F468485
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 605 | 284 | 605 | 390 |
Family's Representative Sequence
| Representative Sequence | 3300026116|Ga0207674_10180666|Ga0207674_101806662 |
| Length | 443 |
| Sequence | MPYFDLDPLLETMLDYSPGISDLNLSVGRPPQVELDGQLRPVAYAGIERLLPYQTELIAMRLLAGKRDLADKLVRTGSVDLSYSLAKRTRFRVNVFAQRGSYSVVLRVIPNKIPTVEELGIPPQLNEIGNERNGIVLVTGPTGSGKSTTLAAIINKINQDKAIHIITIEDPIEYLHPHVKSTINQREVGADTQTFALALRAALRQAPKVILVGEMRDVETISIALEASETGHLVLSTLHTIDASKTIDRIVGVFPKNEERQVRTRFSQAFKWVVSQRLVPKQGGGRQAICEILRSTSRTKEYVQEGEREGKSLIDAMADGQLEGMQTFDGELEKLINAGLIDKETGLSYATNRTNLQLVLETGGNNMTDEPQFTRFEAEFIAGYVYGRCLPDDQVIRKTDYVKLYQYIDEALILIGRTTTFERQAMKEIEDLLGGKDVQEESG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 2 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 33 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 42 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 48 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 49 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 50 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 52 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 53 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 54 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 55 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 56 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 57 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 58 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 60 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 61 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 62 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 63 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 64 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 65 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 66 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 67 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 68 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 69 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 70 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 71 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 72 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 73 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 75 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 93 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 95 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 96 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 97 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 98 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 138 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 142 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 143 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 144 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 145 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 146 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 147 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 148 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 149 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 150 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 151 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 152 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 153 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 154 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 155 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 156 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 157 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 158 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 159 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 160 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 161 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 162 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 163 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 164 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 165 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 166 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 167 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 168 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 169 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 170 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 171 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 172 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 173 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 174 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 175 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 176 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 177 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 178 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 179 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 180 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 181 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 182 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 183 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 184 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 185 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 186 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 187 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 188 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 189 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 190 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 191 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 192 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 193 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 194 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 195 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 196 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 197 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 198 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 199 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 200 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 201 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 202 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 203 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 204 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 205 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 206 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 207 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 208 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 209 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 210 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 211 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 212 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 213 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 214 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 215 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 216 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 217 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 218 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 219 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 241 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 242 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 243 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 246 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 248 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 250 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 269 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 270 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 271 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 272 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 273 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 274 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 284 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.34 |
| Metatranscriptomes | 0.66 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.14 |
| Nodule | 0 |
| Rhizoplane | 0.5 |
| Rhizosphere | 92.4 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.97 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH2_10054090 | 3300003320 | Bacteria | 5928 |
| 2 | Ga0065715_10103480 | 3300005293 | Unclassified | 3019 |
| 3 | Ga0070658_10056106 | 3300005327 | Bacteria | 3201 |
| 4 | Ga0070658_10074775 | 3300005327 | Bacteria | 2778 |
| 5 | Ga0070683_100006797 | 3300005329 | Bacteria | 9614 |
| 6 | Ga0070683_100030105 | 3300005329 | Bacteria | 4922 |
| 7 | Ga0070683_100202931 | 3300005329 | Bacteria | 1883 |
| 8 | Ga0070690_100007018 | 3300005330 | Bacteria | 6422 |
| 9 | Ga0070690_100021471 | 3300005330 | Bacteria | 3943 |
| 10 | Ga0070690_100129028 | 3300005330 | Bacteria | 1705 |
| 11 | Ga0070690_100150748 | 3300005330 | Bacteria | 1586 |
| 12 | Ga0070670_100002462 | 3300005331 | Bacteria | 15271 |
| 13 | Ga0068869_100002310 | 3300005334 | Bacteria | 11473 |
| 14 | Ga0068869_100011381 | 3300005334 | Bacteria | 5833 |
| 15 | Ga0068869_100014927 | 3300005334 | Bacteria | 5193 |
| 16 | Ga0070666_10028244 | 3300005335 | Bacteria | 3680 |
| 17 | Ga0070666_10031519 | 3300005335 | Bacteria | 3499 |
| 18 | Ga0068868_100082652 | 3300005338 | Bacteria | 2576 |
| 19 | Ga0070660_100002320 | 3300005339 | Bacteria | 13081 |
| 20 | Ga0070660_100005436 | 3300005339 | Bacteria | 8824 |
| 21 | Ga0070660_100108286 | 3300005339 | Bacteria | 2208 |
| 22 | Ga0070689_100052289 | 3300005340 | Bacteria | 3159 |
| 23 | Ga0070691_10024267 | 3300005341 | Bacteria | 2818 |
| 24 | Ga0070661_100042426 | 3300005344 | Bacteria | 3320 |
| 25 | Ga0070661_100152321 | 3300005344 | Bacteria | 1748 |
| 26 | Ga0070668_100122503 | 3300005347 | Bacteria | 2080 |
| 27 | Ga0070668_100127101 | 3300005347 | Bacteria | 2042 |
| 28 | Ga0070669_100129148 | 3300005353 | Bacteria | 1936 |
| 29 | Ga0070675_100010502 | 3300005354 | Bacteria | 7233 |
| 30 | Ga0070671_100118589 | 3300005355 | Bacteria | 2226 |
| 31 | Ga0070674_100021050 | 3300005356 | Bacteria | 4180 |
| 32 | Ga0070673_100152841 | 3300005364 | Bacteria | 1956 |
| 33 | Ga0070673_100183679 | 3300005364 | Bacteria | 1791 |
| 34 | Ga0070688_100059959 | 3300005365 | Bacteria | 2402 |
| 35 | Ga0070688_100098166 | 3300005365 | Bacteria | 1926 |
| 36 | Ga0070688_100202389 | 3300005365 | Bacteria | 1390 |
| 37 | Ga0070659_100163212 | 3300005366 | Bacteria | 1822 |
| 38 | Ga0070667_100002607 | 3300005367 | Bacteria | 15648 |
| 39 | Ga0070714_100015285 | 3300005435 | Bacteria | 6175 |
| 40 | Ga0070713_100081604 | 3300005436 | Bacteria | 2759 |
| 41 | Ga0070701_10006287 | 3300005438 | Bacteria | 4986 |
| 42 | Ga0070711_100006453 | 3300005439 | Bacteria | 7072 |
| 43 | Ga0070700_100016277 | 3300005441 | Bacteria | 4235 |
| 44 | Ga0070694_100027022 | 3300005444 | Bacteria | 3724 |
| 45 | Ga0070694_100206913 | 3300005444 | Bacteria | 1465 |
| 46 | Ga0070708_100011673 | 3300005445 | Bacteria | 7149 |
| 47 | Ga0070708_100046444 | 3300005445 | Bacteria | 3832 |
| 48 | Ga0070678_100104839 | 3300005456 | Bacteria | 2200 |
| 49 | Ga0070681_10030459 | 3300005458 | Bacteria | 5413 |
| 50 | Ga0070681_10054309 | 3300005458 | Bacteria | 3992 |
| 51 | Ga0070681_10074824 | 3300005458 | Bacteria | 3347 |
| 52 | Ga0068867_100033566 | 3300005459 | Bacteria | 3717 |
| 53 | Ga0068867_100236012 | 3300005459 | Bacteria | 1481 |
