0501079_0012125 3300049741 Bacteria 6580
546 Ga0501079_0012179 3300049741 Bacteria 6565
547 Ga0501079_0020392 3300049741 Bacteria 5066
548 Ga0501079_0040682 3300049741 Bacteria 3586
549 Ga0501079_0069672 3300049741 Bacteria 2715
550 Ga0501079_0132643 3300049741 Bacteria 1939
551 Ga0501079_0197744 3300049741 Bacteria 1569
552 Ga0501080_0006433 3300049742 Bacteria 10543
553 Ga0501080_0013557 3300049742 Bacteria 7503
554 Ga0501080_0087670 3300049742 Bacteria 2891
555 Ga0501080_0301272 3300049742 Archaea 1454
556 Ga0501080_0502330 3300049742 Bacteria 1084
557 Ga0501081_0006444 3300049743 Bacteria 7617
558 Ga0501081_0008703 3300049743 Bacteria 6596
559 Ga0501081_0017081 3300049743 Bacteria 4798
560 Ga0501081_0028015 3300049743 Bacteria 3799
561 Ga0501081_0062703 3300049743 Bacteria 2579
562 Ga0501081_0199537 3300049743 Bacteria 1450
563 Ga0501081_0207884 3300049743 Bacteria 1421
564 Ga0501083_0017700 3300049744 Bacteria 4969
565 Ga0501083_0092390 3300049744 Bacteria 1998
566 Ga0501083_0124860 3300049744 Bacteria 1687
567 Ga0501083_0151684 3300049744 Bacteria 1517
568 Ga0501035_0009648 3300049822 Bacteria 8978
569 Ga0501035_0037353 3300049822 Bacteria 4398
570 Ga0501035_0062526 3300049822 Bacteria 3313
571 Ga0501035_0104046 3300049822 Bacteria 2490
572 Ga0501044_0067505 3300049823 Bacteria 3644
573 Ga0501045_0014465 3300049824 Bacteria 5592
574 Ga0501045_0079071 3300049824 Bacteria 2424
575 Ga0501045_0145399 3300049824 Bacteria 1764
576 Ga0501045_0187667 3300049824 Bacteria 1540
577 nmdc:mga00v17_406073_c1 3300050491 Bacteria 885
578 nmdc:mga0yw44_4853_c2 3300050492 Bacteria 5672
579 nmdc:mga05p37_465308_c1 3300050507 Archaea 1460
580 nmdc:mga05p37_5841_c2 3300050507 Bacteria 10530
581 nmdc:mga06r32_655197_c1 3300050510 Unclassified 1018
582 nmdc:mga08y16_157665_c1 3300050511 Bacteria 2359
583 nmdc:mga08y16_578951_c1 3300050511 Unclassified 1133
584 nmdc:mga0a205_8363_c1 3300050515 Bacteria 9412
585 nmdc:mga0a205_840628_c1 3300050515 Bacteria 765
586 Ga0495612_0157588 3300053078 Bacteria 990
587 Ga0495655_0044135 3300053083 Bacteria 1152
588 Ga0495595_0075665 3300053084 Bacteria 1597
589 Ga0495619_0179126 3300053085 Unclassified 1466
590 Ga0501084_0006463 3300054114 Bacteria 9638
591 Ga0501084_0010024 3300054114 Bacteria 7827
592 Ga0501084_0013735 3300054114 Bacteria 6702
593 Ga0501084_0037042 3300054114 Bacteria 4075
594 Ga0501084_0287079 3300054114 Bacteria 1389
595 Ga0501082_0003992 3300060353 Bacteria 12878
596 Ga0501082_0004592 3300060353 Bacteria 12065
597 Ga0501082_0007538 3300060353 Bacteria 9388
598 Ga0501082_0046153 3300060353 Bacteria 3756
599 Ga0501082_0160346 3300060353 Bacteria 1954
600 Ga0501082_0658213 3300060353 Archaea 917
601 Ga0466962_0233401 3300061719 Bacteria 902
602 Ga0530510_0012356 3300061734 Bacteria 5997
603 Ga0530510_0052261 3300061734 Bacteria 2953
604 Ga0530510_0083757 3300061734 Bacteria 2322
605 Ga0530510_0102895 3300061734 Bacteria 2089
606 Ga0105243_10416626
607 ARSoilOldRDRAFT_c009932
608 JGI24739J22299_10035832
609 JGI24743J22301_10005203
610 JGI24738J21930_10005569
611 JGI25406J46586_10040463
612 Ga0070658_10119662
613 Ga0070683_100031599
614 Ga0070683_100044042
615 Ga0070683_100045947
616 Ga0070683_100133958
617 Ga0070683_100225107
618 Ga0070683_100752793
619 Ga0070670_100098812
620 Ga0070670_100293172
621 Ga0070670_100683416
622 Ga0068869_100144702
623 Ga0068869_100977688
624 Ga0070680_100006280