| 54 | Ga0070685_10023854 | 3300005466 | Bacteria | 3353 |
| 55 | Ga0070706_100002661 | 3300005467 | Bacteria | 17903 |
| 56 | Ga0070706_100036392 | 3300005467 | Bacteria | 4546 |
| 57 | Ga0070706_100203695 | 3300005467 | Bacteria | 1848 |
| 58 | Ga0070707_100099636 | 3300005468 | Bacteria | 2815 |
| 59 | Ga0070698_100004488 | 3300005471 | Bacteria | 15349 |
| 60 | Ga0070698_100008136 | 3300005471 | Bacteria | 11336 |
| 61 | Ga0070698_100012216 | 3300005471 | Bacteria | 9099 |
| 62 | Ga0070698_100022136 | 3300005471 | Bacteria | 6653 |
| 63 | Ga0070698_100036805 | 3300005471 | Bacteria | 5051 |
| 64 | Ga0070699_100024049 | 3300005518 | Bacteria | 5250 |
| 65 | Ga0070699_100167319 | 3300005518 | Bacteria | 1947 |
| 66 | Ga0070679_100068279 | 3300005530 | Bacteria | 3546 |
| 67 | Ga0070679_100132479 | 3300005530 | Bacteria | 2474 |
| 68 | Ga0070684_100005906 | 3300005535 | Bacteria | 9427 |
| 69 | Ga0070697_100004973 | 3300005536 | Bacteria | 10206 |
| 70 | Ga0070697_100062942 | 3300005536 | Bacteria | 3029 |
| 71 | Ga0070697_100088508 | 3300005536 | Bacteria | 2557 |
| 72 | Ga0068853_100236443 | 3300005539 | Bacteria | 1673 |
| 73 | Ga0070672_100032584 | 3300005543 | Bacteria | 3935 |
| 74 | Ga0070695_100000332 | 3300005545 | Bacteria | 24281 |
| 75 | Ga0070695_100056111 | 3300005545 | Bacteria | 2541 |
| 76 | Ga0070696_100216558 | 3300005546 | Bacteria | 1435 |
| 77 | Ga0070665_100078493 | 3300005548 | Bacteria | 3308 |
| 78 | Ga0070665_100108904 | 3300005548 | Bacteria | 2773 |
| 79 | Ga0070704_100038753 | 3300005549 | Bacteria | 3267 |
| 80 | Ga0070704_100127547 | 3300005549 | Bacteria | 1966 |
| 81 | Ga0070704_100220523 | 3300005549 | Bacteria | 1542 |
| 82 | Ga0068855_100039565 | 3300005563 | Bacteria | 5598 |
| 83 | Ga0068855_100045953 | 3300005563 | Bacteria | 5162 |
| 84 | Ga0068855_100125625 | 3300005563 | Bacteria | 2933 |
| 85 | Ga0068855_100133062 | 3300005563 | Bacteria | 2839 |
| 86 | Ga0068855_100330392 | 3300005563 | Bacteria | 1683 |
| 87 | Ga0068857_100005362 | 3300005577 | Bacteria | 10933 |
| 88 | Ga0068856_100001681 | 3300005614 | Bacteria | 23153 |
| 89 | Ga0068856_100029138 | 3300005614 | Bacteria | 5392 |
| 90 | Ga0068856_100041360 | 3300005614 | Bacteria | 4529 |
| 91 | Ga0070702_100127938 | 3300005615 | Bacteria | 1600 |
| 92 | Ga0070702_100149438 | 3300005615 | Bacteria | 1498 |
| 93 | Ga0068852_100395111 | 3300005616 | Bacteria | 1359 |
| 94 | Ga0068859_100023044 | 3300005617 | Bacteria | 6243 |
| 95 | Ga0068859_100108923 | 3300005617 | Bacteria | 2831 |
| 96 | Ga0068859_100154498 | 3300005617 | Bacteria | 2371 |
| 97 | Ga0068859_100302369 | 3300005617 | Unclassified | 1693 |
| 98 | Ga0068864_100029683 | 3300005618 | Bacteria | 4634 |
| 99 | Ga0068864_100354739 | 3300005618 | Bacteria | 1385 |
| 100 | Ga0068864_100375158 | 3300005618 | Bacteria | 1347 |
| 101 | Ga0068861_100196693 | 3300005719 | Bacteria | 1689 |
| 102 | Ga0068863_100045249 | 3300005841 | Bacteria | 4177 |
| 103 | Ga0068863_100058335 | 3300005841 | Bacteria | 3653 |
| 104 | Ga0068863_100216170 | 3300005841 | Bacteria | 1846 |
| 105 | Ga0068858_100009346 | 3300005842 | Bacteria | 9360 |
| 106 | Ga0068858_100013534 | 3300005842 | Bacteria | 7698 |
| 107 | Ga0068862_100042914 | 3300005844 | Bacteria | 3854 |
| 108 | Ga0068862_100059002 | 3300005844 | Bacteria | 3293 |
| 109 | Ga0070717_10002462 | 3300006028 | Bacteria | 13073 |
| 110 | Ga0075365_10009882 | 3300006038 | Bacteria | 5522 |
| 111 | Ga0075364_10041319 | 3300006051 | Bacteria | 2994 |
| 112 | Ga0075364_10065154 | 3300006051 | Bacteria | 2391 |
| 113 | Ga0075362_10005868 | 3300006177 | Bacteria | 4530 |
| 114 | Ga0075367_10003400 | 3300006178 | Bacteria | 7583 |
| 115 | Ga0075367_10022928 | 3300006178 | Bacteria | 3508 |
| 116 | Ga0075369_10015744 | 3300006186 | Bacteria | 3040 |
| 117 | Ga0075366_10000451 | 3300006195 | Bacteria | 19121 |
| 118 | Ga0075366_10047113 | 3300006195 | Bacteria | 2555 |
| 119 | Ga0075370_10017369 | 3300006353 | Bacteria | 3886 |
| 120 | Ga0068871_100014149 | 3300006358 | Bacteria | 5937 |
| 121 | Ga0075428_100006228 | 3300006844 | Bacteria | 13272 |
| 122 | Ga0075428_100057093 | 3300006844 | Bacteria | 4274 |
| 123 | Ga0075431_100037924 | 3300006847 | Bacteria | 4962 |
| 124 | Ga0075431_100078369 | 3300006847 | Bacteria | 3410 |
| 125 | Ga0075431_100243744 | 3300006847 | Bacteria | 1827 |
| 126 | Ga0075431_100363379 | 3300006847 | Bacteria | 1453 |
| 127 | Ga0075433_10073451 | 3300006852 | Bacteria | 3008 |
| 128 | Ga0075434_100077099 | 3300006871 | Bacteria | 3328 |
| 129 | Ga0075434_100250915 | 3300006871 | Bacteria | 1789 |
| 130 | Ga0075434_100264670 | 3300006871 | Bacteria | 1739 |
| 131 | Ga0075429_100000847 | 3300006880 | Bacteria | 24024 |
| 132 | Ga0075429_100027456 | 3300006880 | Bacteria | 4941 |
| 133 | Ga0075429_100036051 | 3300006880 | Bacteria | 4302 |
| 134 | Ga0075429_100046673 | 3300006880 | Bacteria | 3769 |
| 135 | Ga0075429_100115633 | 3300006880 | Bacteria | 2345 |
| 136 | Ga0068865_100011862 | 3300006881 | Bacteria | 5467 |
| 137 | Ga0068865_100035764 | 3300006881 | Bacteria | 3344 |
| 138 | Ga0068865_100115160 | 3300006881 | Bacteria | 1989 |
| 139 | Ga0097620_100023044 | 3300006931 | Bacteria | 6243 |
| 140 | Ga0097620_100108925 | 3300006931 | Bacteria | 2831 |
| 141 | Ga0097620_100154495 | 3300006931 | Bacteria | 2371 |
| 142 | Ga0097620_100302413 | 3300006931 | Unclassified | 1693 |
| 143 | Ga0097620_100321597 | 3300006931 | Bacteria | 1641 |
| 144 | Ga0075435_100091424 | 3300007076 | Bacteria | 2511 |
| 145 | Ga0075435_100129022 | 3300007076 | Bacteria | 2115 |
| 146 | Ga0075435_100170144 | 3300007076 | Bacteria | 1838 |
| 147 | Ga0105240_10032877 | 3300009093 | Bacteria | 6708 |
| 148 | Ga0105240_10076034 | 3300009093 | Bacteria | 4141 |
| 149 | Ga0105240_10216818 | 3300009093 | Bacteria | 2232 |
| 150 | Ga0105240_10246365 | 3300009093 | Bacteria | 2069 |
| 151 | Ga0111539_10000113 | 3300009094 | Bacteria | 89042 |
| 152 | Ga0111539_10005541 | 3300009094 | Bacteria | 16324 |
| 153 | Ga0111539_10198647 | 3300009094 | Bacteria | 2339 |
| 154 | Ga0114129_10000576 | 3300009147 | Bacteria | 45211 |
| 155 | Ga0114129_10001509 | 3300009147 | Bacteria | 31480 |
| 156 | Ga0114129_10006424 | 3300009147 | Bacteria | 16668 |
| 157 | Ga0114129_10040693 | 3300009147 | Bacteria | 6551 |
| 158 | Ga0114129_10042343 | 3300009147 | Bacteria | 6413 |
| 159 | Ga0105243_10019388 | 3300009148 | Bacteria | 5158 |
| 160 | Ga0105241_10227820 | 3300009174 | Bacteria | 1570 |
| 161 | Ga0105248_10020953 | 3300009177 | Bacteria | 7246 |
| 162 | Ga0105248_10052164 | 3300009177 | Bacteria | 4590 |
| 163 | Ga0105248_10209096 | 3300009177 | Bacteria | 2198 |
| 164 | Ga0105248_10296378 | 3300009177 | Bacteria | 1821 |
| 165 | Ga0105237_10268904 | 3300009545 | Bacteria | 1708 |
| 166 | Ga0105238_10002928 | 3300009551 | Bacteria | 17040 |
| 167 | Ga0105239_10017617 | 3300010375 | Bacteria | 7901 |
| 168 | Ga0105246_10047378 | 3300011119 | Bacteria | 2935 |
| 169 | Ga0157370_10087563 | 3300013104 | Bacteria | 2925 |
| 170 | Ga0157370_10146551 | 3300013104 | Unclassified | 2198 |
| 171 | Ga0157369_10191034 | 3300013105 | Bacteria | 2152 |
| 172 | Ga0157374_10013937 | 3300013296 | Bacteria | 7026 |
| 173 | Ga0163162_10013066 | 3300013306 | Bacteria | 8104 |
| 174 | Ga0157372_10169948 | 3300013307 | Bacteria | 2522 |
| 175 | Ga0157372_10257909 | 3300013307 | Bacteria | 2024 |
| 176 | Ga0157375_10000006 | 3300013308 | Bacteria | 384086 |
| 177 | Ga0157375_10010268 | 3300013308 | Bacteria | 8240 |
| 178 | Ga0157375_10402228 | 3300013308 | Bacteria | 1536 |
| 179 | Ga0163163_10368666 | 3300014325 | Bacteria | 1493 |
| 180 | Ga0182008_10009538 | 3300014497 | Bacteria | 5232 |
| 181 | Ga0182008_10071496 | 3300014497 | Bacteria | 1707 |
| 182 | Ga0157379_10069084 | 3300014968 | Bacteria | 3159 |
| 183 | Ga0157379_10325323 | 3300014968 | Bacteria | 1404 |
| 184 | Ga0206356_10199250 | 3300020070 | Bacteria | 1501 |
| 185 | Ga0213872_10087362 | 3300021361 | Bacteria | 1397 |
| 186 | Ga0213876_10000099 | 3300021384 | Bacteria | 97202 |
| 187 | Ga0213876_10000499 | 3300021384 | Bacteria | 30548 |
| 188 | Ga0213876_10063781 | 3300021384 | Bacteria | 1945 |
| 189 | Ga0224572_1014186 | 3300024225 | Bacteria | 1522 |
| 190 | Ga0207653_10030449 | 3300025885 | Bacteria | 1741 |
| 191 | Ga0207642_10010166 | 3300025899 | Bacteria | 3303 |
| 192 | Ga0207647_10006481 | 3300025904 | Bacteria | 8505 |
| 193 | Ga0207645_10018651 | 3300025907 | Bacteria | 4558 |
| 194 | Ga0207643_10049752 | 3300025908 | Bacteria | 2375 |
| 195 | Ga0207705_10007416 | 3300025909 | Bacteria | 8066 |
| 196 | Ga0207684_10042749 | 3300025910 | Bacteria | 3842 |
| 197 | Ga0207707_10020321 | 3300025912 | Bacteria | 5799 |
| 198 | Ga0207707_10053250 | 3300025912 | Bacteria | 3523 |
| 199 | Ga0207707_10089694 | 3300025912 | Bacteria | 2687 |
| 200 | Ga0207695_10040587 | 3300025913 | Bacteria | 4987 |
| 201 | Ga0207695_10049797 | 3300025913 | Bacteria | 4412 |
| 202 | Ga0207695_10100345 | 3300025913 | Bacteria | 2891 |
| 203 | Ga0207693_10183250 | 3300025915 | Bacteria | 1648 |
| 204 | Ga0207663_10006313 | 3300025916 | Bacteria | 6052 |
| 205 | Ga0207660_10036316 | 3300025917 | Bacteria | 3425 |
| 206 | Ga0207657_10002101 | 3300025919 | Bacteria | 21549 |
| 207 | Ga0207657_10032292 | 3300025919 | Bacteria | 4732 |
| 208 | Ga0207652_10024327 | 3300025921 | Bacteria | 5024 |
| 209 | Ga0207652_10027406 | 3300025921 | Bacteria | 4748 |
| 210 | Ga0207652_10084782 | 3300025921 | Bacteria | 2776 |
| 211 | Ga0207652_10162013 | 3300025921 | Bacteria | 2005 |
| 212 | Ga0207646_10001967 | 3300025922 | Bacteria | 24656 |
| 213 | Ga0207646_10011019 | 3300025922 | Bacteria | 8780 |
| 214 | Ga0207681_10112143 | 3300025923 | Bacteria | 1985 |
| 215 | Ga0207659_10015782 | 3300025926 | Bacteria | 4904 |
| 216 | Ga0207664_10024852 | 3300025929 | Bacteria | 4504 |
| 217 | Ga0207664_10040347 | 3300025929 | Bacteria | 3629 |
| 218 | Ga0207644_10145282 | 3300025931 | Bacteria | 1831 |
| 219 | Ga0207690_10030148 | 3300025932 | Bacteria | 3457 |
| 220 | Ga0207690_10185670 | 3300025932 | Bacteria | 1569 |
| 221 | Ga0207709_10044125 | 3300025935 | Bacteria | 2692 |
| 222 | Ga0207670_10028908 | 3300025936 | Bacteria | 3525 |
| 223 | Ga0207704_10009641 | 3300025938 | Bacteria | 4669 |
| 224 | Ga0207704_10040395 | 3300025938 | Bacteria | 2726 |
| 225 | Ga0207704_10135741 | 3300025938 | Bacteria | 1712 |
| 226 | Ga0207691_10001566 | 3300025940 | Bacteria | 22711 |
| 227 | Ga0207691_10027345 | 3300025940 | Bacteria | 5347 |
| 228 | Ga0207711_10111400 | 3300025941 | Bacteria | 2434 |
| 229 | Ga0207689_10000068 | 3300025942 | Bacteria | 83861 |
| 230 | Ga0207689_10047058 | 3300025942 | Bacteria | 3563 |
| 231 | Ga0207661_10005618 | 3300025944 | Bacteria | 8841 |
| 232 | Ga0207661_10177240 | 3300025944 | Bacteria | 1859 |
| 233 | Ga0207667_10098053 | 3300025949 | Bacteria | 3024 |
| 234 | Ga0207667_10154276 | 3300025949 | Bacteria | 2363 |
| 235 | Ga0207667_10256321 | 3300025949 | Bacteria | 1789 |
| 236 | Ga0207667_10304926 | 3300025949 | Bacteria | 1627 |
| 237 | Ga0207651_10046661 | 3300025960 | Bacteria | 2915 |
| 238 | Ga0207651_10149597 | 3300025960 | Bacteria | 1815 |
| 239 | Ga0207658_10104759 | 3300025986 | Bacteria | 2223 |
| 240 | Ga0207677_10020219 | 3300026023 | Bacteria | 4038 |
| 241 | Ga0207703_10004361 | 3300026035 | Bacteria | 11626 |
| 242 | Ga0207703_10021316 | 3300026035 | Bacteria | 5074 |
| 243 | Ga0207708_10018651 | 3300026075 | Bacteria | 5226 |
| 244 | Ga0207708_10022921 | 3300026075 | Bacteria | 4716 |
| 245 | Ga0207702_10000808 | 3300026078 | Bacteria | 33196 |
| 246 | Ga0207702_10020867 | 3300026078 | Bacteria | 5420 |
| 247 | Ga0207702_10192745 | 3300026078 | Bacteria | 1884 |
| 248 | Ga0207641_10019532 | 3300026088 | Bacteria | 5562 |
| 249 | Ga0207641_10049937 | 3300026088 | Bacteria | 3537 |
| 250 | Ga0207648_10013312 | 3300026089 | Bacteria | 7660 |
| 251 | Ga0207648_10024974 | 3300026089 | Bacteria | 5327 |
| 252 | Ga0207674_10003025 | 3300026116 | Bacteria | 20840 |
| 253 | Ga0207674_10096275 | 3300026116 | Bacteria | 2945 |
| 254 | Ga0207674_10131333 | 3300026116 | Bacteria | 2467 |
| 255 | Ga0207674_10180666 | 3300026116 | Bacteria | 2061 |
| 256 | Ga0207675_100037088 | 3300026118 | Bacteria | 4547 |
| 257 | Ga0207683_10082157 | 3300026121 | Bacteria | 2862 |
| 258 | Ga0207428_10000197 | 3300027907 | Bacteria | 84315 |
| 259 | Ga0207428_10129029 | 3300027907 | Bacteria | 1935 |
| 260 | Ga0207428_10182139 | 3300027907 | Bacteria | 1587 |
| 261 | Ga0268266_10050430 | 3300028379 | Bacteria | 3571 |
| 262 | Ga0268265_10021110 | 3300028380 | Bacteria | 4555 |
| 263 | Ga0268265_10024420 | 3300028380 | Bacteria | 4276 |
| 264 | Ga0268264_10034012 | 3300028381 | Bacteria | 4191 |
| 265 | Ga0265337_1000420 | 3300028556 | Bacteria | 22614 |
| 266 | Ga0265337_1009313 | 3300028556 | Bacteria | 3511 |
| 267 | Ga0265319_1010521 | 3300028563 | Bacteria | 3852 |
| 268 | Ga0265319_1011301 | 3300028563 | Bacteria | 3661 |
| 269 | Ga0265323_10000808 | 3300028653 | Bacteria | 16811 |
| 270 | Ga0265323_10009676 | 3300028653 | Bacteria | 3927 |
| 271 | Ga0265338_10000032 | 3300028800 | Bacteria | 257580 |
| 272 | Ga0265338_10000487 | 3300028800 | Bacteria | 70806 |
| 273 | Ga0265338_10000605 | 3300028800 | Bacteria | 62898 |
| 274 | Ga0265338_10000808 | 3300028800 | Bacteria | 52850 |
| 275 | Ga0265338_10003037 | 3300028800 | Bacteria | 24157 |
| 276 | Ga0265338_10004439 | 3300028800 | Bacteria | 18945 |
| 277 | Ga0265338_10006433 | 3300028800 | Bacteria | 14972 |
| 278 | Ga0265338_10006466 | 3300028800 | Bacteria | 14930 |
| 279 | Ga0265338_10009600 | 3300028800 | Bacteria | 11496 |
| 280 | Ga0265338_10012683 | 3300028800 | Bacteria | 9591 |
| 281 | Ga0265338_10013371 | 3300028800 | Bacteria | 9272 |
| 282 | Ga0265338_10015698 | 3300028800 | Bacteria | 8300 |
| 283 | Ga0265338_10016304 | 3300028800 | Bacteria | 8094 |
| 284 | Ga0265338_10017598 | 3300028800 | Bacteria | 7694 |
| 285 | Ga0265338_10021100 | 3300028800 | Bacteria | 6809 |
| 286 | Ga0265338_10032281 | 3300028800 | Bacteria | 5112 |
| 287 | Ga0265338_10036354 | 3300028800 | Bacteria | 4715 |
| 288 | Ga0265338_10052764 | 3300028800 | Bacteria | 3644 |
| 289 | Ga0265338_10065919 | 3300028800 | Bacteria | 3137 |
| 290 | Ga0265338_10107801 | 3300028800 | Bacteria | 2252 |
| 291 | Ga0265338_10145659 | 3300028800 | Bacteria | 1848 |
| 292 | Ga0265324_10000275 | 3300029957 | Bacteria | 38013 |
| 293 | Ga0265324_10000434 | 3300029957 | Bacteria | 29709 |
| 294 | Ga0265324_10008137 | 3300029957 | Bacteria | 4193 |
| 295 | Ga0265324_10013737 | 3300029957 | Bacteria | 3013 |
| 296 | Ga0265324_10016597 | 3300029957 | Bacteria | 2685 |
| 297 | Ga0265324_10027158 | 3300029957 | Bacteria | 2022 |
| 298 | Ga0265760_10001214 | 3300031090 | Bacteria | 7544 |
| 299 | Ga0265330_10065362 | 3300031235 | Bacteria | 1579 |
| 300 | Ga0265320_10015186 | 3300031240 | Bacteria | 4359 |
| 301 | Ga0265325_10012954 | 3300031241 | Bacteria | 4757 |
| 302 | Ga0265325_10027993 | 3300031241 | Bacteria | 3042 |
| 303 | Ga0265325_10073717 | 3300031241 | Bacteria | 1708 |
| 304 | Ga0265340_10000208 | 3300031247 | Bacteria | 29683 |
| 305 | Ga0265340_10002875 | 3300031247 | Bacteria | 9799 |
| 306 | Ga0265339_10003685 | 3300031249 | Bacteria | 10688 |
| 307 | Ga0265339_10013432 | 3300031249 | Bacteria | 4961 |
| 308 | Ga0265339_10043425 | 3300031249 | Bacteria | 2486 |
| 309 | Ga0265327_10001424 | 3300031251 | Bacteria | 30421 |
| 310 | Ga0265327_10016400 | 3300031251 | Bacteria | 4706 |
| 311 | Ga0265316_10001616 | 3300031344 | Bacteria | 24035 |
| 312 | Ga0265316_10007894 | 3300031344 | Bacteria | 9959 |
| 313 | Ga0265316_10054548 | 3300031344 | Bacteria | 3129 |
| 314 | Ga0265316_10066286 | 3300031344 | Bacteria | 2795 |
| 315 | Ga0265316_10162262 | 3300031344 | Bacteria | 1670 |
| 316 | Ga0265313_10026169 | 3300031595 | Bacteria | 3078 |
| 317 | Ga0265313_10026209 | 3300031595 | Bacteria | 3075 |
| 318 | Ga0316575_10000137 | 3300031665 | Bacteria | 18328 |
| 319 | Ga0316575_10003349 | 3300031665 | Bacteria | 5521 |
| 320 | Ga0316575_10013470 | 3300031665 | Bacteria | 3054 |
| 321 | Ga0316579_10010485 | 3300031691 | Bacteria | 3919 |
| 322 | Ga0316579_10011595 | 3300031691 | Bacteria | 3748 |
| 323 | Ga0316579_10017849 | 3300031691 | Bacteria | 3117 |
| 324 | Ga0316579_10036678 | 3300031691 | Bacteria | 2262 |
| 325 | Ga0316579_10046136 | 3300031691 | Bacteria | 2032 |
| 326 | Ga0265314_10011022 | 3300031711 | Bacteria | 7496 |
| 327 | Ga0265314_10029742 | 3300031711 | Bacteria | 4056 |
| 328 | Ga0265314_10033302 | 3300031711 | Bacteria | 3781 |
| 329 | Ga0265314_10064052 | 3300031711 | Bacteria | 2491 |
| 330 | Ga0265314_10116439 | 3300031711 | Bacteria | 1689 |
| 331 | Ga0316576_10006734 | 3300031727 | Bacteria | 7181 |
| 332 | Ga0316576_10007773 | 3300031727 | Bacteria | 6774 |
| 333 | Ga0316576_10011164 | 3300031727 | Bacteria | 5870 |
| 334 | Ga0316576_10023339 | 3300031727 | Bacteria | 4307 |
| 335 | Ga0316576_10024125 | 3300031727 | Bacteria | 4245 |
| 336 | Ga0316576_10047770 | 3300031727 | Bacteria | 3103 |
| 337 | Ga0316576_10049913 | 3300031727 | Bacteria | 3040 |
| 338 | Ga0316576_10067626 | 3300031727 | Bacteria | 2630 |
| 339 | Ga0316576_10076170 | 3300031727 | Bacteria | 2482 |
| 340 | Ga0316578_10002110 | 3300031728 | Bacteria | 8525 |
| 341 | Ga0316578_10003250 | 3300031728 | Bacteria | 7380 |
| 342 | Ga0316578_10004444 | 3300031728 | Bacteria | 6623 |
| 343 | Ga0316578_10026658 | 3300031728 | Bacteria | 3261 |
| 344 | Ga0316578_10028855 | 3300031728 | Bacteria | 3145 |
| 345 | Ga0316578_10136752 | 3300031728 | Bacteria | 1475 |
| 346 | Ga0316577_10003305 | 3300031733 | Bacteria | 8124 |
| 347 | Ga0316577_10011104 | 3300031733 | Bacteria | 4873 |
| 348 | Ga0316577_10021614 | 3300031733 | Bacteria | 3570 |
| 349 | Ga0316577_10023621 | 3300031733 | Bacteria | 3413 |
| 350 | Ga0316577_10042046 | 3300031733 | Bacteria | 2557 |
| 351 | Ga0316577_10043114 | 3300031733 | Bacteria | 2524 |
| 352 | Ga0316583_10001633 | 3300032133 | Bacteria | 7585 |
| 353 | Ga0316583_10008407 | 3300032133 | Bacteria | 3724 |
| 354 | Ga0316583_10010921 | 3300032133 | Bacteria | 3270 |
| 355 | Ga0316583_10017925 | 3300032133 | Unclassified | 2543 |
| 356 | Ga0316583_10027753 | 3300032133 | Bacteria | 2021 |
| 357 | Ga0316585_10002173 | 3300032137 | Bacteria | 5268 |
| 358 | Ga0316585_10021964 | 3300032137 | Bacteria | 1961 |
| 359 | Ga0316585_10023486 | 3300032137 | Bacteria | 1902 |
| 360 | Ga0316585_10041778 | 3300032137 | Bacteria | 1461 |
| 361 | Ga0316580_10006464 | 3300032139 | Bacteria | 3462 |
| 362 | Ga0316593_10006804 | 3300032168 | Bacteria | 3108 |
| 363 | Ga0316592_1016432 | 3300033524 | Bacteria | 1546 |
| 364 | Ga0373930_0001976 | 3300034816 | Bacteria | 3139 |
| 365 | Ga0373926_0001985 | 3300035083 | Bacteria | 6413 |
| 366 | Ga0373929_0004550 | 3300035085 | Bacteria | 2482 |
| 367 | Ga0373944_0002365 | 3300035089 | Bacteria | 4803 |
| 368 | Ga0373949_0001197 | 3300035090 | Bacteria | 7696 |
| 369 | Ga0373951_0002160 | 3300035091 | Bacteria | 5014 |
| 370 | Ga0373932_0000003 | 3300035112 | Bacteria | 459351 |
| 371 | Ga0373945_0044889 | 3300035116 | Bacteria | 1608 |
| 372 | Ga0373954_0019754 | 3300035118 | Bacteria | 3041 |
| 373 | Ga0373956_0071153 | 3300035119 | Bacteria | 1587 |
| 374 | Ga0373946_0002216 | 3300035171 | Bacteria | 6850 |
| 375 | Ga0373962_0000106 | 3300035242 | Bacteria | 18384 |
| 376 | Ga0316574_0002636 | 3300035398 | Bacteria | 9050 |
| 377 | Ga0316574_0013133 | 3300035398 | Bacteria | 4755 |
| 378 | Ga0316574_0090720 | 3300035398 | Bacteria | 1948 |
| 379 | Ga0316574_0101247 | 3300035398 | Bacteria | 1844 |
| 380 | Ga0316574_0121083 | 3300035398 | Bacteria | 1680 |
| 381 | Ga0373931_0000017 | 3300035691 | Bacteria | 207733 |
| 382 | Ga0373935_0018453 | 3300035692 | Bacteria | 4243 |
| 383 | Ga0373935_0127303 | 3300035692 | Bacteria | 1708 |
| 384 | Ga0373927_0000442 | 3300035695 | Bacteria | 31705 |
| 385 | Ga0373927_0156714 | 3300035695 | Bacteria | 1491 |
| 386 | Ga0373947_0018292 | 3300035725 | Bacteria | 4033 |
| 387 | Ga0373947_0023833 | 3300035725 | Bacteria | 3563 |
| 388 | Ga0373947_0058315 | 3300035725 | Bacteria | 2339 |
| 389 | Ga0373937_0006833 | 3300036401 | Bacteria | 9846 |
| 390 | Ga0373937_0047621 | 3300036401 | Bacteria | 3923 |
| 391 | Ga0373937_0058419 | 3300036401 | Bacteria | 3544 |
| 392 | Ga0316582_0000276 | 3300036647 | Bacteria | 17513 |
| 393 | Ga0316582_0000544 | 3300036647 | Bacteria | 14391 |
| 394 | Ga0316582_0000865 | 3300036647 | Bacteria | 12348 |
| 395 | Ga0316582_0007404 | 3300036647 | Bacteria | 5839 |
| 396 | Ga0316582_0018348 | 3300036647 | Bacteria | 4070 |
| 397 | Ga0316582_0121905 | 3300036647 | Bacteria | 1745 |
| 398 | Ga0316584_0001417 | 3300036712 | Bacteria | 14335 |
| 399 | Ga0316584_0005032 | 3300036712 | Bacteria | 8810 |
| 400 | Ga0316584_0013494 | 3300036712 | Bacteria | 5785 |
| 401 | Ga0316584_0017467 | 3300036712 | Bacteria | 5158 |
| 402 | Ga0316584_0024858 | 3300036712 | Bacteria | 4388 |
| 403 | Ga0316584_0038300 | 3300036712 | Bacteria | 3566 |
| 404 | Ga0316584_0083163 | 3300036712 | Bacteria | 2397 |
| 405 | Ga0316584_0087525 | 3300036712 | Unclassified | 2332 |
| 406 | Ga0316584_0128813 | 3300036712 | Bacteria | 1890 |
| 407 | Ga0316584_0145687 | 3300036712 | Bacteria | 1764 |
| 408 | Ga0316584_0156528 | 3300036712 | Bacteria | 1694 |
| 409 | Ga0316584_0264232 | 3300036712 | Bacteria | 1254 |
| 410 | Ga0316584_0306392 | 3300036712 | Bacteria | 1149 |
| 411 | Ga0373925_0001370 | 3300037068 | Bacteria | 21253 |
| 412 | Ga0373925_0002451 | 3300037068 | Bacteria | 14856 |
| 413 | Ga0373925_0009024 | 3300037068 | Bacteria | 7262 |
| 414 | Ga0395899_0081153 | 3300037312 | Bacteria | 2360 |
| 415 | Ga0395900_0009629 | 3300037418 | Bacteria | 9909 |
| 416 | Ga0395900_0031075 | 3300037418 | Bacteria | 5486 |
| 417 | Ga0395900_0062833 | 3300037418 | Bacteria | 3817 |
| 418 | Ga0395900_0286839 | 3300037418 | Bacteria | 1636 |
| 419 | Ga0395898_0008286 | 3300037466 | Bacteria | 10990 |
| 420 | Ga0395898_0039951 | 3300037466 | Bacteria | 4642 |
| 421 | Ga0395905_0007990 | 3300037471 | Bacteria | 10454 |
| 422 | Ga0395905_0376655 | 3300037471 | Bacteria | 1313 |
| 423 | Ga0316581_0005654 | 3300037588 | Bacteria | 3273 |
| 424 | Ga0436364_1048088 | 3300037853 | Bacteria | 1680 |
| 425 | Ga0395901_0074377 | 3300038443 | Bacteria | 3544 |
| 426 | Ga0395901_0132487 | 3300038443 | Bacteria | 2619 |
| 427 | Ga0395901_0194192 | 3300038443 | Bacteria | 2129 |
| 428 | Ga0400490_08090 | 3300038726 | Bacteria | 2454 |
| 429 | Ga0400490_08299 | 3300038726 | Unclassified | 2019 |
| 430 | Ga0400490_16839 | 3300038726 | Bacteria | 36448 |