625 Ga0070680_100062689
626 Ga0070682_100030833
627 Ga0070682_100059146
628 Ga0070682_100095936
629 Ga0070682_100454119
630 Ga0070682_100455509
631 Ga0068868_100157542
632 Ga0068868_100281276
633 Ga0070660_100135498
634 Ga0070689_100334267
635 Ga0070691_10032236
636 Ga0070691_10088808
637 Ga0070661_100017514
638 Ga0070661_100168985
639 Ga0070668_100091866
640 Ga0070668_100103335
641 Ga0070675_100027707
642 Ga0070675_100069322
643 Ga0070674_100071031
644 Ga0070674_100138997
645 Ga0070673_100005153
646 Ga0070673_100007612
647 Ga0070659_100009185
648 Ga0070659_100010513
649 Ga0070659_100031388
650 Ga0070659_100064759
651 Ga0070659_100376391
652 Ga0070667_100298941
653 Ga0070701_10006182
654 Ga0070701_10019521
655 Ga0070701_10121580
656 Ga0070705_100001459
657 Ga0070705_100120696
658 Ga0070700_100057241
659 Ga0070700_100417384
660 Ga0070694_100330198
661 Ga0070694_100512866
662 Ga0070663_100011865
663 Ga0070678_100000052
664 Ga0070678_100015082
665 Ga0070678_100261374
666 Ga0070662_100036282
667 Ga0070662_100060621
668 Ga0070681_10161743
669 Ga0068867_100554733
670 Ga0070685_10007843
671 Ga0070685_10062379
672 Ga0070685_10283100
673 Ga0070698_100102616
674 Ga0070699_100070877
675 Ga0070699_100699930
676 Ga0070679_100063253
677 Ga0070679_100071314
678 Ga0070679_100142937
679 Ga0070679_100208506
680 Ga0070679_100351783
681 Ga0070684_100009821
682 Ga0070684_100030081
683 Ga0070684_100105826
684 Ga0070684_100147719
685 Ga0070684_100173337
686 Ga0070684_100213617
687 Ga0070684_100399143
688 Ga0070697_100162445
689 Ga0068853_100012719
690 Ga0068853_100067239
691 Ga0068853_100088341
692 Ga0070672_100103175
693 Ga0070672_100158549
694 Ga0070686_100001674
695 Ga0070686_100146896
696 Ga0070686_100232857
697 Ga0070696_100152127
698 Ga0070696_100580628
699 Ga0070693_100009212
700 Ga0070693_100016326
701 Ga0070693_100081932
702 Ga0070693_100164333
703 Ga0070665_100046359
704 Ga0070665_100103425
705 Ga0070704_100023046
706 Ga0070704_100296643
707 Ga0070704_100390061
708 Ga0068855_100033474
709 Ga0070664_100061110
710 Ga0070664_100071615
711 Ga0070664_100096048
712 Ga0070664_100603663
713 Ga0068857_100030114
714 Ga0068857_100156668
715 Ga0068854_100066826
716 Ga0068854_100137398
717 Ga0068856_100032298
718 Ga0068856_100094815
719 Ga0070702_100044763
720 Ga0070702_100052912
721 Ga0070702_100058184
722 Ga0070702_100105698
723 Ga0070702_100223072
724 Ga0068852_100558112
725 Ga0068859_100094205
726 Ga0068864_100019754
727 Ga0068866_10008968
728 Ga0068866_10076202
729 Ga0068866_10157838
730 Ga0068866_10357162
731 Ga0068861_100028780
732 Ga0068851_10009084
733 Ga0068870_10016192
734 Ga0068870_10059327
735 Ga0068863_100110603
736 Ga0068858_100047996
737 Ga0068858_100206649
738 Ga0068858_100230765
739 Ga0068860_100027023
740 Ga0068860_100446760
741 Ga0068862_100131730
742 Ga0081455_10013098
743 Ga0081455_10026506
744 Ga0081455_10411539
745 Ga0081538_10031464
746 Ga0081539_10000200
747 Ga0075364_10020761
748 Ga0075364_10149290
749 Ga0075432_10018362
750 Ga0070715_10019378
751 Ga0097621_100026124
752 Ga0068871_100046109
753 Ga0068871_100314221
754 Ga0068871_100506477
755 Ga0075428_100260262
756 Ga0075428_100469626
757 Ga0075431_100713536
758 Ga0075433_10118193
759 Ga0075433_10924960
760 Ga0068865_100008991
761 Ga0068865_100031732
762 Ga0097620_100094200
763 Ga0105240_10245173
764 Ga0111539_10157964
765 Ga0111539_10833348
766 Ga0105245_10023597
767 Ga0105245_10046418