| 431 | Ga0400491_08615 | 3300038727 | Bacteria | 3746 |
| 432 | Ga0400491_24515 | 3300038727 | Bacteria | 2984 |
| 433 | Ga0400485_00122 | 3300038735 | Bacteria | 16318 |
| 434 | Ga0400485_17873 | 3300038735 | Bacteria | 24379 |
| 435 | Ga0400486_21674 | 3300038742 | Bacteria | 15135 |
| 436 | Ga0400486_23273 | 3300038742 | Bacteria | 28833 |
| 437 | Ga0400483_129331 | 3300039062 | Bacteria | 4069 |
| 438 | Ga0400483_204894 | 3300039062 | Bacteria | 1685 |
| 439 | Ga0400489_04024 | 3300039093 | Bacteria | 18064 |
| 440 | Ga0400489_24971 | 3300039093 | Bacteria | 18183 |
| 441 | Ga0400489_26114 | 3300039093 | Bacteria | 44665 |
| 442 | Ga0400489_29570 | 3300039093 | Bacteria | 28517 |
| 443 | Ga0400487_63934 | 3300039110 | Bacteria | 30817 |
| 444 | Ga0436365_0178835 | 3300039437 | Bacteria | 16798 |
| 445 | Ga0436365_0243335 | 3300039437 | Bacteria | 111830 |
| 446 | Ga0436365_0529836 | 3300039437 | Bacteria | 1360 |
| 447 | Ga0436361_0449901 | 3300039447 | Bacteria | 2032 |
| 448 | Ga0439446_0022219 | 3300042156 | Bacteria | 1798 |
| 449 | Ga0451577_0003436 | 3300042876 | Bacteria | 17641 |
| 450 | Ga0451577_0015600 | 3300042876 | Bacteria | 7060 |
| 451 | Ga0451577_0237047 | 3300042876 | Bacteria | 1650 |
| 452 | Ga0466972_0003402 | 3300044658 | Bacteria | 7889 |
| 453 | Ga0466965_0053540 | 3300044683 | Bacteria | 2006 |
| 454 | Ga0466966_0003064 | 3300044684 | Bacteria | 11019 |
| 455 | Ga0466961_0006703 | 3300044693 | Bacteria | 7328 |
| 456 | Ga0466961_0022687 | 3300044693 | Bacteria | 4037 |
| 457 | Ga0466961_0051602 | 3300044693 | Bacteria | 2626 |
| 458 | Ga0466963_0002833 | 3300044694 | Bacteria | 9777 |
| 459 | Ga0466963_0028739 | 3300044694 | Bacteria | 3573 |
| 460 | Ga0466963_0070351 | 3300044694 | Bacteria | 2353 |
| 461 | Ga0466963_0074221 | 3300044694 | Bacteria | 2293 |
| 462 | Ga0466963_0081390 | 3300044694 | Bacteria | 2193 |
| 463 | Ga0466963_0192911 | 3300044694 | Bacteria | 1423 |
| 464 | Ga0466964_0006640 | 3300044706 | Bacteria | 4312 |
| 465 | Ga0453684_0000137 | 3300044712 | Bacteria | 323390 |
| 466 | Ga0453684_0004628 | 3300044712 | Bacteria | 28595 |
| 467 | Ga0453684_0194504 | 3300044712 | Bacteria | 2370 |
| 468 | Ga0466971_0001127 | 3300044719 | Bacteria | 11112 |
| 469 | Ga0466971_0024358 | 3300044719 | Bacteria | 2700 |
| 470 | Ga0466968_0021140 | 3300044735 | Bacteria | 2633 |
| 471 | Ga0466957_0014120 | 3300044842 | Bacteria | 4646 |
| 472 | Ga0466957_0034198 | 3300044842 | Bacteria | 3049 |
| 473 | Ga0466959_0018530 | 3300045049 | Bacteria | 5113 |
| 474 | Ga0466959_0022745 | 3300045049 | Bacteria | 4634 |
| 475 | Ga0466959_0081904 | 3300045049 | Bacteria | 2325 |
| 476 | Ga0466959_0165675 | 3300045049 | Bacteria | 1552 |
| 477 | Ga0451576_0028983 | 3300045051 | Bacteria | 5928 |
| 478 | Ga0451576_0070874 | 3300045051 | Bacteria | 3628 |
| 479 | Ga0451576_0101374 | 3300045051 | Bacteria | 2994 |
| 480 | Ga0451576_0119407 | 3300045051 | Bacteria | 2745 |
| 481 | Ga0451576_0125277 | 3300045051 | Bacteria | 2677 |
| 482 | Ga0466958_0006784 | 3300045836 | Bacteria | 6256 |
| 483 | Ga0466958_0023765 | 3300045836 | Bacteria | 3601 |
| 484 | Ga0466958_0046096 | 3300045836 | Bacteria | 2630 |
| 485 | Ga0466967_0009640 | 3300045976 | Bacteria | 7179 |
| 486 | Ga0466967_0021947 | 3300045976 | Bacteria | 5198 |
| 487 | Ga0466967_0055088 | 3300045976 | Bacteria | 3502 |
| 488 | Ga0466967_0065363 | 3300045976 | Bacteria | 3237 |
| 489 | Ga0466967_0318065 | 3300045976 | Bacteria | 1500 |
| 490 | Ga0495592_0008014 | 3300046454 | Bacteria | 7929 |
| 491 | Ga0495592_0157188 | 3300046454 | Bacteria | 1567 |
| 492 | Ga0495603_0074034 | 3300046455 | Bacteria | 2000 |
| 493 | Ga0495641_0040200 | 3300046461 | Bacteria | 2176 |
| 494 | Ga0495582_0008132 | 3300046473 | Bacteria | 5791 |
| 495 | Ga0495664_0028784 | 3300046477 | Bacteria | 3246 |
| 496 | Ga0495630_0000010 | 3300046517 | Bacteria | 265324 |
| 497 | Ga0495630_0010815 | 3300046517 | Bacteria | 6589 |
| 498 | Ga0495630_0015375 | 3300046517 | Bacteria | 5589 |
| 499 | Ga0495630_0044356 | 3300046517 | Bacteria | 3323 |
| 500 | Ga0495666_0039038 | 3300046526 | Bacteria | 2307 |
| 501 | Ga0495652_0220923 | 3300046529 | Bacteria | 1424 |
| 502 | Ga0495640_0112665 | 3300046533 | Bacteria | 1776 |
| 503 | Ga0495586_0000048 | 3300046535 | Bacteria | 71629 |
| 504 | Ga0495586_0001538 | 3300046535 | Bacteria | 12729 |
| 505 | Ga0495586_0122090 | 3300046535 | Bacteria | 1456 |
| 506 | Ga0495645_0061296 | 3300046543 | Bacteria | 2726 |
| 507 | Ga0495645_0136467 | 3300046543 | Bacteria | 1715 |
| 508 | Ga0495634_0018314 | 3300046642 | Bacteria | 4987 |
| 509 | Ga0495634_0018945 | 3300046642 | Bacteria | 4894 |
| 510 | Ga0495599_0022090 | 3300046678 | Bacteria | 3971 |
| 511 | Ga0495599_0091371 | 3300046678 | Bacteria | 1899 |
| 512 | Ga0495647_0017659 | 3300046681 | Bacteria | 2527 |
| 513 | Ga0495613_0001643 | 3300046689 | Bacteria | 17024 |
| 514 | Ga0495613_0046528 | 3300046689 | Unclassified | 3208 |
| 515 | Ga0495624_0032378 | 3300046690 | Bacteria | 3391 |
| 516 | Ga0495674_0001886 | 3300047319 | Bacteria | 20650 |
| 517 | Ga0495674_0024817 | 3300047319 | Bacteria | 5504 |
| 518 | Ga0495672_0000882 | 3300047320 | Bacteria | 31549 |
| 519 | Ga0495672_0001766 | 3300047320 | Bacteria | 20805 |
| 520 | Ga0495680_0002831 | 3300047322 | Bacteria | 17453 |
| 521 | Ga0495675_0132473 | 3300047444 | Bacteria | 1549 |
| 522 | Ga0495684_0069611 | 3300047471 | Bacteria | 2675 |
| 523 | Ga0496102_0205408 | 3300048905 | Bacteria | 1857 |
| 524 | Ga0496106_0087848 | 3300048909 | Bacteria | 2396 |
| 525 | Ga0496112_0018723 | 3300048915 | Bacteria | 6526 |
| 526 | Ga0501031_0000012 | 3300049568 | Bacteria | 137943 |
| 527 | Ga0501031_0021793 | 3300049568 | Bacteria | 4176 |
| 528 | Ga0501031_0118618 | 3300049568 | Bacteria | 1729 |
| 529 | Ga0501032_0007666 | 3300049569 | Bacteria | 7870 |
| 530 | Ga0501032_0020292 | 3300049569 | Bacteria | 4631 |
| 531 | Ga0501033_0001607 | 3300049570 | Bacteria | 19842 |
| 532 | Ga0501033_0012811 | 3300049570 | Bacteria | 6395 |
| 533 | Ga0501034_0052299 | 3300049571 | Bacteria | 4115 |
| 534 | Ga0501036_0054509 | 3300049572 | Bacteria | 3387 |
| 535 | Ga0501038_0217698 | 3300049574 | Bacteria | 1525 |
| 536 | Ga0501039_0170552 | 3300049575 | Bacteria | 1711 |
| 537 | Ga0501040_0084447 | 3300049576 | Bacteria | 2203 |
| 538 | Ga0501040_0105707 | 3300049576 | Bacteria | 1967 |
| 539 | Ga0501041_0075180 | 3300049577 | Bacteria | 2077 |
| 540 | Ga0501041_0112300 | 3300049577 | Bacteria | 1691 |
| 541 | Ga0501041_0124569 | 3300049577 | Bacteria | 1603 |
| 542 | Ga0501043_0113291 | 3300049579 | Bacteria | 2130 |
| 543 | Ga0501067_0030844 | 3300049583 | Bacteria | 2974 |
| 544 | Ga0501068_0065527 | 3300049584 | Bacteria | 2211 |
| 545 | Ga0501069_0024610 | 3300049585 | Bacteria | 3284 |
| 546 | Ga0501069_0057290 | 3300049585 | Bacteria | 2171 |
| 547 | Ga0501069_0086145 | 3300049585 | Bacteria | 1773 |
| 548 | Ga0501070_0001690 | 3300049586 | Bacteria | 19562 |
| 549 | Ga0501070_0109344 | 3300049586 | Bacteria | 2284 |
| 550 | Ga0501071_0129109 | 3300049587 | Bacteria | 1877 |
| 551 | Ga0501072_0091059 | 3300049588 | Bacteria | 2421 |
| 552 | Ga0501073_0085144 | 3300049589 | Bacteria | 2200 |
| 553 | Ga0501074_0043348 | 3300049590 | Bacteria | 3256 |
| 554 | Ga0501075_0010180 | 3300049591 | Bacteria | 6601 |
| 555 | Ga0501076_0013731 | 3300049592 | Bacteria | 6076 |
| 556 | Ga0501076_0014008 | 3300049592 | Bacteria | 6026 |
| 557 | Ga0501076_0078554 | 3300049592 | Bacteria | 2648 |
| 558 | Ga0501079_0020662 | 3300049741 | Bacteria | 5033 |
| 559 | Ga0501079_0242910 | 3300049741 | Bacteria | 1407 |
| 560 | Ga0501080_0000790 | 3300049742 | Bacteria | 25827 |
| 561 | Ga0501080_0107594 | 3300049742 | Bacteria | 2584 |
| 562 | Ga0501083_0001358 | 3300049744 | Bacteria | 16628 |
| 563 | Ga0501035_0003711 | 3300049822 | Bacteria | 14559 |
| 564 | Ga0501035_0069282 | 3300049822 | Bacteria | 3127 |
| 565 | Ga0501035_0078062 | 3300049822 | Bacteria | 2926 |
| 566 | Ga0501044_0000024 | 3300049823 | Bacteria | 194302 |
| 567 | Ga0501044_0040160 | 3300049823 | Bacteria | 4878 |
| 568 | nmdc:mga0yw44_36808_c1 | 3300050492 | Bacteria | 2886 |
| 569 | nmdc:mga0k408_143766_c1 | 3300050493 | Bacteria | 1419 |
| 570 | nmdc:mga0k408_50396_c1 | 3300050493 | Bacteria | 2411 |
| 571 | nmdc:mga06z11_125646_c1 | 3300050494 | Bacteria | 1435 |
| 572 | nmdc:mga06z11_19555_c1 | 3300050494 | Bacteria | 3116 |
| 573 | nmdc:mga06z11_34409_c1 | 3300050494 | Bacteria | 2487 |
| 574 | nmdc:mga06z11_3557_c1 | 3300050494 | Bacteria | 6034 |
| 575 | nmdc:mga04h51_19876_c1 | 3300050495 | Bacteria | 1997 |
| 576 | nmdc:mga07m45_5086_c1 | 3300050496 | Bacteria | 6509 |
| 577 | nmdc:mga05p37_113161_c1 | 3300050507 | Bacteria | 3337 |
| 578 | nmdc:mga05p37_131624_c1 | 3300050507 | Bacteria | 3069 |
| 579 | nmdc:mga05p37_1863_c1 | 3300050507 | Bacteria | 24556 |
| 580 | nmdc:mga05p37_61614_c1 | 3300050507 | Bacteria | 4618 |
| 581 | nmdc:mga05p37_69916_c1 | 3300050507 | Bacteria | 2299 |
| 582 | nmdc:mga05p37_98941_c1 | 3300050507 | Bacteria | 3593 |
| 583 | nmdc:mga09592_19269_c1 | 3300050508 | Bacteria | 5602 |
| 584 | nmdc:mga09592_205088_c1 | 3300050508 | Bacteria | 1708 |
| 585 | nmdc:mga09592_217996_c1 | 3300050508 | Bacteria | 1653 |
| 586 | nmdc:mga09592_2682_c1 | 3300050508 | Bacteria | 14394 |
| 587 | nmdc:mga09592_31887_c1 | 3300050508 | Bacteria | 4392 |
| 588 | nmdc:mga09592_54673_c1 | 3300050508 | Bacteria | 3373 |
| 589 | nmdc:mga0qj67_314533_c1 | 3300050509 | Bacteria | 1268 |
| 590 | nmdc:mga06r32_1717_c1 | 3300050510 | Bacteria | 19727 |
| 591 | nmdc:mga06r32_180028_c1 | 3300050510 | Bacteria | 2099 |
| 592 | nmdc:mga06r32_48741_c1 | 3300050510 | Bacteria | 4050 |
| 593 | nmdc:mga08y16_11988_c1 | 3300050511 | Bacteria | 9102 |
| 594 | nmdc:mga08y16_3313_c1 | 3300050511 | Bacteria | 16684 |
| 595 | nmdc:mga0n895_166472_c1 | 3300050512 | Bacteria | 2236 |
| 596 | nmdc:mga0n895_383551_c1 | 3300050512 | Bacteria | 1422 |
| 597 | nmdc:mga0rr50_255926_c1 | 3300050513 | Bacteria | 1455 |
| 598 | nmdc:mga0a205_23008_c1 | 3300050515 | Bacteria | 5908 |
| 599 | nmdc:mga0a205_295831_c1 | 3300050515 | Bacteria | 1492 |
| 600 | Ga0501084_0210827 | 3300054114 | Bacteria | 1639 |
| 601 | Ga0501084_0252281 | 3300054114 | Bacteria | 1489 |
| 602 | Ga0501082_0021513 | 3300060353 | Bacteria | 5563 |
| 603 | Ga0501082_0066638 | 3300060353 | Bacteria | 3101 |
| 604 | Ga0466962_0000874 | 3300061719 | Bacteria | 13664 |
| 605 | Ga0530510_0070335 | 3300061734 | Bacteria | 2540 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046689 | Ga0495613_0046528 | Ga0495613_0046528_2191_3180 | 321 |
| 2 | 3300036712 | Ga0316584_0306392 | Ga0316584_0306392_16_1014 | 327 |
| 3 | 3300054114 | Ga0501084_0252281 | Ga0501084_0252281_82_1212 | 335 |
| 4 | 3300047320 | Ga0495672_0001766 | Ga0495672_0001766_1682_2836 | 337 |
| 5 | 3300021361 | Ga0213872_10087362 | Ga0213872_100873622 | 345 |
| 6 | 3300039447 | Ga0436361_0449901 | Ga0436361_0449901_748_1821 | 345 |
| 7 | 3300005441 | Ga0070700_100016277 | Ga0070700_1000162774 | 346 |
| 8 | 3300050513 | nmdc:mga0rr50_255926_c1 | nmdc:mga0rr50_255926_c1_138_1328 | 347 |
| 9 | 3300007076 | Ga0075435_100170144 | Ga0075435_1001701442 | 348 |
| 10 | 3300031691 | Ga0316579_10010485 | Ga0316579_100104851 | 349 |
| 11 | 3300037418 | Ga0395900_0031075 | Ga0395900_0031075_21_1127 | 350 |
| 12 | 3300042156 | Ga0439446_0022219 | Ga0439446_0022219_478_1608 | 350 |
| 13 | 3300021384 | Ga0213876_10000099 | Ga0213876_1000009937 | 352 |
| 14 | 3300037312 | Ga0395899_0081153 | Ga0395899_0081153_1253_2347 | 352 |
| 15 | 3300039437 | Ga0436365_0243335 | Ga0436365_0243335_52619_53836 | 352 |
| 16 | 3300009094 | Ga0111539_10005541 | Ga0111539_1000554114 | 353 |
| 17 | 3300027907 | Ga0207428_10129029 | Ga0207428_101290292 | 353 |
| 18 | 3300031241 | Ga0265325_10012954 | Ga0265325_100129542 | 353 |
| 19 | 3300050511 | nmdc:mga08y16_11988_c1 | nmdc:mga08y16_11988_c1_116_1330 | 353 |
| 20 | 3300005617 | Ga0068859_100302369 | Ga0068859_1003023692 | 354 |
| 21 | 3300006931 | Ga0097620_100302413 | Ga0097620_1003024132 | 354 |
| 22 | 3300050510 | nmdc:mga06r32_48741_c1 | nmdc:mga06r32_48741_c1_857_2011 | 354 |
| 23 | 3300005355 | Ga0070671_100118589 | Ga0070671_1001185892 | 355 |
| 24 | 3300005518 | Ga0070699_100167319 | Ga0070699_1001673192 | 356 |
| 25 | 3300006028 | Ga0070717_10002462 | Ga0070717_1000246210 | 356 |
| 26 | 3300025929 | Ga0207664_10040347 | Ga0207664_100403474 | 356 |
| 27 | 3300026075 | Ga0207708_10022921 | Ga0207708_100229212 | 356 |
| 28 | 3300044694 | Ga0466963_0002833 | Ga0466963_0002833_7934_9169 | 356 |
| 29 | 3300046454 | Ga0495592_0008014 | Ga0495592_0008014_11_1096 | 356 |
| 30 | 3300024225 | Ga0224572_1014186 | Ga0224572_10141862 | 357 |
| 31 | 3300031090 | Ga0265760_10001214 | Ga0265760_100012149 | 357 |
| 32 | 3300031241 | Ga0265325_10027993 | Ga0265325_100279933 | 357 |
| 33 | 3300044694 | Ga0466963_0070351 | Ga0466963_0070351_798_2021 | 357 |
| 34 | 3300037466 | Ga0395898_0008286 | Ga0395898_0008286_8841_9992 | 358 |
| 35 | 3300005329 | Ga0070683_100030105 | Ga0070683_1000301052 | 359 |
| 36 | 3300005436 | Ga0070713_100081604 | Ga0070713_1000816042 | 359 |
| 37 | 3300005841 | Ga0068863_100058335 | Ga0068863_1000583353 | 359 |
| 38 | 3300006881 | Ga0068865_100011862 | Ga0068865_1000118622 | 359 |
| 39 | 3300025944 | Ga0207661_10177240 | Ga0207661_101772402 | 359 |
| 40 | 3300026089 | Ga0207648_10024974 | Ga0207648_100249743 | 359 |
| 41 | 3300038443 | Ga0395901_0194192 | Ga0395901_0194192_633_1850 | 359 |
| 42 | 3300045976 | Ga0466967_0009640 | Ga0466967_0009640_5354_6577 | 359 |
| 43 | 3300028800 | Ga0265338_10065919 | Ga0265338_100659192 | 360 |
| 44 | 3300031235 | Ga0265330_10065362 | Ga0265330_100653622 | 360 |
| 45 | 3300031249 | Ga0265339_10003685 | Ga0265339_100036854 | 360 |
| 46 | 3300031344 | Ga0265316_10007894 | Ga0265316_100078944 | 360 |
| 47 | 3300031344 | Ga0265316_10054548 | Ga0265316_100545482 | 360 |
| 48 | 3300031595 | Ga0265313_10026209 | Ga0265313_100262092 | 360 |
| 49 | 3300031711 | Ga0265314_10033302 | Ga0265314_100333024 | 360 |
| 50 | 3300031711 | Ga0265314_10116439 | Ga0265314_101164391 | 360 |
| 51 | 3300044693 | Ga0466961_0022687 | Ga0466961_0022687_2188_3366 | 360 |
| 52 | 3300044719 | Ga0466971_0024358 | Ga0466971_0024358_1355_2533 | 360 |
| 53 | 3300045049 | Ga0466959_0081904 | Ga0466959_0081904_181_1359 | 360 |
| 54 | 3300045836 | Ga0466958_0046096 | Ga0466958_0046096_619_1797 | 360 |
| 55 | 3300061719 | Ga0466962_0000874 | Ga0466962_0000874_3374_4552 | 360 |
| 56 | 3300038443 | Ga0395901_0132487 | Ga0395901_0132487_163_1323 | 362 |
| 57 | 3300045051 | Ga0451576_0070874 | Ga0451576_0070874_1901_3103 | 362 |
| 58 | 3300005330 | Ga0070690_100021471 | Ga0070690_1000214712 | 363 |
| 59 | 3300005338 | Ga0068868_100082652 | Ga0068868_1000826523 | 363 |
| 60 | 3300005459 | Ga0068867_100236012 | Ga0068867_1002360122 | 363 |
| 61 | 3300010375 | Ga0105239_10017617 | Ga0105239_100176173 | 363 |
| 62 | 3300013306 | Ga0163162_10013066 | Ga0163162_100130666 | 363 |
| 63 | 3300014968 | Ga0157379_10069084 | Ga0157379_100690842 | 363 |
| 64 | 3300035171 | Ga0373946_0002216 | Ga0373946_0002216_3325_4446 | 363 |
| 65 | 3300045976 | Ga0466967_0021947 | Ga0466967_0021947_2165_3376 | 363 |
| 66 | 3300005334 | Ga0068869_100011381 | Ga0068869_1000113816 | 364 |
| 67 | 3300028800 | Ga0265338_10016304 | Ga0265338_100163046 | 364 |
| 68 | 3300037418 | Ga0395900_0286839 | Ga0395900_0286839_41_1201 | 364 |
| 69 | 3300049571 | Ga0501034_0052299 | Ga0501034_0052299_2804_4021 | 364 |
| 70 | 3300049586 | Ga0501070_0001690 | Ga0501070_0001690_13101_14318 | 364 |
| 71 | 3300049590 | Ga0501074_0043348 | Ga0501074_0043348_1433_2650 | 364 |
| 72 | 3300049742 | Ga0501080_0000790 | Ga0501080_0000790_15592_16809 | 364 |
| 73 | 3300039437 | Ga0436365_0529836 | Ga0436365_0529836_136_1308 | 365 |
| 74 | 3300005334 | Ga0068869_100002310 | Ga0068869_1000023107 | 366 |
| 75 | 3300005466 | Ga0070685_10023854 | Ga0070685_100238542 | 366 |
| 76 | 3300005539 | Ga0068853_100236443 | Ga0068853_1002364432 | 366 |
| 77 | 3300005617 | Ga0068859_100023044 | Ga0068859_1000230443 | 366 |
| 78 | 3300005842 | Ga0068858_100009346 | Ga0068858_1000093462 | 366 |
| 79 | 3300006931 | Ga0097620_100023044 | Ga0097620_1000230443 | 366 |
| 80 | 3300009093 | Ga0105240_10032877 | Ga0105240_100328774 | 366 |
| 81 | 3300013296 | Ga0157374_10013937 | Ga0157374_100139375 | 366 |
| 82 | 3300013307 | Ga0157372_10169948 | Ga0157372_101699483 | 366 |
| 83 | 3300013308 | Ga0157375_10010268 | Ga0157375_100102685 | 366 |
| 84 | 3300014497 | Ga0182008_10009538 | Ga0182008_100095382 | 366 |
| 85 | 3300021384 | Ga0213876_10000499 | Ga0213876_1000049913 | 366 |
| 86 | 3300025904 | Ga0207647_10006481 | Ga0207647_100064814 | 366 |
| 87 | 3300025913 | Ga0207695_10040587 | Ga0207695_100405872 | 366 |
| 88 | 3300025938 | Ga0207704_10040395 | Ga0207704_100403951 | 366 |
| 89 | 3300025942 | Ga0207689_10000068 | Ga0207689_1000006875 | 366 |
| 90 | 3300026035 | Ga0207703_10004361 | Ga0207703_100043615 | 366 |
| 91 | 3300044842 | Ga0466957_0014120 | Ga0466957_0014120_871_2088 | 366 |
| 92 | 3300045836 | Ga0466958_0023765 | Ga0466958_0023765_23_1240 | 366 |
| 93 | 3300045976 | Ga0466967_0318065 | Ga0466967_0318065_36_1253 | 366 |
| 94 | 3300048915 | Ga0496112_0018723 | Ga0496112_0018723_2995_4191 | 366 |
| 95 | 3300005545 | Ga0070695_100000332 | Ga0070695_10000033212 | 367 |
| 96 | 3300005563 | Ga0068855_100330392 | Ga0068855_1003303921 | 367 |
| 97 | 3300006178 | Ga0075367_10003400 | Ga0075367_100034006 | 367 |
| 98 | 3300006880 | Ga0075429_100036051 | Ga0075429_1000360514 | 367 |
| 99 | 3300009147 | Ga0114129_10006424 | Ga0114129_1000642411 | 367 |
| 100 | 3300025949 | Ga0207667_10304926 | Ga0207667_103049261 | 367 |
| 101 | 3300048905 | Ga0496102_0205408 | Ga0496102_0205408_95_1312 | 367 |
| 102 | 3300048909 | Ga0496106_0087848 | Ga0496106_0087848_541_1755 | 367 |
| 103 | 3300050494 | nmdc:mga06z11_34409_c1 | nmdc:mga06z11_34409_c1_945_2096 | 367 |
| 104 | 3300050508 | nmdc:mga09592_31887_c1 | nmdc:mga09592_31887_c1_3136_4296 | 367 |
| 105 | 3300044658 | Ga0466972_0003402 | Ga0466972_0003402_4049_5263 | 368 |
| 106 | 3300044694 | Ga0466963_0081390 | Ga0466963_0081390_577_1716 | 368 |
| 107 | 3300044735 | Ga0466968_0021140 | Ga0466968_0021140_987_2201 | 368 |
| 108 | 3300049741 | Ga0501079_0020662 | Ga0501079_0020662_1793_3019 | 368 |
| 109 | 3300049742 | Ga0501080_0107594 | Ga0501080_0107594_905_2131 | 368 |
| 110 | 3300049744 | Ga0501083_0001358 | Ga0501083_0001358_8802_10028 | 368 |
| 111 | 3300050493 | nmdc:mga0k408_143766_c1 | nmdc:mga0k408_143766_c1_223_1392 | 368 |
| 112 | 3300054114 | Ga0501084_0210827 | Ga0501084_0210827_74_1300 | 368 |
| 113 | 3300005365 | Ga0070688_100202389 | Ga0070688_1002023892 | 369 |
| 114 | 3300005618 | Ga0068864_100375158 | Ga0068864_1003751582 | 369 |
| 115 | 3300006881 | Ga0068865_100035764 | Ga0068865_1000357643 | 369 |
| 116 | 3300009177 | Ga0105248_10296378 | Ga0105248_102963782 | 369 |
| 117 | 3300011119 | Ga0105246_10047378 | Ga0105246_100473783 | 369 |
| 118 | 3300013308 | Ga0157375_10402228 | Ga0157375_104022281 | 369 |
| 119 | 3300032137 | Ga0316585_10021964 | Ga0316585_100219642 | 369 |
| 120 | 3300035398 | Ga0316574_0101247 | Ga0316574_0101247_557_1786 | 369 |
| 121 | 3300049583 | Ga0501067_0030844 | Ga0501067_0030844_1566_2780 | 369 |
| 122 | 3300049585 | Ga0501069_0024610 | Ga0501069_0024610_1791_3005 | 369 |
| 123 | 3300049586 | Ga0501070_0109344 | Ga0501070_0109344_388_1602 | 369 |
| 124 | 3300005530 | Ga0070679_100068279 | Ga0070679_1000682793 | 370 |
| 125 | 3300044693 | Ga0466961_0051602 | Ga0466961_0051602_245_1390 | 370 |
| 126 | 3300045049 | Ga0466959_0022745 | Ga0466959_0022745_2982_4127 | 370 |
| 127 | 3300046455 | Ga0495603_0074034 | Ga0495603_0074034_565_1698 | 370 |
| 128 | 3300046461 | Ga0495641_0040200 | Ga0495641_0040200_617_1750 | 370 |
| 129 | 3300049587 | Ga0501071_0129109 | Ga0501071_0129109_136_1317 | 370 |
| 130 | 3300049589 | Ga0501073_0085144 | Ga0501073_0085144_405_1586 | 370 |
| 131 | 3300031691 | Ga0316579_10036678 | Ga0316579_100366782 | 371 |
| 132 | 3300031733 | Ga0316577_10023621 | Ga0316577_100236212 | 371 |
| 133 | 3300036712 | Ga0316584_0001417 | Ga0316584_0001417_760_1989 | 371 |
| 134 | 3300037853 | Ga0436364_1048088 | Ga0436364_1048088_206_1357 | 371 |
| 135 | 3300044712 | Ga0453684_0000137 | Ga0453684_0000137_70313_71455 | 371 |
| 136 | 3300005293 | Ga0065715_10103480 | Ga0065715_101034802 | 372 |
| 137 | 3300005471 | Ga0070698_100008136 | Ga0070698_10000813610 | 372 |
| 138 | 3300028800 | Ga0265338_10013371 | Ga0265338_100133713 | 372 |
| 139 | 3300050510 | nmdc:mga06r32_180028_c1 | nmdc:mga06r32_180028_c1_36_1193 | 372 |
| 140 | 3300005536 | Ga0070697_100062942 | Ga0070697_1000629422 | 373 |
| 141 | 3300036712 | Ga0316584_0264232 | Ga0316584_0264232_95_1225 | 373 |
| 142 | 3300049585 | Ga0501069_0086145 | Ga0501069_0086145_219_1394 | 373 |
| 143 | 3300005331 | Ga0070670_100002462 | Ga0070670_1000024627 | 374 |
| 144 | 3300005339 | Ga0070660_100108286 | Ga0070660_1001082861 | 374 |
| 145 | 3300005616 | Ga0068852_100395111 | Ga0068852_1003951111 | 374 |
| 146 | 3300009545 | Ga0105237_10268904 | Ga0105237_102689042 | 374 |
| 147 | 3300025912 | Ga0207707_10089694 | Ga0207707_100896942 | 374 |
| 148 | 3300025932 | Ga0207690_10185670 | Ga0207690_101856701 | 374 |
| 149 | 3300031727 | Ga0316576_10006734 | Ga0316576_100067345 | 374 |
| 150 | 3300049574 | Ga0501038_0217698 | Ga0501038_0217698_68_1258 | 374 |
| 151 | 3300049575 | Ga0501039_0170552 | Ga0501039_0170552_490_1692 | 374 |
| 152 | 3300049577 | Ga0501041_0124569 | Ga0501041_0124569_137_1327 | 374 |
| 153 | 3300049579 | Ga0501043_0113291 | Ga0501043_0113291_775_1977 | 374 |
| 154 | 3300049592 | Ga0501076_0013731 | Ga0501076_0013731_4700_5890 | 374 |
| 155 | 3300049822 | Ga0501035_0078062 | Ga0501035_0078062_1342_2544 | 374 |
| 156 | 3300060353 | Ga0501082_0021513 | Ga0501082_0021513_2864_4054 | 374 |
| 157 | 3300005344 | Ga0070661_100152321 | Ga0070661_1001523211 | 375 |
| 158 | 3300005367 | Ga0070667_100002607 | Ga0070667_1000026072 | 375 |
| 159 | 3300005548 | Ga0070665_100108904 | Ga0070665_1001089042 | 375 |
| 160 | 3300009174 | Ga0105241_10227820 | Ga0105241_102278202 | 375 |
| 161 | 3300013105 | Ga0157369_10191034 | Ga0157369_101910342 | 375 |
| 162 | 3300025909 | Ga0207705_10007416 | Ga0207705_100074166 | 375 |
| 163 | 3300025919 | Ga0207657_10032292 | Ga0207657_100322924 | 375 |
| 164 | 3300025921 | Ga0207652_10084782 | Ga0207652_100847823 | 375 |
| 165 | 3300025932 | Ga0207690_10030148 | Ga0207690_100301483 | 375 |