768 Ga0105245_10070046
769 Ga0105245_10143776
770 Ga0105245_10978751
771 Ga0114129_10038780
772 Ga0114129_10131500
773 Ga0114129_11421874
774 Ga0114129_11518467
775 Ga0105243_10007909
776 Ga0105243_10009015
777 Ga0105243_10023935
778 Ga0105243_10097084
779 Ga0105243_10164351
780 Ga0105241_10100207
781 Ga0105241_10159922
782 Ga0105242_10009065
783 Ga0105242_10040774
784 Ga0105242_10557308
785 Ga0105242_11187675
786 Ga0105248_10015219
787 Ga0105248_10024950
788 Ga0105248_10045330
789 Ga0105248_11043442
790 Ga0105237_10390820
791 Ga0105238_10160285
792 Ga0105238_10252584
793 Ga0105249_10085675
794 Ga0105249_10641698
795 Ga0105249_10687761
796 Ga0105239_10031030
797 Ga0105239_10250057
798 Ga0105246_10008656
799 Ga0105246_10111951
800 Ga0157371_10029676
801 Ga0157371_10137294
802 Ga0157369_10013890
803 Ga0157369_10102394
804 Ga0157378_10001752
805 Ga0163162_10259427
806 Ga0157372_10049404
807 Ga0157372_10124270
808 Ga0157372_10287824
809 Ga0157375_10064949
810 Ga0157375_10072916
811 Ga0157375_10080233
812 Ga0157375_10654906
813 Ga0163163_10245031
814 Ga0157380_10000820
815 Ga0157380_10573076
816 Ga0182008_10197189
817 Ga0157377_10005680
818 Ga0157377_10009457
819 Ga0157377_10015087
820 Ga0157377_10111314
821 Ga0157377_10406336
822 Ga0157379_10009631
823 Ga0157379_10059591
824 Ga0157379_10094192
825 Ga0157376_10014368
826 Ga0157376_10036180
827 Ga0157376_10211245
828 Ga0163161_10053935
829 Ga0206351_10482556
830 Ga0206350_11107442
831 Ga0206354_11183149
832 Ga0206353_10994781
833 Ga0206353_11119996
834 Ga0207653_10066552
835 Ga0207642_10005610
836 Ga0207688_10001403
837 Ga0207688_10006162
838 Ga0207688_10194107
839 Ga0207680_10288812
840 Ga0207647_10199761
841 Ga0207685_10280871
842 Ga0207645_10023350
843 Ga0207643_10033044
844 Ga0207643_10114507
845 Ga0207705_10065729
846 Ga0207707_10238996
847 Ga0207707_10253793
848 Ga0207695_10056425
849 Ga0207660_10049258
850 Ga0207662_10067432
851 Ga0207662_10107962
852 Ga0207657_10001010
853 Ga0207657_10059901
854 Ga0207657_10186079
855 Ga0207657_10265952
856 Ga0207649_10034246
857 Ga0207649_10035028
858 Ga0207649_10166286
859 Ga0207652_10064630
860 Ga0207694_10155637
861 Ga0207694_10297908
862 Ga0207650_10096434
863 Ga0207650_10112424
864 Ga0207687_10008752
865 Ga0207687_10102095
866 Ga0207687_10136027
867 Ga0207690_10069688
868 Ga0207706_10023980
869 Ga0207706_10033910
870 Ga0207706_10039259
871 Ga0207706_10051168
872 Ga0207686_10074483
873 Ga0207686_10159028
874 Ga0207686_10178591
875 Ga0207686_10247646
876 Ga0207686_10316933
877 Ga0207709_10022156
878 Ga0207709_10022551
879 Ga0207709_10023219
880 Ga0207709_10083159
881 Ga0207709_10274812
882 Ga0207669_10019183
883 Ga0207669_10198467
884 Ga0207704_10029907
885 Ga0207704_10710805
886 Ga0207665_10391597
887 Ga0207691_10010456
888 Ga0207691_10026609
889 Ga0207691_10096134
890 Ga0207691_10513083
891 Ga0207711_10023268
892 Ga0207711_10123290
893 Ga0207711_10222058
894 Ga0207711_10409906
895 Ga0207711_10543187
896 Ga0207689_10047479
897 Ga0207661_10002116
898 Ga0207661_10102126
899 Ga0207661_10117674
900 Ga0207661_10123419
901 Ga0207661_10259337
902 Ga0207661_10391893
903 Ga0207679_10135944
904 Ga0207679_10240673
905 Ga0207679_10303011
906 Ga0207679_10356303
907 Ga0207667_10285817
908 Ga0207667_10649629
909 Ga0207651_10042627
910 Ga0207712_10049006
911 Ga0207712_10336470
912 Ga0207668_10082938
913 Ga0207640_10076045
914 Ga0207658_10059380
915 Ga0207677_10233022