| 166 | 3300025986 | Ga0207658_10104759 | Ga0207658_101047592 | 375 |
| 167 | 3300026078 | Ga0207702_10192745 | Ga0207702_101927452 | 375 |
| 168 | 3300028379 | Ga0268266_10050430 | Ga0268266_100504303 | 375 |
| 169 | 3300035083 | Ga0373926_0001985 | Ga0373926_0001985_4304_5530 | 375 |
| 170 | 3300035695 | Ga0373927_0000442 | Ga0373927_0000442_4320_5546 | 375 |
| 171 | 3300035695 | Ga0373927_0156714 | Ga0373927_0156714_339_1475 | 375 |
| 172 | 3300035725 | Ga0373947_0058315 | Ga0373947_0058315_81_1307 | 375 |
| 173 | 3300037068 | Ga0373925_0002451 | Ga0373925_0002451_4332_5558 | 375 |
| 174 | 3300037418 | Ga0395900_0009629 | Ga0395900_0009629_3187_4359 | 375 |
| 175 | 3300037418 | Ga0395900_0062833 | Ga0395900_0062833_137_1309 | 375 |
| 176 | 3300037466 | Ga0395898_0039951 | Ga0395898_0039951_273_1445 | 375 |
| 177 | 3300037471 | Ga0395905_0007990 | Ga0395905_0007990_6067_7239 | 375 |
| 178 | 3300037471 | Ga0395905_0376655 | Ga0395905_0376655_109_1281 | 375 |
| 179 | 3300044694 | Ga0466963_0074221 | Ga0466963_0074221_354_1502 | 375 |
| 180 | 3300044694 | Ga0466963_0192911 | Ga0466963_0192911_133_1296 | 375 |
| 181 | 3300044706 | Ga0466964_0006640 | Ga0466964_0006640_2172_3335 | 375 |
| 182 | 3300045976 | Ga0466967_0055088 | Ga0466967_0055088_11_1174 | 375 |
| 183 | 3300045976 | Ga0466967_0065363 | Ga0466967_0065363_282_1430 | 375 |
| 184 | 3300046517 | Ga0495630_0010815 | Ga0495630_0010815_1046_2272 | 375 |
| 185 | 3300046526 | Ga0495666_0039038 | Ga0495666_0039038_384_1610 | 375 |
| 186 | 3300049584 | Ga0501068_0065527 | Ga0501068_0065527_169_1335 | 375 |
| 187 | 3300049585 | Ga0501069_0057290 | Ga0501069_0057290_994_2160 | 375 |
| 188 | 3300061734 | Ga0530510_0070335 | Ga0530510_0070335_201_1367 | 375 |
| 189 | 3300005344 | Ga0070661_100042426 | Ga0070661_1000424263 | 376 |
| 190 | 3300020070 | Ga0206356_10199250 | Ga0206356_101992501 | 376 |
| 191 | 3300025912 | Ga0207707_10053250 | Ga0207707_100532503 | 376 |
| 192 | 3300025915 | Ga0207693_10183250 | Ga0207693_101832502 | 376 |
| 193 | 3300025917 | Ga0207660_10036316 | Ga0207660_100363163 | 376 |
| 194 | 3300028653 | Ga0265323_10000808 | Ga0265323_1000080814 | 376 |
| 195 | 3300031344 | Ga0265316_10162262 | Ga0265316_101622621 | 376 |
| 196 | 3300049576 | Ga0501040_0105707 | Ga0501040_0105707_230_1426 | 376 |
| 197 | 3300060353 | Ga0501082_0066638 | Ga0501082_0066638_182_1378 | 376 |
| 198 | 3300005329 | Ga0070683_100006797 | Ga0070683_1000067979 | 377 |
| 199 | 3300005535 | Ga0070684_100005906 | Ga0070684_1000059069 | 377 |
| 200 | 3300005577 | Ga0068857_100005362 | Ga0068857_10000536212 | 377 |
| 201 | 3300025944 | Ga0207661_10005618 | Ga0207661_100056182 | 377 |
| 202 | 3300026116 | Ga0207674_10003025 | Ga0207674_1000302514 | 377 |
| 203 | 3300044684 | Ga0466966_0003064 | Ga0466966_0003064_1524_2693 | 377 |
| 204 | 3300045049 | Ga0466959_0018530 | Ga0466959_0018530_3438_4607 | 377 |
| 205 | 3300005614 | Ga0068856_100041360 | Ga0068856_1000413603 | 378 |
| 206 | 3300009093 | Ga0105240_10076034 | Ga0105240_100760342 | 378 |
| 207 | 3300009551 | Ga0105238_10002928 | Ga0105238_100029285 | 378 |
| 208 | 3300028556 | Ga0265337_1009313 | Ga0265337_10093133 | 378 |
| 209 | 3300028800 | Ga0265338_10145659 | Ga0265338_101456592 | 378 |
| 210 | 3300031249 | Ga0265339_10013432 | Ga0265339_100134322 | 378 |
| 211 | 3300031727 | Ga0316576_10047770 | Ga0316576_100477702 | 378 |
| 212 | 3300038443 | Ga0395901_0074377 | Ga0395901_0074377_31_1242 | 378 |
| 213 | 3300005330 | Ga0070690_100007018 | Ga0070690_1000070183 | 379 |
| 214 | 3300005458 | Ga0070681_10054309 | Ga0070681_100543094 | 379 |
| 215 | 3300009093 | Ga0105240_10216818 | Ga0105240_102168182 | 379 |
| 216 | 3300026078 | Ga0207702_10020867 | Ga0207702_100208674 | 379 |
| 217 | 3300026116 | Ga0207674_10131333 | Ga0207674_101313332 | 379 |
| 218 | 3300036401 | Ga0373937_0006833 | Ga0373937_0006833_2603_3766 | 379 |
| 219 | 3300046477 | Ga0495664_0028784 | Ga0495664_0028784_633_1796 | 379 |
| 220 | 3300046535 | Ga0495586_0122090 | Ga0495586_0122090_210_1373 | 379 |
| 221 | 3300047471 | Ga0495684_0069611 | Ga0495684_0069611_1404_2567 | 379 |
| 222 | 3300005444 | Ga0070694_100206913 | Ga0070694_1002069132 | 380 |
| 223 | 3300005549 | Ga0070704_100038753 | Ga0070704_1000387534 | 380 |
| 224 | 3300006195 | Ga0075366_10047113 | Ga0075366_100471132 | 380 |
| 225 | 3300005327 | Ga0070658_10074775 | Ga0070658_100747754 | 381 |
| 226 | 3300005339 | Ga0070660_100005436 | Ga0070660_1000054361 | 381 |
| 227 | 3300005471 | Ga0070698_100004488 | Ga0070698_10000448812 | 381 |
| 228 | 3300006051 | Ga0075364_10065154 | Ga0075364_100651543 | 381 |
| 229 | 3300006871 | Ga0075434_100264670 | Ga0075434_1002646702 | 381 |
| 230 | 3300006880 | Ga0075429_100115633 | Ga0075429_1001156332 | 381 |
| 231 | 3300025913 | Ga0207695_10100345 | Ga0207695_101003453 | 381 |
| 232 | 3300025923 | Ga0207681_10112143 | Ga0207681_101121432 | 381 |
| 233 | 3300025949 | Ga0207667_10098053 | Ga0207667_100980533 | 381 |
| 234 | 3300028380 | Ga0268265_10024420 | Ga0268265_100244203 | 381 |
| 235 | 3300049568 | Ga0501031_0118618 | Ga0501031_0118618_223_1422 | 381 |
| 236 | 3300049577 | Ga0501041_0075180 | Ga0501041_0075180_251_1450 | 381 |
| 237 | 3300049588 | Ga0501072_0091059 | Ga0501072_0091059_296_1495 | 381 |
| 238 | 3300049592 | Ga0501076_0078554 | Ga0501076_0078554_97_1296 | 381 |
| 239 | 3300049741 | Ga0501079_0242910 | Ga0501079_0242910_97_1296 | 381 |
| 240 | 3300050508 | nmdc:mga09592_54673_c1 | nmdc:mga09592_54673_c1_786_2003 | 381 |
| 241 | 3300005339 | Ga0070660_100002320 | Ga0070660_1000023208 | 382 |
| 242 | 3300005458 | Ga0070681_10030459 | Ga0070681_100304594 | 382 |
| 243 | 3300005563 | Ga0068855_100045953 | Ga0068855_1000459535 | 382 |
| 244 | 3300005615 | Ga0070702_100127938 | Ga0070702_1001279382 | 382 |
| 245 | 3300006881 | Ga0068865_100115160 | Ga0068865_1001151602 | 382 |
| 246 | 3300014497 | Ga0182008_10071496 | Ga0182008_100714962 | 382 |
| 247 | 3300025912 | Ga0207707_10020321 | Ga0207707_100203212 | 382 |
| 248 | 3300025919 | Ga0207657_10002101 | Ga0207657_1000210116 | 382 |
| 249 | 3300025921 | Ga0207652_10027406 | Ga0207652_100274062 | 382 |
| 250 | 3300028800 | Ga0265338_10000808 | Ga0265338_100008084 | 382 |
| 251 | 3300031247 | Ga0265340_10000208 | Ga0265340_1000020811 | 382 |
| 252 | 3300046454 | Ga0495592_0157188 | Ga0495592_0157188_300_1505 | 382 |
| 253 | 3300049568 | Ga0501031_0021793 | Ga0501031_0021793_2449_3666 | 382 |
| 254 | 3300049572 | Ga0501036_0054509 | Ga0501036_0054509_29_1246 | 382 |
| 255 | 3300049576 | Ga0501040_0084447 | Ga0501040_0084447_342_1559 | 382 |
| 256 | 3300049591 | Ga0501075_0010180 | Ga0501075_0010180_4257_5474 | 382 |
| 257 | 3300049592 | Ga0501076_0014008 | Ga0501076_0014008_1457_2674 | 382 |
| 258 | 3300005364 | Ga0070673_100183679 | Ga0070673_1001836792 | 383 |
| 259 | 3300005365 | Ga0070688_100059959 | Ga0070688_1000599592 | 383 |
| 260 | 3300005366 | Ga0070659_100163212 | Ga0070659_1001632122 | 383 |
| 261 | 3300005617 | Ga0068859_100154498 | Ga0068859_1001544982 | 383 |
| 262 | 3300005618 | Ga0068864_100029683 | Ga0068864_1000296833 | 383 |
| 263 | 3300006844 | Ga0075428_100057093 | Ga0075428_1000570932 | 383 |
| 264 | 3300006852 | Ga0075433_10073451 | Ga0075433_100734512 | 383 |
| 265 | 3300006880 | Ga0075429_100046673 | Ga0075429_1000466734 | 383 |
| 266 | 3300006931 | Ga0097620_100154495 | Ga0097620_1001544952 | 383 |
| 267 | 3300009094 | Ga0111539_10198647 | Ga0111539_101986472 | 383 |
| 268 | 3300009177 | Ga0105248_10052164 | Ga0105248_100521642 | 383 |
| 269 | 3300025960 | Ga0207651_10149597 | Ga0207651_101495972 | 383 |
| 270 | 3300027907 | Ga0207428_10182139 | Ga0207428_101821392 | 383 |
| 271 | 3300028800 | Ga0265338_10015698 | Ga0265338_100156982 | 383 |
| 272 | 3300044683 | Ga0466965_0053540 | Ga0466965_0053540_728_1942 | 383 |
| 273 | 3300044693 | Ga0466961_0006703 | Ga0466961_0006703_4686_5900 | 383 |
| 274 | 3300044694 | Ga0466963_0028739 | Ga0466963_0028739_1135_2349 | 383 |
| 275 | 3300044719 | Ga0466971_0001127 | Ga0466971_0001127_8306_9520 | 383 |
| 276 | 3300044842 | Ga0466957_0034198 | Ga0466957_0034198_1037_2251 | 383 |
| 277 | 3300045049 | Ga0466959_0165675 | Ga0466959_0165675_106_1320 | 383 |
| 278 | 3300045836 | Ga0466958_0006784 | Ga0466958_0006784_4161_5375 | 383 |
| 279 | 3300046529 | Ga0495652_0220923 | Ga0495652_0220923_12_1181 | 383 |
| 280 | 3300046543 | Ga0495645_0061296 | Ga0495645_0061296_357_1526 | 383 |
| 281 | 3300047320 | Ga0495672_0000882 | Ga0495672_0000882_21265_22449 | 383 |
| 282 | 3300050508 | nmdc:mga09592_19269_c1 | nmdc:mga09592_19269_c1_1736_2917 | 383 |
| 283 | 3300005549 | Ga0070704_100220523 | Ga0070704_1002205232 | 384 |
| 284 | 3300006844 | Ga0075428_100006228 | Ga0075428_1000062285 | 384 |
| 285 | 3300006847 | Ga0075431_100243744 | Ga0075431_1002437442 | 384 |
| 286 | 3300009177 | Ga0105248_10209096 | Ga0105248_102090962 | 384 |
| 287 | 3300013104 | Ga0157370_10146551 | Ga0157370_101465512 | 384 |
| 288 | 3300025921 | Ga0207652_10024327 | Ga0207652_100243273 | 384 |
| 289 | 3300025931 | Ga0207644_10145282 | Ga0207644_101452821 | 384 |
| 290 | 3300025940 | Ga0207691_10027345 | Ga0207691_100273452 | 384 |
| 291 | 3300029957 | Ga0265324_10016597 | Ga0265324_100165972 | 384 |
| 292 | 3300031247 | Ga0265340_10002875 | Ga0265340_100028755 | 384 |
| 293 | 3300050507 | nmdc:mga05p37_98941_c1 | nmdc:mga05p37_98941_c1_1793_2977 | 384 |
| 294 | 3300005327 | Ga0070658_10056106 | Ga0070658_100561064 | 385 |
| 295 | 3300005329 | Ga0070683_100202931 | Ga0070683_1002029311 | 385 |
| 296 | 3300005445 | Ga0070708_100046444 | Ga0070708_1000464443 | 385 |
| 297 | 3300005467 | Ga0070706_100002661 | Ga0070706_10000266110 | 385 |
| 298 | 3300005467 | Ga0070706_100203695 | Ga0070706_1002036952 | 385 |
| 299 | 3300005518 | Ga0070699_100024049 | Ga0070699_1000240492 | 385 |
| 300 | 3300005536 | Ga0070697_100004973 | Ga0070697_1000049738 | 385 |
| 301 | 3300005563 | Ga0068855_100125625 | Ga0068855_1001256254 | 385 |
| 302 | 3300005615 | Ga0070702_100149438 | Ga0070702_1001494381 | 385 |
| 303 | 3300006871 | Ga0075434_100250915 | Ga0075434_1002509151 | 385 |
| 304 | 3300013307 | Ga0157372_10257909 | Ga0157372_102579091 | 385 |
| 305 | 3300021384 | Ga0213876_10063781 | Ga0213876_100637811 | 385 |
| 306 | 3300025922 | Ga0207646_10001967 | Ga0207646_100019679 | 385 |
| 307 | 3300028800 | Ga0265338_10017598 | Ga0265338_100175982 | 385 |
| 308 | 3300028800 | Ga0265338_10021100 | Ga0265338_100211008 | 385 |
| 309 | 3300029957 | Ga0265324_10000275 | Ga0265324_100002753 | 385 |
| 310 | 3300031665 | Ga0316575_10000137 | Ga0316575_1000013710 | 385 |
| 311 | 3300031665 | Ga0316575_10003349 | Ga0316575_100033492 | 385 |
| 312 | 3300031665 | Ga0316575_10013470 | Ga0316575_100134702 | 385 |
| 313 | 3300031691 | Ga0316579_10011595 | Ga0316579_100115952 | 385 |
| 314 | 3300031691 | Ga0316579_10017849 | Ga0316579_100178494 | 385 |
| 315 | 3300031691 | Ga0316579_10046136 | Ga0316579_100461362 | 385 |
| 316 | 3300031727 | Ga0316576_10007773 | Ga0316576_100077735 | 385 |
| 317 | 3300031727 | Ga0316576_10023339 | Ga0316576_100233392 | 385 |
| 318 | 3300031727 | Ga0316576_10024125 | Ga0316576_100241253 | 385 |
| 319 | 3300031727 | Ga0316576_10049913 | Ga0316576_100499132 | 385 |
| 320 | 3300031727 | Ga0316576_10067626 | Ga0316576_100676262 | 385 |
| 321 | 3300031727 | Ga0316576_10076170 | Ga0316576_100761701 | 385 |
| 322 | 3300031728 | Ga0316578_10002110 | Ga0316578_100021102 | 385 |
| 323 | 3300031728 | Ga0316578_10003250 | Ga0316578_100032504 | 385 |
| 324 | 3300031728 | Ga0316578_10004444 | Ga0316578_100044442 | 385 |
| 325 | 3300031728 | Ga0316578_10026658 | Ga0316578_100266582 | 385 |
| 326 | 3300031728 | Ga0316578_10028855 | Ga0316578_100288552 | 385 |
| 327 | 3300031728 | Ga0316578_10136752 | Ga0316578_101367522 | 385 |
| 328 | 3300031733 | Ga0316577_10003305 | Ga0316577_100033057 | 385 |
| 329 | 3300031733 | Ga0316577_10011104 | Ga0316577_100111042 | 385 |
| 330 | 3300031733 | Ga0316577_10021614 | Ga0316577_100216143 | 385 |
| 331 | 3300031733 | Ga0316577_10042046 | Ga0316577_100420463 | 385 |
| 332 | 3300031733 | Ga0316577_10043114 | Ga0316577_100431142 | 385 |
| 333 | 3300032133 | Ga0316583_10001633 | Ga0316583_100016339 | 385 |
| 334 | 3300032133 | Ga0316583_10008407 | Ga0316583_100084072 | 385 |
| 335 | 3300032133 | Ga0316583_10010921 | Ga0316583_100109212 | 385 |
| 336 | 3300032133 | Ga0316583_10017925 | Ga0316583_100179253 | 385 |
| 337 | 3300032133 | Ga0316583_10027753 | Ga0316583_100277532 | 385 |
| 338 | 3300032137 | Ga0316585_10002173 | Ga0316585_100021732 | 385 |
| 339 | 3300032137 | Ga0316585_10023486 | Ga0316585_100234862 | 385 |
| 340 | 3300032137 | Ga0316585_10041778 | Ga0316585_100417781 | 385 |
| 341 | 3300032139 | Ga0316580_10006464 | Ga0316580_100064643 | 385 |
| 342 | 3300032168 | Ga0316593_10006804 | Ga0316593_100068045 | 385 |
| 343 | 3300033524 | Ga0316592_1016432 | Ga0316592_10164322 | 385 |
| 344 | 3300035398 | Ga0316574_0002636 | Ga0316574_0002636_521_1687 | 385 |
| 345 | 3300035398 | Ga0316574_0090720 | Ga0316574_0090720_290_1462 | 385 |
| 346 | 3300035398 | Ga0316574_0121083 | Ga0316574_0121083_370_1533 | 385 |
| 347 | 3300036647 | Ga0316582_0000276 | Ga0316582_0000276_9657_10820 | 385 |
| 348 | 3300036647 | Ga0316582_0000544 | Ga0316582_0000544_12580_13746 | 385 |
| 349 | 3300036647 | Ga0316582_0000865 | Ga0316582_0000865_371_1534 | 385 |
| 350 | 3300036647 | Ga0316582_0007404 | Ga0316582_0007404_2095_3264 | 385 |
| 351 | 3300036647 | Ga0316582_0018348 | Ga0316582_0018348_2101_3267 | 385 |
| 352 | 3300036647 | Ga0316582_0121905 | Ga0316582_0121905_563_1726 | 385 |
| 353 | 3300036712 | Ga0316584_0005032 | Ga0316584_0005032_3802_4965 | 385 |
| 354 | 3300036712 | Ga0316584_0013494 | Ga0316584_0013494_3314_4486 | 385 |
| 355 | 3300036712 | Ga0316584_0017467 | Ga0316584_0017467_522_1685 | 385 |
| 356 | 3300036712 | Ga0316584_0024858 | Ga0316584_0024858_426_1595 | 385 |
| 357 | 3300036712 | Ga0316584_0038300 | Ga0316584_0038300_519_1685 | 385 |
| 358 | 3300036712 | Ga0316584_0083163 | Ga0316584_0083163_51_1214 | 385 |
| 359 | 3300036712 | Ga0316584_0087525 | Ga0316584_0087525_861_2027 | 385 |
| 360 | 3300036712 | Ga0316584_0128813 | Ga0316584_0128813_364_1530 | 385 |
| 361 | 3300036712 | Ga0316584_0145687 | Ga0316584_0145687_118_1281 | 385 |
| 362 | 3300036712 | Ga0316584_0156528 | Ga0316584_0156528_216_1385 | 385 |
| 363 | 3300037588 | Ga0316581_0005654 | Ga0316581_0005654_1415_2581 | 385 |
| 364 | 3300038726 | Ga0400490_08090 | Ga0400490_08090_796_1962 | 385 |
| 365 | 3300038726 | Ga0400490_08299 | Ga0400490_08299_94_1260 | 385 |
| 366 | 3300038726 | Ga0400490_16839 | Ga0400490_16839_11439_12605 | 385 |
| 367 | 3300038727 | Ga0400491_08615 | Ga0400491_08615_1138_2304 | 385 |
| 368 | 3300038727 | Ga0400491_24515 | Ga0400491_24515_536_1702 | 385 |
| 369 | 3300038735 | Ga0400485_00122 | Ga0400485_00122_10837_12003 | 385 |
| 370 | 3300038735 | Ga0400485_17873 | Ga0400485_17873_16727_17893 | 385 |
| 371 | 3300038742 | Ga0400486_21674 | Ga0400486_21674_3150_4316 | 385 |
| 372 | 3300038742 | Ga0400486_23273 | Ga0400486_23273_12640_13806 | 385 |
| 373 | 3300039062 | Ga0400483_129331 | Ga0400483_129331_904_2079 | 385 |
| 374 | 3300039062 | Ga0400483_204894 | Ga0400483_204894_241_1404 | 385 |
| 375 | 3300039093 | Ga0400489_04024 | Ga0400489_04024_10234_11400 | 385 |
| 376 | 3300039093 | Ga0400489_24971 | Ga0400489_24971_1862_3028 | 385 |
| 377 | 3300039093 | Ga0400489_26114 | Ga0400489_26114_12974_14137 | 385 |
| 378 | 3300039093 | Ga0400489_29570 | Ga0400489_29570_2130_3296 | 385 |
| 379 | 3300039110 | Ga0400487_63934 | Ga0400487_63934_14644_15810 | 385 |
| 380 | 3300039437 | Ga0436365_0178835 | Ga0436365_0178835_14870_16036 | 385 |
| 381 | 3300050494 | nmdc:mga06z11_125646_c1 | nmdc:mga06z11_125646_c1_15_1250 | 385 |
| 382 | 3300050494 | nmdc:mga06z11_19555_c1 | nmdc:mga06z11_19555_c1_194_1393 | 385 |
| 383 | 3300050495 | nmdc:mga04h51_19876_c1 | nmdc:mga04h51_19876_c1_408_1607 | 385 |
| 384 | 3300050507 | nmdc:mga05p37_131624_c1 | nmdc:mga05p37_131624_c1_402_1598 | 385 |
| 385 | 3300050512 | nmdc:mga0n895_383551_c1 | nmdc:mga0n895_383551_c1_40_1239 | 385 |
| 386 | 3300005330 | Ga0070690_100129028 | Ga0070690_1001290282 | 386 |
| 387 | 3300005445 | Ga0070708_100011673 | Ga0070708_1000116734 | 386 |
| 388 | 3300005468 | Ga0070707_100099636 | Ga0070707_1000996362 | 386 |
| 389 | 3300005471 | Ga0070698_100036805 | Ga0070698_1000368053 | 386 |
| 390 | 3300005536 | Ga0070697_100088508 | Ga0070697_1000885082 | 386 |
| 391 | 3300005618 | Ga0068864_100354739 | Ga0068864_1003547392 | 386 |
| 392 | 3300006880 | Ga0075429_100000847 | Ga0075429_10000084724 | 386 |
| 393 | 3300009147 | Ga0114129_10000576 | Ga0114129_1000057627 | 386 |
| 394 | 3300014968 | Ga0157379_10325323 | Ga0157379_103253231 | 386 |
| 395 | 3300025910 | Ga0207684_10042749 | Ga0207684_100427492 | 386 |
| 396 | 3300025922 | Ga0207646_10011019 | Ga0207646_100110197 | 386 |
| 397 | 3300050507 | nmdc:mga05p37_1863_c1 | nmdc:mga05p37_1863_c1_8127_9323 | 386 |
| 398 | 3300050508 | nmdc:mga09592_2682_c1 | nmdc:mga09592_2682_c1_7073_8269 | 386 |
| 399 | 3300050509 | nmdc:mga0qj67_314533_c1 | nmdc:mga0qj67_314533_c1_14_1210 | 386 |
| 400 | 3300006178 | Ga0075367_10022928 | Ga0075367_100229282 | 387 |
| 401 | 3300006847 | Ga0075431_100037924 | Ga0075431_1000379244 | 387 |
| 402 | 3300006847 | Ga0075431_100078369 | Ga0075431_1000783695 | 387 |
| 403 | 3300009147 | Ga0114129_10040693 | Ga0114129_100406933 | 387 |
| 404 | 3300009147 | Ga0114129_10042343 | Ga0114129_100423436 | 387 |
| 405 | 3300050507 | nmdc:mga05p37_113161_c1 | nmdc:mga05p37_113161_c1_153_1358 | 387 |
| 406 | 3300050507 | nmdc:mga05p37_69916_c1 | nmdc:mga05p37_69916_c1_761_1963 | 387 |
| 407 | 3300050508 | nmdc:mga09592_217996_c1 | nmdc:mga09592_217996_c1_69_1307 | 387 |
| 408 | 3300050510 | nmdc:mga06r32_1717_c1 | nmdc:mga06r32_1717_c1_1276_2478 | 387 |
| 409 | 3300050515 | nmdc:mga0a205_23008_c1 | nmdc:mga0a205_23008_c1_1159_2361 | 387 |
| 410 | 3300050515 | nmdc:mga0a205_295831_c1 | nmdc:mga0a205_295831_c1_113_1315 | 387 |
| 411 | 3300005334 | Ga0068869_100014927 | Ga0068869_1000149275 | 388 |
| 412 | 3300005335 | Ga0070666_10031519 | Ga0070666_100315193 | 388 |
| 413 | 3300005340 | Ga0070689_100052289 | Ga0070689_1000522891 | 388 |
| 414 | 3300005347 | Ga0070668_100127101 | Ga0070668_1001271011 | 388 |
| 415 | 3300005353 | Ga0070669_100129148 | Ga0070669_1001291482 | 388 |
| 416 | 3300005354 | Ga0070675_100010502 | Ga0070675_1000105027 | 388 |
| 417 | 3300005356 | Ga0070674_100021050 | Ga0070674_1000210502 | 388 |
| 418 | 3300005438 | Ga0070701_10006287 | Ga0070701_100062871 | 388 |
| 419 | 3300005456 | Ga0070678_100104839 | Ga0070678_1001048391 | 388 |
| 420 | 3300005459 | Ga0068867_100033566 | Ga0068867_1000335663 | 388 |
| 421 | 3300005471 | Ga0070698_100012216 | Ga0070698_1000122165 | 388 |
| 422 | 3300005543 | Ga0070672_100032584 | Ga0070672_1000325842 | 388 |
| 423 | 3300005548 | Ga0070665_100078493 | Ga0070665_1000784932 | 388 |
| 424 | 3300005549 | Ga0070704_100127547 | Ga0070704_1001275472 | 388 |
| 425 | 3300005563 | Ga0068855_100133062 | Ga0068855_1001330622 | 388 |
| 426 | 3300005617 | Ga0068859_100108923 | Ga0068859_1001089233 | 388 |
| 427 | 3300005719 | Ga0068861_100196693 | Ga0068861_1001966931 | 388 |
| 428 | 3300005841 | Ga0068863_100045249 | Ga0068863_1000452492 | 388 |
| 429 | 3300005842 | Ga0068858_100013534 | Ga0068858_1000135347 | 388 |
| 430 | 3300005844 | Ga0068862_100059002 | Ga0068862_1000590023 | 388 |
| 431 | 3300006038 | Ga0075365_10009882 | Ga0075365_100098826 | 388 |
| 432 | 3300006051 | Ga0075364_10041319 | Ga0075364_100413193 | 388 |
| 433 | 3300006177 | Ga0075362_10005868 | Ga0075362_100058684 | 388 |
| 434 | 3300006186 | Ga0075369_10015744 | Ga0075369_100157443 | 388 |
| 435 | 3300006195 | Ga0075366_10000451 | Ga0075366_1000045110 | 388 |
| 436 | 3300006353 | Ga0075370_10017369 | Ga0075370_100173692 | 388 |
| 437 | 3300006871 | Ga0075434_100077099 | Ga0075434_1000770992 | 388 |
| 438 | 3300006880 | Ga0075429_100027456 | Ga0075429_1000274565 | 388 |
| 439 | 3300006931 | Ga0097620_100108925 | Ga0097620_1001089253 | 388 |
| 440 | 3300007076 | Ga0075435_100091424 | Ga0075435_1000914241 | 388 |
| 441 | 3300009094 | Ga0111539_10000113 | Ga0111539_1000011334 | 388 |
| 442 | 3300009148 | Ga0105243_10019388 | Ga0105243_100193883 | 388 |
| 443 | 3300009177 | Ga0105248_10020953 | Ga0105248_100209535 | 388 |
| 444 | 3300025899 | Ga0207642_10010166 | Ga0207642_100101663 | 388 |
| 445 | 3300025907 | Ga0207645_10018651 | Ga0207645_100186512 | 388 |
| 446 | 3300025908 | Ga0207643_10049752 | Ga0207643_100497522 | 388 |
| 447 | 3300025926 | Ga0207659_10015782 | Ga0207659_100157822 | 388 |
| 448 | 3300025935 | Ga0207709_10044125 | Ga0207709_100441253 | 388 |
| 449 | 3300025936 | Ga0207670_10028908 | Ga0207670_100289082 | 388 |
| 450 | 3300025938 | Ga0207704_10009641 | Ga0207704_100096415 | 388 |
| 451 | 3300025940 | Ga0207691_10001566 | Ga0207691_1000156616 | 388 |
| 452 | 3300025941 | Ga0207711_10111400 | Ga0207711_101114002 | 388 |
| 453 | 3300025942 | Ga0207689_10047058 | Ga0207689_100470583 | 388 |
| 454 | 3300025960 | Ga0207651_10046661 | Ga0207651_100466612 | 388 |
| 455 | 3300026023 | Ga0207677_10020219 | Ga0207677_100202194 | 388 |
| 456 | 3300026035 | Ga0207703_10021316 | Ga0207703_100213163 | 388 |
| 457 | 3300026075 | Ga0207708_10018651 | Ga0207708_100186515 | 388 |
| 458 | 3300026088 | Ga0207641_10019532 | Ga0207641_100195322 | 388 |
| 459 | 3300026089 | Ga0207648_10013312 | Ga0207648_100133122 | 388 |
| 460 | 3300026118 | Ga0207675_100037088 | Ga0207675_1000370885 | 388 |
| 461 | 3300026121 | Ga0207683_10082157 | Ga0207683_100821572 | 388 |
| 462 | 3300027907 | Ga0207428_10000197 | Ga0207428_1000019768 | 388 |
| 463 | 3300028380 | Ga0268265_10021110 | Ga0268265_100211102 | 388 |
| 464 | 3300028381 | Ga0268264_10034012 | Ga0268264_100340125 | 388 |
| 465 | 3300050492 | nmdc:mga0yw44_36808_c1 | nmdc:mga0yw44_36808_c1_720_1928 | 388 |
| 466 | 3300050493 | nmdc:mga0k408_50396_c1 | nmdc:mga0k408_50396_c1_119_1327 | 388 |
| 467 | 3300050494 | nmdc:mga06z11_3557_c1 | nmdc:mga06z11_3557_c1_2453_3661 | 388 |
| 468 | 3300050496 | nmdc:mga07m45_5086_c1 | nmdc:mga07m45_5086_c1_302_1510 | 388 |
| 469 | 3300050508 | nmdc:mga09592_205088_c1 | nmdc:mga09592_205088_c1_333_1541 | 388 |
| 470 | 3300050511 | nmdc:mga08y16_3313_c1 | nmdc:mga08y16_3313_c1_14151_15359 | 388 |
| 471 | 3300050512 | nmdc:mga0n895_166472_c1 | nmdc:mga0n895_166472_c1_84_1295 | 388 |
| 472 | 3300005347 | Ga0070668_100122503 | Ga0070668_1001225032 | 389 |
| 473 | 3300005844 | Ga0068862_100042914 | Ga0068862_1000429145 | 389 |
| 474 | 3300006847 | Ga0075431_100363379 | Ga0075431_1003633792 | 389 |