916 Ga0207677_10438266
917 Ga0207677_10571710
918 Ga0207703_10108622
919 Ga0207703_10742213
920 Ga0207639_10066505
921 Ga0207639_10070000
922 Ga0207639_10204830
923 Ga0207639_10568360
924 Ga0207678_10025385
925 Ga0207678_10482932
926 Ga0207708_10026938
927 Ga0207708_10029313
928 Ga0207708_10210356
929 Ga0207708_10405516
930 Ga0207702_10094097
931 Ga0207702_10115772
932 Ga0207641_10324022
933 Ga0207648_10023616
934 Ga0207648_10043885
935 Ga0207648_10082064
936 Ga0207648_10194353
937 Ga0207648_10523448
938 Ga0207648_10592160
939 Ga0207674_10017040
940 Ga0207674_10027394
941 Ga0207674_10248810
942 Ga0207674_10332750
943 Ga0207674_10653180
944 Ga0207675_100014934
945 Ga0207675_100129978
946 Ga0207683_10000088
947 Ga0207683_10003610
948 Ga0207683_10016673
949 Ga0207683_10205089
950 Ga0207683_10346410
951 Ga0207698_10073734
952 Ga0207698_10559089
953 Ga0207698_10629085
954 Ga0207428_10000244
955 Ga0207428_10050859
956 Ga0207428_10149851
957 Ga0268266_10067580
958 Ga0268265_10132980
959 Ga0268265_10615168
960 Ga0268264_10104619
961 Ga0265319_1015620
962 Ga0265318_10008787
963 Ga0265338_10070748
964 Ga0265320_10014826
965 Ga0265320_10070740
966 Ga0265320_10100366
967 Ga0265340_10076615
968 Ga0307408_100223764
969 Ga0265313_10107135
970 Ga0307405_10388174
971 Ga0307410_10543068
972 Ga0307406_10818474
973 Ga0307407_10095402
974 Ga0307409_100060552
975 Ga0373938_0035511
976 Ga0373954_0053157
977 Ga0373960_0002607
978 Ga0373931_0101830
979 Ga0373925_0187262
980 Ga0395900_0219544
981 Ga0395898_0406647
982 Ga0395901_0454210
983 Ga0395901_0790099
984 Ga0451807_1742402
985 Ga0439445_0062318
986 Ga0439448_0113386
987 Ga0439432_104426
988 Ga0439449_0079620
989 Ga0439462_0007795
990 Ga0450914_000276
991 Ga0450906_012059
992 Ga0439446_0001483
993 Ga0439459_0020854
994 Ga0466966_0013574
995 Ga0466961_0040354
996 Ga0466961_0218860
997 Ga0466963_0108183
998 Ga0466963_0256828
999 Ga0466957_0396843
1000 Ga0466959_0040893
1001 Ga0466967_0256603
1002 Ga0466967_0440093
1003 Ga0495603_0006748
1004 Ga0495603_0030234
1005 Ga0495603_0086270
1006 Ga0495641_0090870
1007 Ga0495582_0122111
1008 Ga0495596_0144180
1009 Ga0495637_0093037
1010 Ga0495644_0091114
1011 Ga0495656_0013806
1012 Ga0495634_0188294
1013 Ga0495659_0175426
1014 Ga0495658_0157095
1015 Ga0495604_0315596
1016 Ga0495602_0523589
1017 Ga0496100_0083321
1018 Ga0496101_0001935
1019 Ga0496101_0116460
1020 Ga0496102_0262912
1021 Ga0496102_0309936
1022 Ga0496103_0016856
1023 Ga0496104_0075582
1024 Ga0496105_0001655
1025 Ga0496105_0110301
1026 Ga0496105_0465631
1027 Ga0496106_0067900
1028 Ga0496106_0236419
1029 Ga0496107_0011271
1030 Ga0496107_0241251
1031 Ga0496108_0009092
1032 Ga0496108_0024449
1033 Ga0496108_0063926
1034 Ga0496108_0213713
1035 Ga0496109_0008352
1036 Ga0496109_0128506
1037 Ga0496109_0293917
1038 Ga0496110_0013159
1039 Ga0496110_0060184
1040 Ga0496110_0074971
1041 Ga0496110_0084249
1042 Ga0496111_0002857
1043 Ga0496111_0023990
1044 Ga0496111_0122453
1045 Ga0496112_0020518
1046 Ga0496112_0414650
1047 Ga0496112_0900082
1048 Ga0496113_0053237
1049 Ga0496114_0035638
1050 Ga0496114_0079772
1051 Ga0496114_0087087
1052 Ga0496114_0138237
1053 Ga0496114_0411360
1054 Ga0496114_0418944
1055 Ga0501031_0015535
1056 Ga0501031_0026848
1057 Ga0501031_0052869
1058 Ga0501032_0031634
1059 Ga0501032_0063572
1060 Ga0501032_0180072
1061 Ga0501033_0022921
1062 Ga0501033_0050721
1063 Ga0501033_0152906
1064 Ga0501034_0068007
1065 Ga0501034_0186625
1066 Ga0501036_0002878
1067 Ga0501036_0007924
1068 Ga0501036_0024789
1069 Ga0501036_0176644
1070 Ga0501037_0071846
1071 Ga0501037_0141275
1072 Ga0501038_0022126
1073 Ga0501038_0037681
1074 Ga0501038_0099779
1075 Ga0501038_0271444
1076 Ga0501039_0003065
1077 Ga0501039_0008700
1078 Ga0501039_0011656
1079 Ga0501039_0052617
1080 Ga0501039_0077813
1081 Ga0501039_0165130
1082 Ga0501039_0173222
1083 Ga0501040_0006377
1084 Ga0501040_0015305
1085 Ga0501040_0510060
1086 Ga0501041_0009685
1087 Ga0501041_0014045
1088 Ga0501041_0032310
1089 Ga0501041_0073589
1090 Ga0501041_0196945
1091 Ga0501042_0005099
1092 Ga0501042_0022473
1093 Ga0501042_0046879
1094 Ga0501042_0091668
1095 Ga0501042_0617039
1096 Ga0501043_0194724
1097 Ga0501043_0203376
1098 Ga0501046_0017152
1099 Ga0501046_0019020
1100 Ga0501046_0020889
1101 Ga0501046_0089731
1102 Ga0501046_0184611
1103 Ga0501048_0038176
1104 Ga0501048_0120565
1105 Ga0501067_0000374
1106 Ga0501067_0170092
1107 Ga0501068_0007668
1108 Ga0501068_0012680
1109 Ga0501068_0038057
1110 Ga0501069_0012844
1111 Ga0501069_0053764
1112 Ga0501070_0019174
1113 Ga0501070_0231463
1114 Ga0501070_0481720
1115 Ga0501071_0005923
1116 Ga0501071_0096896
1117 Ga0501071_0117140
1118 Ga0501071_0233063
1119 Ga0501072_0002327
1120 Ga0501072_0003758
1121 Ga0501072_0007152
1122 Ga0501072_0033001
1123 Ga0501073_0046682
1124 Ga0501073_0085238
1125 Ga0501073_0097732
1126 Ga0501073_0311730
1127 Ga0501074_0019343
1128 Ga0501074_0031823
1129 Ga0501074_0049329
1130 Ga0501074_0095028
1131 Ga0501074_0160941
1132 Ga0501075_0004047
1133 Ga0501075_0011797
1134 Ga0501075_0019900
1135 Ga0501075_0033917
1136 Ga0501075_0176841
1137 Ga0501075_0182154
1138 Ga0501075_0199524
1139 Ga0501076_0002568
1140 Ga0501076_0003503
1141 Ga0501076_0016358
1142 Ga0501076_0083280
1143 Ga0501076_0260446
1144 Ga0501076_0263385
1145 Ga0501077_0001034
1146 Ga0501077_0002923
1147 Ga0501077_0011255
1148 Ga0501077_0067603
1149 Ga0501077_0125267
1150 Ga0501079_0012125
1151 Ga0501079_0012179
1152 Ga0501079_0020392
1153 Ga0501079_0040682
1154 Ga0501079_0069672
1155 Ga0501079_0132643
1156 Ga0501079_0197744
1157 Ga0501080_0006433
1158 Ga0501080_0013557
1159 Ga0501080_0087670
1160 Ga0501080_0301272
1161 Ga0501080_0502330
1162 Ga0501081_0006444
1163 Ga0501081_0008703
1164 Ga0501081_0017081
1165 Ga0501081_0028015
1166 Ga0501081_0062703
1167 Ga0501081_0199537
1168 Ga0501081_0207884
1169 Ga0501083_0017700
1170 Ga0501083_0092390
1171 Ga0501083_0124860
1172 Ga0501083_0151684
1173 Ga0501035_0009648
1174 Ga0501035_0037353
1175 Ga0501035_0062526
1176 Ga0501035_0104046
1177 Ga0501044_0067505
1178 Ga0501045_0014465
1179 Ga0501045_0079071
1180 Ga0501045_0145399
1181 Ga0501045_0187667
1182 nmdc:mga00v17_406073_c1
1183 nmdc:mga0yw44_4853_c2
1184 nmdc:mga05p37_465308_c1
1185 nmdc:mga05p37_5841_c2
1186 nmdc:mga06r32_655197_c1
1187 nmdc:mga08y16_157665_c1
1188 nmdc:mga08y16_578951_c1
1189 nmdc:mga0a205_8363_c1
1190 nmdc:mga0a205_840628_c1
1191 Ga0495612_0157588
1192 Ga0495655_0044135
1193 Ga0495595_0075665
1194 Ga0495619_0179126
1195 Ga0501084_0006463
1196 Ga0501084_0010024
1197 Ga0501084_0013735
1198 Ga0501084_0037042
1199 Ga0501084_0287079
1200 Ga0501082_0003992
1201 Ga0501082_0004592
1202 Ga0501082_0007538
1203 Ga0501082_0046153
1204 Ga0501082_0160346
1205 Ga0501082_0658213
1206 Ga0466962_0233401
1207 Ga0530510_0012356
1208 Ga0530510_0052261
1209 Ga0530510_0083757
1210 Ga0530510_0102895

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12706

Lactamase_B_2

Beta-lactamase superfamily domain

36

215

0.85

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

20

214

0.84

PF13483

Lactamase_B_3

Beta-lactamase superfamily domain

19

214

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
3x30-assembly1.cif.gz_A crystal structure of metallo-beta-lactamase from thermotoga maritima 0.9522 3 235
3x2x-assembly1.cif.gz_C crystal structure of metallo-beta-lactamase h48a from thermotoga maritima 0.9467 3 235
3x30-assembly1.cif.gz_A crystal structure of metallo-beta-lactamase from thermotoga maritima 0.944 3 235
3x2x-assembly1.cif.gz_C crystal structure of metallo-beta-lactamase h48a from thermotoga maritima 0.9387 3 235
7e3w-assembly1.cif.gz_C metallo beta-lactamase fold protein (camp bound) 0.9376 3 235
ID Description Score Start End Superfamily
af_Q2FXM0_1_229_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9473 4 235 3.60.15.10
af_Q2FXM0_1_229_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9393 4 235 3.60.15.10
3x30A00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9178 4 235 3.60.15.10
3x30A00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9098 4 235 3.60.15.10
af_Q58563_1_217_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8981 5 235 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A7W0TCX9-F1-model_v4 UPF0173 metal-dependent hydrolase H0U05_09140 0.9921 1 235 GO:0016787
AF-A0A7W0TCX9-F1-model_v4 UPF0173 metal-dependent hydrolase H0U05_09140 0.9879 1 235 GO:0016787
AF-A0A538GAP3-F1-model_v4 Metal-dependent hydrolase 0.9834 158 235
AF-A0A351B0Z3-F1-model_v4 deleted 0.9826 158 233
AF-A0A7J9YQF1-F1-model_v4 UPF0173 metal-dependent hydrolase GEU88_00955 0.981 2 234 GO:0016787

Map