| 475 | 3300009147 | Ga0114129_10001509 | Ga0114129_1000150911 | 389 |
| 476 | 3300026116 | Ga0207674_10180666 | Ga0207674_101806662 | 389 |
| 477 | 3300031251 | Ga0265327_10016400 | Ga0265327_100164003 | 389 |
| 478 | 3300031727 | Ga0316576_10011164 | Ga0316576_100111644 | 389 |
| 479 | 3300035398 | Ga0316574_0013133 | Ga0316574_0013133_1518_2732 | 389 |
| 480 | 3300050507 | nmdc:mga05p37_61614_c1 | nmdc:mga05p37_61614_c1_1184_2440 | 389 |
| 481 | 3300025885 | Ga0207653_10030449 | Ga0207653_100304491 | 390 |
| 482 | 3300025949 | Ga0207667_10154276 | Ga0207667_101542762 | 390 |
| 483 | 3300049577 | Ga0501041_0112300 | Ga0501041_0112300_383_1609 | 390 |
| 484 | 3300005444 | Ga0070694_100027022 | Ga0070694_1000270221 | 391 |
| 485 | 3300005467 | Ga0070706_100036392 | Ga0070706_1000363926 | 391 |
| 486 | 3300005471 | Ga0070698_100022136 | Ga0070698_1000221365 | 391 |
| 487 | 3300005545 | Ga0070695_100056111 | Ga0070695_1000561112 | 391 |
| 488 | 3300005546 | Ga0070696_100216558 | Ga0070696_1002165581 | 391 |
| 489 | 3300013104 | Ga0157370_10087563 | Ga0157370_100875632 | 391 |
| 490 | 3300028800 | Ga0265338_10000032 | Ga0265338_1000003247 | 391 |
| 491 | 3300029957 | Ga0265324_10000434 | Ga0265324_100004347 | 391 |
| 492 | 3300042876 | Ga0451577_0237047 | Ga0451577_0237047_305_1525 | 391 |
| 493 | 3300005435 | Ga0070714_100015285 | Ga0070714_1000152853 | 392 |
| 494 | 3300025929 | Ga0207664_10024852 | Ga0207664_100248525 | 392 |
| 495 | 3300028800 | Ga0265338_10004439 | Ga0265338_1000443916 | 392 |
| 496 | 3300029957 | Ga0265324_10008137 | Ga0265324_100081375 | 392 |
| 497 | 3300036401 | Ga0373937_0058419 | Ga0373937_0058419_1732_2925 | 392 |
| 498 | 3300026088 | Ga0207641_10049937 | Ga0207641_100499372 | 393 |
| 499 | 3300028800 | Ga0265338_10107801 | Ga0265338_101078012 | 393 |
| 500 | 3300042876 | Ga0451577_0015600 | Ga0451577_0015600_4628_5827 | 393 |
| 501 | 3300044712 | Ga0453684_0194504 | Ga0453684_0194504_985_2190 | 393 |
| 502 | 3300049570 | Ga0501033_0012811 | Ga0501033_0012811_2469_3674 | 393 |
| 503 | 3300005335 | Ga0070666_10028244 | Ga0070666_100282444 | 394 |
| 504 | 3300005341 | Ga0070691_10024267 | Ga0070691_100242672 | 394 |
| 505 | 3300005364 | Ga0070673_100152841 | Ga0070673_1001528412 | 394 |
| 506 | 3300005614 | Ga0068856_100029138 | Ga0068856_1000291383 | 394 |
| 507 | 3300006358 | Ga0068871_100014149 | Ga0068871_1000141492 | 394 |
| 508 | 3300006931 | Ga0097620_100321597 | Ga0097620_1003215972 | 394 |
| 509 | 3300007076 | Ga0075435_100129022 | Ga0075435_1001290222 | 394 |
| 510 | 3300013308 | Ga0157375_10000006 | Ga0157375_10000006213 | 394 |
| 511 | 3300014325 | Ga0163163_10368666 | Ga0163163_103686661 | 394 |
| 512 | 3300025938 | Ga0207704_10135741 | Ga0207704_101357412 | 394 |
| 513 | 3300026116 | Ga0207674_10096275 | Ga0207674_100962753 | 394 |
| 514 | 3300028800 | Ga0265338_10000605 | Ga0265338_100006058 | 394 |
| 515 | 3300028800 | Ga0265338_10003037 | Ga0265338_100030377 | 394 |
| 516 | 3300042876 | Ga0451577_0003436 | Ga0451577_0003436_11335_12537 | 394 |
| 517 | 3300044712 | Ga0453684_0004628 | Ga0453684_0004628_22353_23555 | 394 |
| 518 | 3300045051 | Ga0451576_0028983 | Ga0451576_0028983_94_1296 | 394 |
| 519 | 3300045051 | Ga0451576_0101374 | Ga0451576_0101374_691_1893 | 394 |
| 520 | 3300045051 | Ga0451576_0119407 | Ga0451576_0119407_1021_2238 | 394 |
| 521 | 3300046473 | Ga0495582_0008132 | Ga0495582_0008132_4034_5236 | 394 |
| 522 | 3300046517 | Ga0495630_0000010 | Ga0495630_0000010_110262_111464 | 394 |
| 523 | 3300046535 | Ga0495586_0000048 | Ga0495586_0000048_54577_55779 | 394 |
| 524 | 3300046642 | Ga0495634_0018314 | Ga0495634_0018314_1396_2598 | 394 |
| 525 | 3300046678 | Ga0495599_0022090 | Ga0495599_0022090_2362_3567 | 394 |
| 526 | 3300047319 | Ga0495674_0001886 | Ga0495674_0001886_8786_9988 | 394 |
| 527 | 3300005330 | Ga0070690_100150748 | Ga0070690_1001507482 | 395 |
| 528 | 3300005365 | Ga0070688_100098166 | Ga0070688_1000981662 | 395 |
| 529 | 3300005458 | Ga0070681_10074824 | Ga0070681_100748243 | 395 |
| 530 | 3300005530 | Ga0070679_100132479 | Ga0070679_1001324792 | 395 |
| 531 | 3300005563 | Ga0068855_100039565 | Ga0068855_1000395656 | 395 |
| 532 | 3300005614 | Ga0068856_100001681 | Ga0068856_10000168123 | 395 |
| 533 | 3300025913 | Ga0207695_10049797 | Ga0207695_100497972 | 395 |
| 534 | 3300025921 | Ga0207652_10162013 | Ga0207652_101620132 | 395 |
| 535 | 3300025949 | Ga0207667_10256321 | Ga0207667_102563212 | 395 |
| 536 | 3300026078 | Ga0207702_10000808 | Ga0207702_100008082 | 395 |
| 537 | 3300028563 | Ga0265319_1011301 | Ga0265319_10113013 | 395 |
| 538 | 3300028653 | Ga0265323_10009676 | Ga0265323_100096764 | 395 |
| 539 | 3300028800 | Ga0265338_10000487 | Ga0265338_1000048725 | 395 |
| 540 | 3300028800 | Ga0265338_10006433 | Ga0265338_1000643312 | 395 |
| 541 | 3300028800 | Ga0265338_10032281 | Ga0265338_100322813 | 395 |
| 542 | 3300028800 | Ga0265338_10036354 | Ga0265338_100363544 | 395 |
| 543 | 3300029957 | Ga0265324_10027158 | Ga0265324_100271583 | 395 |
| 544 | 3300031240 | Ga0265320_10015186 | Ga0265320_100151863 | 395 |
| 545 | 3300031241 | Ga0265325_10073717 | Ga0265325_100737172 | 395 |
| 546 | 3300031249 | Ga0265339_10043425 | Ga0265339_100434253 | 395 |
| 547 | 3300031251 | Ga0265327_10001424 | Ga0265327_1000142420 | 395 |
| 548 | 3300031344 | Ga0265316_10001616 | Ga0265316_1000161621 | 395 |
| 549 | 3300031595 | Ga0265313_10026169 | Ga0265313_100261693 | 395 |
| 550 | 3300031711 | Ga0265314_10011022 | Ga0265314_100110228 | 395 |
| 551 | 3300035118 | Ga0373954_0019754 | Ga0373954_0019754_321_1508 | 395 |
| 552 | 3300035119 | Ga0373956_0071153 | Ga0373956_0071153_192_1394 | 395 |
| 553 | 3300035692 | Ga0373935_0018453 | Ga0373935_0018453_2159_3364 | 395 |
| 554 | 3300035692 | Ga0373935_0127303 | Ga0373935_0127303_374_1576 | 395 |
| 555 | 3300035725 | Ga0373947_0018292 | Ga0373947_0018292_1318_2523 | 395 |
| 556 | 3300036401 | Ga0373937_0047621 | Ga0373937_0047621_2354_3541 | 395 |
| 557 | 3300045051 | Ga0451576_0125277 | Ga0451576_0125277_1290_2495 | 395 |
| 558 | 3300046517 | Ga0495630_0015375 | Ga0495630_0015375_3895_5082 | 395 |
| 559 | 3300046517 | Ga0495630_0044356 | Ga0495630_0044356_345_1550 | 395 |
| 560 | 3300046533 | Ga0495640_0112665 | Ga0495640_0112665_25_1212 | 395 |
| 561 | 3300046535 | Ga0495586_0001538 | Ga0495586_0001538_8726_9913 | 395 |
| 562 | 3300046543 | Ga0495645_0136467 | Ga0495645_0136467_277_1479 | 395 |
| 563 | 3300046642 | Ga0495634_0018945 | Ga0495634_0018945_1407_2594 | 395 |
| 564 | 3300046678 | Ga0495599_0091371 | Ga0495599_0091371_643_1845 | 395 |
| 565 | 3300046681 | Ga0495647_0017659 | Ga0495647_0017659_248_1435 | 395 |
| 566 | 3300046689 | Ga0495613_0001643 | Ga0495613_0001643_3184_4371 | 395 |
| 567 | 3300046690 | Ga0495624_0032378 | Ga0495624_0032378_761_1966 | 395 |
| 568 | 3300047319 | Ga0495674_0024817 | Ga0495674_0024817_138_1340 | 395 |
| 569 | 3300047322 | Ga0495680_0002831 | Ga0495680_0002831_5003_6190 | 395 |
| 570 | 3300028556 | Ga0265337_1000420 | Ga0265337_100042016 | 396 |
| 571 | 3300028563 | Ga0265319_1010521 | Ga0265319_10105214 | 396 |
| 572 | 3300028800 | Ga0265338_10006466 | Ga0265338_100064664 | 396 |
| 573 | 3300028800 | Ga0265338_10009600 | Ga0265338_100096004 | 396 |
| 574 | 3300028800 | Ga0265338_10012683 | Ga0265338_1001268310 | 396 |
| 575 | 3300031344 | Ga0265316_10066286 | Ga0265316_100662862 | 396 |
| 576 | 3300031711 | Ga0265314_10029742 | Ga0265314_100297423 | 396 |
| 577 | 3300031711 | Ga0265314_10064052 | Ga0265314_100640522 | 396 |
| 578 | 3300005439 | Ga0070711_100006453 | Ga0070711_1000064535 | 397 |
| 579 | 3300005841 | Ga0068863_100216170 | Ga0068863_1002161702 | 397 |
| 580 | 3300025916 | Ga0207663_10006313 | Ga0207663_100063135 | 397 |
| 581 | 3300028800 | Ga0265338_10052764 | Ga0265338_100527642 | 397 |
| 582 | 3300034816 | Ga0373930_0001976 | Ga0373930_0001976_1891_3093 | 397 |
| 583 | 3300035085 | Ga0373929_0004550 | Ga0373929_0004550_225_1427 | 397 |
| 584 | 3300035089 | Ga0373944_0002365 | Ga0373944_0002365_1413_2615 | 397 |
| 585 | 3300035090 | Ga0373949_0001197 | Ga0373949_0001197_4812_6014 | 397 |
| 586 | 3300035091 | Ga0373951_0002160 | Ga0373951_0002160_206_1408 | 397 |
| 587 | 3300035112 | Ga0373932_0000003 | Ga0373932_0000003_94565_95767 | 397 |
| 588 | 3300035116 | Ga0373945_0044889 | Ga0373945_0044889_387_1589 | 397 |
| 589 | 3300035242 | Ga0373962_0000106 | Ga0373962_0000106_12843_14045 | 397 |
| 590 | 3300035691 | Ga0373931_0000017 | Ga0373931_0000017_94423_95625 | 397 |
| 591 | 3300035725 | Ga0373947_0023833 | Ga0373947_0023833_1167_2369 | 397 |
| 592 | 3300037068 | Ga0373925_0001370 | Ga0373925_0001370_11118_12320 | 397 |
| 593 | 3300037068 | Ga0373925_0009024 | Ga0373925_0009024_4530_5732 | 397 |
| 594 | 3300047444 | Ga0495675_0132473 | Ga0495675_0132473_211_1407 | 397 |
| 595 | 3300049569 | Ga0501032_0020292 | Ga0501032_0020292_3111_4313 | 397 |
| 596 | 3300049822 | Ga0501035_0069282 | Ga0501035_0069282_1640_2842 | 397 |
| 597 | 3300049823 | Ga0501044_0040160 | Ga0501044_0040160_2262_3464 | 397 |
| 598 | 3300009093 | Ga0105240_10246365 | Ga0105240_102463652 | 398 |
| 599 | 3300049568 | Ga0501031_0000012 | Ga0501031_0000012_18536_19741 | 398 |
| 600 | 3300049569 | Ga0501032_0007666 | Ga0501032_0007666_1199_2404 | 398 |
| 601 | 3300049570 | Ga0501033_0001607 | Ga0501033_0001607_3442_4647 | 398 |
| 602 | 3300049822 | Ga0501035_0003711 | Ga0501035_0003711_10274_11479 | 398 |
| 603 | 3300049823 | Ga0501044_0000024 | Ga0501044_0000024_15397_16602 | 398 |
| 604 | 3300003320 | rootH2_10054090 | rootH2_100540907 | 401 |
| 605 | 3300029957 | Ga0265324_10013737 | Ga0265324_100137372 | 401 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2eyu-assembly2.cif.gz_B | the crystal structure of the c-terminal domain of aquifex aeolicus pilt | 0.9276 | 115 | 361 |
| 2eyu-assembly2.cif.gz_B | the crystal structure of the c-terminal domain of aquifex aeolicus pilt | 0.9205 | 115 | 361 |
| 3jvv-assembly1.cif.gz_A-2 | crystal structure of p. aeruginosa pilt with bound amp-pcp | 0.9151 | 7 | 340 |
| 3jvu-assembly1.cif.gz_A-2 | crystal structure of unliganded p. aeruginosa pilt | 0.9106 | 1 | 354 |
| 2ewv-assembly1.cif.gz_A | crystal structure of the pilus retraction motor pilt and bound adp | 0.9058 | 6 | 359 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3jvvC02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9659 | 113 | 354 | 3.40.50.300 |
| 3jvvC02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9539 | 113 | 354 | 3.40.50.300 |
| 5fl3A01 | Alpha Beta;2-Layer Sandwich;Beta-Lactamase; | 0.9122 | 5 | 111 | 3.30.450.90 |
| 3jvvA01 | Alpha Beta;2-Layer Sandwich;Beta-Lactamase; | 0.8988 | 7 | 111 | 3.30.450.90 |
| 5fl3A01 | Alpha Beta;2-Layer Sandwich;Beta-Lactamase; | 0.8953 | 5 | 111 | 3.30.450.90 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V5W608-F1-model_v4 | Twitching motility protein | 0.9993 | 128 | 225 |
GO:0016887
|
| AF-A0A6I1IXX6-F1-model_v4 | deleted | 0.9868 | 108 | 255 |
|
| AF-A0A3C0R2S6-F1-model_v4 | Type IV pili twitching motility protein PilT | 0.9849 | 122 | 247 |
GO:0016887
|
| AF-K8BJ71-F1-model_v4 | deleted | 0.9832 | 132 | 241 |
|
| AF-X1KSN6-F1-model_v4 | Bacterial type II secretion system protein E domain-containing protein | 0.9805 | 71 | 295 |
GO:0005524
GO:0016887 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar