F468485

General Info

Members Datasets Scaffolds Average Seq Length
605 284 605 390

Family's Representative Sequence

Representative Sequence 3300026116|Ga0207674_10180666|Ga0207674_101806662
Length 443
Sequence MPYFDLDPLLETMLDYSPGISDLNLSVGRPPQVELDGQLRPVAYAGIERLLPYQTELIAMRLLAGKRDLADKLVRTGSVDLSYSLAKRTRFRVNVFAQRGSYSVVLRVIPNKIPTVEELGIPPQLNEIGNERNGIVLVTGPTGSGKSTTLAAIINKINQDKAIHIITIEDPIEYLHPHVKSTINQREVGADTQTFALALRAALRQAPKVILVGEMRDVETISIALEASETGHLVLSTLHTIDASKTIDRIVGVFPKNEERQVRTRFSQAFKWVVSQRLVPKQGGGRQAICEILRSTSRTKEYVQEGEREGKSLIDAMADGQLEGMQTFDGELEKLINAGLIDKETGLSYATNRTNLQLVLETGGNNMTDEPQFTRFEAEFIAGYVYGRCLPDDQVIRKTDYVKLYQYIDEALILIGRTTTFERQAMKEIEDLLGGKDVQEESG

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
60 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
61 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
62 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
63 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
64 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
65 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
96 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
97 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
98 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
142 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
143 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
144 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
145 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
146 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
147 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
148 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
149 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
150 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
151 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
152 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
153 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
154 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
155 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
156 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
157 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
158 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
159 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
160 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
161 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
162 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
163 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
164 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
167 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
168 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
169 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
170 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
171 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
172 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
173 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
174 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
175 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
176 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
177 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
178 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
179 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
180 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
181 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
182 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
183 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
184 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
185 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
186 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
187 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
188 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
189 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
190 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
191 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
192 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
193 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
194 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
195 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
196 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
197 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
198 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
199 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
200 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
201 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
202 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
203 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
204 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
205 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
206 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
207 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
208 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
209 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
210 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
211 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
212 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
213 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
214 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
215 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
216 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
217 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
218 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
219 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
220 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
221 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
222 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
223 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
224 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
225 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
226 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
227 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
228 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
229 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
230 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
231 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
232 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
233 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
234 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
235 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
236 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
237 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
238 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
239 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
240 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
241 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
242 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
243 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
254 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
255 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
256 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
257 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
258 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
259 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
260 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
261 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
262 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
263 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
264 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
265 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
266 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
268 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
269 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
270 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
271 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
272 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
273 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
274 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
275 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
276 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
277 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
278 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
279 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
280 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
281 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
282 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
283 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
284 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.34
Metatranscriptomes 0.66
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.14
Nodule 0
Rhizoplane 0.5
Rhizosphere 92.4
Stem 0
Stem Tuber 0
Unclassified 3.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10054090 3300003320 Bacteria 5928
2 Ga0065715_10103480 3300005293 Unclassified 3019
3 Ga0070658_10056106 3300005327 Bacteria 3201
4 Ga0070658_10074775 3300005327 Bacteria 2778
5 Ga0070683_100006797 3300005329 Bacteria 9614
6 Ga0070683_100030105 3300005329 Bacteria 4922
7 Ga0070683_100202931 3300005329 Bacteria 1883
8 Ga0070690_100007018 3300005330 Bacteria 6422
9 Ga0070690_100021471 3300005330 Bacteria 3943
10 Ga0070690_100129028 3300005330 Bacteria 1705
11 Ga0070690_100150748 3300005330 Bacteria 1586
12 Ga0070670_100002462 3300005331 Bacteria 15271
13 Ga0068869_100002310 3300005334 Bacteria 11473
14 Ga0068869_100011381 3300005334 Bacteria 5833
15 Ga0068869_100014927 3300005334 Bacteria 5193
16 Ga0070666_10028244 3300005335 Bacteria 3680
17 Ga0070666_10031519 3300005335 Bacteria 3499
18 Ga0068868_100082652 3300005338 Bacteria 2576
19 Ga0070660_100002320 3300005339 Bacteria 13081
20 Ga0070660_100005436 3300005339 Bacteria 8824
21 Ga0070660_100108286 3300005339 Bacteria 2208
22 Ga0070689_100052289 3300005340 Bacteria 3159
23 Ga0070691_10024267 3300005341 Bacteria 2818
24 Ga0070661_100042426 3300005344 Bacteria 3320
25 Ga0070661_100152321 3300005344 Bacteria 1748
26 Ga0070668_100122503 3300005347 Bacteria 2080
27 Ga0070668_100127101 3300005347 Bacteria 2042
28 Ga0070669_100129148 3300005353 Bacteria 1936
29 Ga0070675_100010502 3300005354 Bacteria 7233
30 Ga0070671_100118589 3300005355 Bacteria 2226
31 Ga0070674_100021050 3300005356 Bacteria 4180
32 Ga0070673_100152841 3300005364 Bacteria 1956
33 Ga0070673_100183679 3300005364 Bacteria 1791
34 Ga0070688_100059959 3300005365 Bacteria 2402
35 Ga0070688_100098166 3300005365 Bacteria 1926
36 Ga0070688_100202389 3300005365 Bacteria 1390
37 Ga0070659_100163212 3300005366 Bacteria 1822
38 Ga0070667_100002607 3300005367 Bacteria 15648
39 Ga0070714_100015285 3300005435 Bacteria 6175
40 Ga0070713_100081604 3300005436 Bacteria 2759
41 Ga0070701_10006287 3300005438 Bacteria 4986
42 Ga0070711_100006453 3300005439 Bacteria 7072
43 Ga0070700_100016277 3300005441 Bacteria 4235
44 Ga0070694_100027022 3300005444 Bacteria 3724
45 Ga0070694_100206913 3300005444 Bacteria 1465
46 Ga0070708_100011673 3300005445 Bacteria 7149
47 Ga0070708_100046444 3300005445 Bacteria 3832
48 Ga0070678_100104839 3300005456 Bacteria 2200
49 Ga0070681_10030459 3300005458 Bacteria 5413
50 Ga0070681_10054309 3300005458 Bacteria 3992
51 Ga0070681_10074824 3300005458 Bacteria 3347
52 Ga0068867_100033566 3300005459 Bacteria 3717
53 Ga0068867_100236012 3300005459 Bacteria 1481
54 Ga0070685_10023854 3300005466 Bacteria 3353
55 Ga0070706_100002661 3300005467 Bacteria 17903
56 Ga0070706_100036392 3300005467 Bacteria 4546
57 Ga0070706_100203695 3300005467 Bacteria 1848
58 Ga0070707_100099636 3300005468 Bacteria 2815
59 Ga0070698_100004488 3300005471 Bacteria 15349
60 Ga0070698_100008136 3300005471 Bacteria 11336
61 Ga0070698_100012216 3300005471 Bacteria 9099
62 Ga0070698_100022136 3300005471 Bacteria 6653
63 Ga0070698_100036805 3300005471 Bacteria 5051
64 Ga0070699_100024049 3300005518 Bacteria 5250
65 Ga0070699_100167319 3300005518 Bacteria 1947
66 Ga0070679_100068279 3300005530 Bacteria 3546
67 Ga0070679_100132479 3300005530 Bacteria 2474
68 Ga0070684_100005906 3300005535 Bacteria 9427
69 Ga0070697_100004973 3300005536 Bacteria 10206
70 Ga0070697_100062942 3300005536 Bacteria 3029
71 Ga0070697_100088508 3300005536 Bacteria 2557
72 Ga0068853_100236443 3300005539 Bacteria 1673
73 Ga0070672_100032584 3300005543 Bacteria 3935
74 Ga0070695_100000332 3300005545 Bacteria 24281
75 Ga0070695_100056111 3300005545 Bacteria 2541
76 Ga0070696_100216558 3300005546 Bacteria 1435
77 Ga0070665_100078493 3300005548 Bacteria 3308
78 Ga0070665_100108904 3300005548 Bacteria 2773
79 Ga0070704_100038753 3300005549 Bacteria 3267
80 Ga0070704_100127547 3300005549 Bacteria 1966
81 Ga0070704_100220523 3300005549 Bacteria 1542
82 Ga0068855_100039565 3300005563 Bacteria 5598
83 Ga0068855_100045953 3300005563 Bacteria 5162
84 Ga0068855_100125625 3300005563 Bacteria 2933
85 Ga0068855_100133062 3300005563 Bacteria 2839
86 Ga0068855_100330392 3300005563 Bacteria 1683
87 Ga0068857_100005362 3300005577 Bacteria 10933
88 Ga0068856_100001681 3300005614 Bacteria 23153
89 Ga0068856_100029138 3300005614 Bacteria 5392
90 Ga0068856_100041360 3300005614 Bacteria 4529
91 Ga0070702_100127938 3300005615 Bacteria 1600
92 Ga0070702_100149438 3300005615 Bacteria 1498
93 Ga0068852_100395111 3300005616 Bacteria 1359
94 Ga0068859_100023044 3300005617 Bacteria 6243
95 Ga0068859_100108923 3300005617 Bacteria 2831
96 Ga0068859_100154498 3300005617 Bacteria 2371
97 Ga0068859_100302369 3300005617 Unclassified 1693
98 Ga0068864_100029683 3300005618 Bacteria 4634
99 Ga0068864_100354739 3300005618 Bacteria 1385
100 Ga0068864_100375158 3300005618 Bacteria 1347
101 Ga0068861_100196693 3300005719 Bacteria 1689
102 Ga0068863_100045249 3300005841 Bacteria 4177
103 Ga0068863_100058335 3300005841 Bacteria 3653
104 Ga0068863_100216170 3300005841 Bacteria 1846
105 Ga0068858_100009346 3300005842 Bacteria 9360
106 Ga0068858_100013534 3300005842 Bacteria 7698
107 Ga0068862_100042914 3300005844 Bacteria 3854
108 Ga0068862_100059002 3300005844 Bacteria 3293
109 Ga0070717_10002462 3300006028 Bacteria 13073
110 Ga0075365_10009882 3300006038 Bacteria 5522
111 Ga0075364_10041319 3300006051 Bacteria 2994
112 Ga0075364_10065154 3300006051 Bacteria 2391
113 Ga0075362_10005868 3300006177 Bacteria 4530
114 Ga0075367_10003400 3300006178 Bacteria 7583
115 Ga0075367_10022928 3300006178 Bacteria 3508
116 Ga0075369_10015744 3300006186 Bacteria 3040
117 Ga0075366_10000451 3300006195 Bacteria 19121
118 Ga0075366_10047113 3300006195 Bacteria 2555
119 Ga0075370_10017369 3300006353 Bacteria 3886
120 Ga0068871_100014149 3300006358 Bacteria 5937
121 Ga0075428_100006228 3300006844 Bacteria 13272
122 Ga0075428_100057093 3300006844 Bacteria 4274
123 Ga0075431_100037924 3300006847 Bacteria 4962
124 Ga0075431_100078369 3300006847 Bacteria 3410
125 Ga0075431_100243744 3300006847 Bacteria 1827
126 Ga0075431_100363379 3300006847 Bacteria 1453
127 Ga0075433_10073451 3300006852 Bacteria 3008
128 Ga0075434_100077099 3300006871 Bacteria 3328
129 Ga0075434_100250915 3300006871 Bacteria 1789
130 Ga0075434_100264670 3300006871 Bacteria 1739
131 Ga0075429_100000847 3300006880 Bacteria 24024
132 Ga0075429_100027456 3300006880 Bacteria 4941
133 Ga0075429_100036051 3300006880 Bacteria 4302
134 Ga0075429_100046673 3300006880 Bacteria 3769
135 Ga0075429_100115633 3300006880 Bacteria 2345
136 Ga0068865_100011862 3300006881 Bacteria 5467
137 Ga0068865_100035764 3300006881 Bacteria 3344
138 Ga0068865_100115160 3300006881 Bacteria 1989
139 Ga0097620_100023044 3300006931 Bacteria 6243
140 Ga0097620_100108925 3300006931 Bacteria 2831
141 Ga0097620_100154495 3300006931 Bacteria 2371
142 Ga0097620_100302413 3300006931 Unclassified 1693
143 Ga0097620_100321597 3300006931 Bacteria 1641
144 Ga0075435_100091424 3300007076 Bacteria 2511
145 Ga0075435_100129022 3300007076 Bacteria 2115
146 Ga0075435_100170144 3300007076 Bacteria 1838
147 Ga0105240_10032877 3300009093 Bacteria 6708
148 Ga0105240_10076034 3300009093 Bacteria 4141
149 Ga0105240_10216818 3300009093 Bacteria 2232
150 Ga0105240_10246365 3300009093 Bacteria 2069
151 Ga0111539_10000113 3300009094 Bacteria 89042
152 Ga0111539_10005541 3300009094 Bacteria 16324
153 Ga0111539_10198647 3300009094 Bacteria 2339
154 Ga0114129_10000576 3300009147 Bacteria 45211
155 Ga0114129_10001509 3300009147 Bacteria 31480
156 Ga0114129_10006424 3300009147 Bacteria 16668
157 Ga0114129_10040693 3300009147 Bacteria 6551
158 Ga0114129_10042343 3300009147 Bacteria 6413
159 Ga0105243_10019388 3300009148 Bacteria 5158
160 Ga0105241_10227820 3300009174 Bacteria 1570
161 Ga0105248_10020953 3300009177 Bacteria 7246
162 Ga0105248_10052164 3300009177 Bacteria 4590
163 Ga0105248_10209096 3300009177 Bacteria 2198
164 Ga0105248_10296378 3300009177 Bacteria 1821
165 Ga0105237_10268904 3300009545 Bacteria 1708
166 Ga0105238_10002928 3300009551 Bacteria 17040
167 Ga0105239_10017617 3300010375 Bacteria 7901
168 Ga0105246_10047378 3300011119 Bacteria 2935
169 Ga0157370_10087563 3300013104 Bacteria 2925
170 Ga0157370_10146551 3300013104 Unclassified 2198
171 Ga0157369_10191034 3300013105 Bacteria 2152
172 Ga0157374_10013937 3300013296 Bacteria 7026
173 Ga0163162_10013066 3300013306 Bacteria 8104
174 Ga0157372_10169948 3300013307 Bacteria 2522
175 Ga0157372_10257909 3300013307 Bacteria 2024
176 Ga0157375_10000006 3300013308 Bacteria 384086
177 Ga0157375_10010268 3300013308 Bacteria 8240
178 Ga0157375_10402228 3300013308 Bacteria 1536
179 Ga0163163_10368666 3300014325 Bacteria 1493
180 Ga0182008_10009538 3300014497 Bacteria 5232
181 Ga0182008_10071496 3300014497 Bacteria 1707
182 Ga0157379_10069084 3300014968 Bacteria 3159
183 Ga0157379_10325323 3300014968 Bacteria 1404
184 Ga0206356_10199250 3300020070 Bacteria 1501
185 Ga0213872_10087362 3300021361 Bacteria 1397
186 Ga0213876_10000099 3300021384 Bacteria 97202
187 Ga0213876_10000499 3300021384 Bacteria 30548
188 Ga0213876_10063781 3300021384 Bacteria 1945
189 Ga0224572_1014186 3300024225 Bacteria 1522
190 Ga0207653_10030449 3300025885 Bacteria 1741
191 Ga0207642_10010166 3300025899 Bacteria 3303
192 Ga0207647_10006481 3300025904 Bacteria 8505
193 Ga0207645_10018651 3300025907 Bacteria 4558
194 Ga0207643_10049752 3300025908 Bacteria 2375
195 Ga0207705_10007416 3300025909 Bacteria 8066
196 Ga0207684_10042749 3300025910 Bacteria 3842
197 Ga0207707_10020321 3300025912 Bacteria 5799
198 Ga0207707_10053250 3300025912 Bacteria 3523
199 Ga0207707_10089694 3300025912 Bacteria 2687
200 Ga0207695_10040587 3300025913 Bacteria 4987
201 Ga0207695_10049797 3300025913 Bacteria 4412
202 Ga0207695_10100345 3300025913 Bacteria 2891
203 Ga0207693_10183250 3300025915 Bacteria 1648
204 Ga0207663_10006313 3300025916 Bacteria 6052
205 Ga0207660_10036316 3300025917 Bacteria 3425
206 Ga0207657_10002101 3300025919 Bacteria 21549
207 Ga0207657_10032292 3300025919 Bacteria 4732
208 Ga0207652_10024327 3300025921 Bacteria 5024
209 Ga0207652_10027406 3300025921 Bacteria 4748
210 Ga0207652_10084782 3300025921 Bacteria 2776
211 Ga0207652_10162013 3300025921 Bacteria 2005
212 Ga0207646_10001967 3300025922 Bacteria 24656
213 Ga0207646_10011019 3300025922 Bacteria 8780
214 Ga0207681_10112143 3300025923 Bacteria 1985
215 Ga0207659_10015782 3300025926 Bacteria 4904
216 Ga0207664_10024852 3300025929 Bacteria 4504
217 Ga0207664_10040347 3300025929 Bacteria 3629
218 Ga0207644_10145282 3300025931 Bacteria 1831
219 Ga0207690_10030148 3300025932 Bacteria 3457
220 Ga0207690_10185670 3300025932 Bacteria 1569
221 Ga0207709_10044125 3300025935 Bacteria 2692
222 Ga0207670_10028908 3300025936 Bacteria 3525
223 Ga0207704_10009641 3300025938 Bacteria 4669
224 Ga0207704_10040395 3300025938 Bacteria 2726
225 Ga0207704_10135741 3300025938 Bacteria 1712
226 Ga0207691_10001566 3300025940 Bacteria 22711
227 Ga0207691_10027345 3300025940 Bacteria 5347
228 Ga0207711_10111400 3300025941 Bacteria 2434
229 Ga0207689_10000068 3300025942 Bacteria 83861
230 Ga0207689_10047058 3300025942 Bacteria 3563
231 Ga0207661_10005618 3300025944 Bacteria 8841
232 Ga0207661_10177240 3300025944 Bacteria 1859
233 Ga0207667_10098053 3300025949 Bacteria 3024
234 Ga0207667_10154276 3300025949 Bacteria 2363
235 Ga0207667_10256321 3300025949 Bacteria 1789
236 Ga0207667_10304926 3300025949 Bacteria 1627
237 Ga0207651_10046661 3300025960 Bacteria 2915
238 Ga0207651_10149597 3300025960 Bacteria 1815
239 Ga0207658_10104759 3300025986 Bacteria 2223
240 Ga0207677_10020219 3300026023 Bacteria 4038
241 Ga0207703_10004361 3300026035 Bacteria 11626
242 Ga0207703_10021316 3300026035 Bacteria 5074
243 Ga0207708_10018651 3300026075 Bacteria 5226
244 Ga0207708_10022921 3300026075 Bacteria 4716
245 Ga0207702_10000808 3300026078 Bacteria 33196
246 Ga0207702_10020867 3300026078 Bacteria 5420
247 Ga0207702_10192745 3300026078 Bacteria 1884
248 Ga0207641_10019532 3300026088 Bacteria 5562
249 Ga0207641_10049937 3300026088 Bacteria 3537
250 Ga0207648_10013312 3300026089 Bacteria 7660
251 Ga0207648_10024974 3300026089 Bacteria 5327
252 Ga0207674_10003025 3300026116 Bacteria 20840
253 Ga0207674_10096275 3300026116 Bacteria 2945
254 Ga0207674_10131333 3300026116 Bacteria 2467
255 Ga0207674_10180666 3300026116 Bacteria 2061
256 Ga0207675_100037088 3300026118 Bacteria 4547
257 Ga0207683_10082157 3300026121 Bacteria 2862
258 Ga0207428_10000197 3300027907 Bacteria 84315
259 Ga0207428_10129029 3300027907 Bacteria 1935
260 Ga0207428_10182139 3300027907 Bacteria 1587
261 Ga0268266_10050430 3300028379 Bacteria 3571
262 Ga0268265_10021110 3300028380 Bacteria 4555
263 Ga0268265_10024420 3300028380 Bacteria 4276
264 Ga0268264_10034012 3300028381 Bacteria 4191
265 Ga0265337_1000420 3300028556 Bacteria 22614
266 Ga0265337_1009313 3300028556 Bacteria 3511
267 Ga0265319_1010521 3300028563 Bacteria 3852
268 Ga0265319_1011301 3300028563 Bacteria 3661
269 Ga0265323_10000808 3300028653 Bacteria 16811
270 Ga0265323_10009676 3300028653 Bacteria 3927
271 Ga0265338_10000032 3300028800 Bacteria 257580
272 Ga0265338_10000487 3300028800 Bacteria 70806
273 Ga0265338_10000605 3300028800 Bacteria 62898
274 Ga0265338_10000808 3300028800 Bacteria 52850
275 Ga0265338_10003037 3300028800 Bacteria 24157
276 Ga0265338_10004439 3300028800 Bacteria 18945
277 Ga0265338_10006433 3300028800 Bacteria 14972
278 Ga0265338_10006466 3300028800 Bacteria 14930
279 Ga0265338_10009600 3300028800 Bacteria 11496
280 Ga0265338_10012683 3300028800 Bacteria 9591
281 Ga0265338_10013371 3300028800 Bacteria 9272
282 Ga0265338_10015698 3300028800 Bacteria 8300
283 Ga0265338_10016304 3300028800 Bacteria 8094
284 Ga0265338_10017598 3300028800 Bacteria 7694
285 Ga0265338_10021100 3300028800 Bacteria 6809
286 Ga0265338_10032281 3300028800 Bacteria 5112
287 Ga0265338_10036354 3300028800 Bacteria 4715
288 Ga0265338_10052764 3300028800 Bacteria 3644
289 Ga0265338_10065919 3300028800 Bacteria 3137
290 Ga0265338_10107801 3300028800 Bacteria 2252
291 Ga0265338_10145659 3300028800 Bacteria 1848
292 Ga0265324_10000275 3300029957 Bacteria 38013
293 Ga0265324_10000434 3300029957 Bacteria 29709
294 Ga0265324_10008137 3300029957 Bacteria 4193
295 Ga0265324_10013737 3300029957 Bacteria 3013
296 Ga0265324_10016597 3300029957 Bacteria 2685
297 Ga0265324_10027158 3300029957 Bacteria 2022
298 Ga0265760_10001214 3300031090 Bacteria 7544
299 Ga0265330_10065362 3300031235 Bacteria 1579
300 Ga0265320_10015186 3300031240 Bacteria 4359
301 Ga0265325_10012954 3300031241 Bacteria 4757
302 Ga0265325_10027993 3300031241 Bacteria 3042
303 Ga0265325_10073717 3300031241 Bacteria 1708
304 Ga0265340_10000208 3300031247 Bacteria 29683
305 Ga0265340_10002875 3300031247 Bacteria 9799
306 Ga0265339_10003685 3300031249 Bacteria 10688
307 Ga0265339_10013432 3300031249 Bacteria 4961
308 Ga0265339_10043425 3300031249 Bacteria 2486
309 Ga0265327_10001424 3300031251 Bacteria 30421
310 Ga0265327_10016400 3300031251 Bacteria 4706
311 Ga0265316_10001616 3300031344 Bacteria 24035
312 Ga0265316_10007894 3300031344 Bacteria 9959
313 Ga0265316_10054548 3300031344 Bacteria 3129
314 Ga0265316_10066286 3300031344 Bacteria 2795
315 Ga0265316_10162262 3300031344 Bacteria 1670
316 Ga0265313_10026169 3300031595 Bacteria 3078
317 Ga0265313_10026209 3300031595 Bacteria 3075
318 Ga0316575_10000137 3300031665 Bacteria 18328
319 Ga0316575_10003349 3300031665 Bacteria 5521
320 Ga0316575_10013470 3300031665 Bacteria 3054
321 Ga0316579_10010485 3300031691 Bacteria 3919
322 Ga0316579_10011595 3300031691 Bacteria 3748
323 Ga0316579_10017849 3300031691 Bacteria 3117
324 Ga0316579_10036678 3300031691 Bacteria 2262
325 Ga0316579_10046136 3300031691 Bacteria 2032
326 Ga0265314_10011022 3300031711 Bacteria 7496
327 Ga0265314_10029742 3300031711 Bacteria 4056
328 Ga0265314_10033302 3300031711 Bacteria 3781
329 Ga0265314_10064052 3300031711 Bacteria 2491
330 Ga0265314_10116439 3300031711 Bacteria 1689
331 Ga0316576_10006734 3300031727 Bacteria 7181
332 Ga0316576_10007773 3300031727 Bacteria 6774
333 Ga0316576_10011164 3300031727 Bacteria 5870
334 Ga0316576_10023339 3300031727 Bacteria 4307
335 Ga0316576_10024125 3300031727 Bacteria 4245
336 Ga0316576_10047770 3300031727 Bacteria 3103
337 Ga0316576_10049913 3300031727 Bacteria 3040
338 Ga0316576_10067626 3300031727 Bacteria 2630
339 Ga0316576_10076170 3300031727 Bacteria 2482
340 Ga0316578_10002110 3300031728 Bacteria 8525
341 Ga0316578_10003250 3300031728 Bacteria 7380
342 Ga0316578_10004444 3300031728 Bacteria 6623
343 Ga0316578_10026658 3300031728 Bacteria 3261
344 Ga0316578_10028855 3300031728 Bacteria 3145
345 Ga0316578_10136752 3300031728 Bacteria 1475
346 Ga0316577_10003305 3300031733 Bacteria 8124
347 Ga0316577_10011104 3300031733 Bacteria 4873
348 Ga0316577_10021614 3300031733 Bacteria 3570
349 Ga0316577_10023621 3300031733 Bacteria 3413
350 Ga0316577_10042046 3300031733 Bacteria 2557
351 Ga0316577_10043114 3300031733 Bacteria 2524
352 Ga0316583_10001633 3300032133 Bacteria 7585
353 Ga0316583_10008407 3300032133 Bacteria 3724
354 Ga0316583_10010921 3300032133 Bacteria 3270
355 Ga0316583_10017925 3300032133 Unclassified 2543
356 Ga0316583_10027753 3300032133 Bacteria 2021
357 Ga0316585_10002173 3300032137 Bacteria 5268
358 Ga0316585_10021964 3300032137 Bacteria 1961
359 Ga0316585_10023486 3300032137 Bacteria 1902
360 Ga0316585_10041778 3300032137 Bacteria 1461
361 Ga0316580_10006464 3300032139 Bacteria 3462
362 Ga0316593_10006804 3300032168 Bacteria 3108
363 Ga0316592_1016432 3300033524 Bacteria 1546
364 Ga0373930_0001976 3300034816 Bacteria 3139
365 Ga0373926_0001985 3300035083 Bacteria 6413
366 Ga0373929_0004550 3300035085 Bacteria 2482
367 Ga0373944_0002365 3300035089 Bacteria 4803
368 Ga0373949_0001197 3300035090 Bacteria 7696
369 Ga0373951_0002160 3300035091 Bacteria 5014
370 Ga0373932_0000003 3300035112 Bacteria 459351
371 Ga0373945_0044889 3300035116 Bacteria 1608
372 Ga0373954_0019754 3300035118 Bacteria 3041
373 Ga0373956_0071153 3300035119 Bacteria 1587
374 Ga0373946_0002216 3300035171 Bacteria 6850
375 Ga0373962_0000106 3300035242 Bacteria 18384
376 Ga0316574_0002636 3300035398 Bacteria 9050
377 Ga0316574_0013133 3300035398 Bacteria 4755
378 Ga0316574_0090720 3300035398 Bacteria 1948
379 Ga0316574_0101247 3300035398 Bacteria 1844
380 Ga0316574_0121083 3300035398 Bacteria 1680
381 Ga0373931_0000017 3300035691 Bacteria 207733
382 Ga0373935_0018453 3300035692 Bacteria 4243
383 Ga0373935_0127303 3300035692 Bacteria 1708
384 Ga0373927_0000442 3300035695 Bacteria 31705
385 Ga0373927_0156714 3300035695 Bacteria 1491
386 Ga0373947_0018292 3300035725 Bacteria 4033
387 Ga0373947_0023833 3300035725 Bacteria 3563
388 Ga0373947_0058315 3300035725 Bacteria 2339
389 Ga0373937_0006833 3300036401 Bacteria 9846
390 Ga0373937_0047621 3300036401 Bacteria 3923
391 Ga0373937_0058419 3300036401 Bacteria 3544
392 Ga0316582_0000276 3300036647 Bacteria 17513
393 Ga0316582_0000544 3300036647 Bacteria 14391
394 Ga0316582_0000865 3300036647 Bacteria 12348
395 Ga0316582_0007404 3300036647 Bacteria 5839
396 Ga0316582_0018348 3300036647 Bacteria 4070
397 Ga0316582_0121905 3300036647 Bacteria 1745
398 Ga0316584_0001417 3300036712 Bacteria 14335
399 Ga0316584_0005032 3300036712 Bacteria 8810
400 Ga0316584_0013494 3300036712 Bacteria 5785
401 Ga0316584_0017467 3300036712 Bacteria 5158
402 Ga0316584_0024858 3300036712 Bacteria 4388
403 Ga0316584_0038300 3300036712 Bacteria 3566
404 Ga0316584_0083163 3300036712 Bacteria 2397
405 Ga0316584_0087525 3300036712 Unclassified 2332
406 Ga0316584_0128813 3300036712 Bacteria 1890
407 Ga0316584_0145687 3300036712 Bacteria 1764
408 Ga0316584_0156528 3300036712 Bacteria 1694
409 Ga0316584_0264232 3300036712 Bacteria 1254
410 Ga0316584_0306392 3300036712 Bacteria 1149
411 Ga0373925_0001370 3300037068 Bacteria 21253
412 Ga0373925_0002451 3300037068 Bacteria 14856
413 Ga0373925_0009024 3300037068 Bacteria 7262
414 Ga0395899_0081153 3300037312 Bacteria 2360
415 Ga0395900_0009629 3300037418 Bacteria 9909
416 Ga0395900_0031075 3300037418 Bacteria 5486
417 Ga0395900_0062833 3300037418 Bacteria 3817
418 Ga0395900_0286839 3300037418 Bacteria 1636
419 Ga0395898_0008286 3300037466 Bacteria 10990
420 Ga0395898_0039951 3300037466 Bacteria 4642
421 Ga0395905_0007990 3300037471 Bacteria 10454
422 Ga0395905_0376655 3300037471 Bacteria 1313
423 Ga0316581_0005654 3300037588 Bacteria 3273
424 Ga0436364_1048088 3300037853 Bacteria 1680
425 Ga0395901_0074377 3300038443 Bacteria 3544
426 Ga0395901_0132487 3300038443 Bacteria 2619
427 Ga0395901_0194192 3300038443 Bacteria 2129
428 Ga0400490_08090 3300038726 Bacteria 2454
429 Ga0400490_08299 3300038726 Unclassified 2019
430 Ga0400490_16839 3300038726 Bacteria 36448
431 Ga0400491_08615 3300038727 Bacteria 3746
432 Ga0400491_24515 3300038727 Bacteria 2984
433 Ga0400485_00122 3300038735 Bacteria 16318
434 Ga0400485_17873 3300038735 Bacteria 24379
435 Ga0400486_21674 3300038742 Bacteria 15135
436 Ga0400486_23273 3300038742 Bacteria 28833
437 Ga0400483_129331 3300039062 Bacteria 4069
438 Ga0400483_204894 3300039062 Bacteria 1685
439 Ga0400489_04024 3300039093 Bacteria 18064
440 Ga0400489_24971 3300039093 Bacteria 18183
441 Ga0400489_26114 3300039093 Bacteria 44665
442 Ga0400489_29570 3300039093 Bacteria 28517
443 Ga0400487_63934 3300039110 Bacteria 30817
444 Ga0436365_0178835 3300039437 Bacteria 16798
445 Ga0436365_0243335 3300039437 Bacteria 111830
446 Ga0436365_0529836 3300039437 Bacteria 1360
447 Ga0436361_0449901 3300039447 Bacteria 2032
448 Ga0439446_0022219 3300042156 Bacteria 1798
449 Ga0451577_0003436 3300042876 Bacteria 17641
450 Ga0451577_0015600 3300042876 Bacteria 7060
451 Ga0451577_0237047 3300042876 Bacteria 1650
452 Ga0466972_0003402 3300044658 Bacteria 7889
453 Ga0466965_0053540 3300044683 Bacteria 2006
454 Ga0466966_0003064 3300044684 Bacteria 11019
455 Ga0466961_0006703 3300044693 Bacteria 7328
456 Ga0466961_0022687 3300044693 Bacteria 4037
457 Ga0466961_0051602 3300044693 Bacteria 2626
458 Ga0466963_0002833 3300044694 Bacteria 9777
459 Ga0466963_0028739 3300044694 Bacteria 3573
460 Ga0466963_0070351 3300044694 Bacteria 2353
461 Ga0466963_0074221 3300044694 Bacteria 2293
462 Ga0466963_0081390 3300044694 Bacteria 2193
463 Ga0466963_0192911 3300044694 Bacteria 1423
464 Ga0466964_0006640 3300044706 Bacteria 4312
465 Ga0453684_0000137 3300044712 Bacteria 323390
466 Ga0453684_0004628 3300044712 Bacteria 28595
467 Ga0453684_0194504 3300044712 Bacteria 2370
468 Ga0466971_0001127 3300044719 Bacteria 11112
469 Ga0466971_0024358 3300044719 Bacteria 2700
470 Ga0466968_0021140 3300044735 Bacteria 2633
471 Ga0466957_0014120 3300044842 Bacteria 4646
472 Ga0466957_0034198 3300044842 Bacteria 3049
473 Ga0466959_0018530 3300045049 Bacteria 5113
474 Ga0466959_0022745 3300045049 Bacteria 4634
475 Ga0466959_0081904 3300045049 Bacteria 2325
476 Ga0466959_0165675 3300045049 Bacteria 1552
477 Ga0451576_0028983 3300045051 Bacteria 5928
478 Ga0451576_0070874 3300045051 Bacteria 3628
479 Ga0451576_0101374 3300045051 Bacteria 2994
480 Ga0451576_0119407 3300045051 Bacteria 2745
481 Ga0451576_0125277 3300045051 Bacteria 2677
482 Ga0466958_0006784 3300045836 Bacteria 6256
483 Ga0466958_0023765 3300045836 Bacteria 3601
484 Ga0466958_0046096 3300045836 Bacteria 2630
485 Ga0466967_0009640 3300045976 Bacteria 7179
486 Ga0466967_0021947 3300045976 Bacteria 5198
487 Ga0466967_0055088 3300045976 Bacteria 3502
488 Ga0466967_0065363 3300045976 Bacteria 3237
489 Ga0466967_0318065 3300045976 Bacteria 1500
490 Ga0495592_0008014 3300046454 Bacteria 7929
491 Ga0495592_0157188 3300046454 Bacteria 1567
492 Ga0495603_0074034 3300046455 Bacteria 2000
493 Ga0495641_0040200 3300046461 Bacteria 2176
494 Ga0495582_0008132 3300046473 Bacteria 5791
495 Ga0495664_0028784 3300046477 Bacteria 3246
496 Ga0495630_0000010 3300046517 Bacteria 265324
497 Ga0495630_0010815 3300046517 Bacteria 6589
498 Ga0495630_0015375 3300046517 Bacteria 5589
499 Ga0495630_0044356 3300046517 Bacteria 3323
500 Ga0495666_0039038 3300046526 Bacteria 2307
501 Ga0495652_0220923 3300046529 Bacteria 1424
502 Ga0495640_0112665 3300046533 Bacteria 1776
503 Ga0495586_0000048 3300046535 Bacteria 71629
504 Ga0495586_0001538 3300046535 Bacteria 12729
505 Ga0495586_0122090 3300046535 Bacteria 1456
506 Ga0495645_0061296 3300046543 Bacteria 2726
507 Ga0495645_0136467 3300046543 Bacteria 1715
508 Ga0495634_0018314 3300046642 Bacteria 4987
509 Ga0495634_0018945 3300046642 Bacteria 4894
510 Ga0495599_0022090 3300046678 Bacteria 3971
511 Ga0495599_0091371 3300046678 Bacteria 1899
512 Ga0495647_0017659 3300046681 Bacteria 2527
513 Ga0495613_0001643 3300046689 Bacteria 17024
514 Ga0495613_0046528 3300046689 Unclassified 3208
515 Ga0495624_0032378 3300046690 Bacteria 3391
516 Ga0495674_0001886 3300047319 Bacteria 20650
517 Ga0495674_0024817 3300047319 Bacteria 5504
518 Ga0495672_0000882 3300047320 Bacteria 31549
519 Ga0495672_0001766 3300047320 Bacteria 20805
520 Ga0495680_0002831 3300047322 Bacteria 17453
521 Ga0495675_0132473 3300047444 Bacteria 1549
522 Ga0495684_0069611 3300047471 Bacteria 2675
523 Ga0496102_0205408 3300048905 Bacteria 1857
524 Ga0496106_0087848 3300048909 Bacteria 2396
525 Ga0496112_0018723 3300048915 Bacteria 6526
526 Ga0501031_0000012 3300049568 Bacteria 137943
527 Ga0501031_0021793 3300049568 Bacteria 4176
528 Ga0501031_0118618 3300049568 Bacteria 1729
529 Ga0501032_0007666 3300049569 Bacteria 7870
530 Ga0501032_0020292 3300049569 Bacteria 4631
531 Ga0501033_0001607 3300049570 Bacteria 19842
532 Ga0501033_0012811 3300049570 Bacteria 6395
533 Ga0501034_0052299 3300049571 Bacteria 4115
534 Ga0501036_0054509 3300049572 Bacteria 3387
535 Ga0501038_0217698 3300049574 Bacteria 1525
536 Ga0501039_0170552 3300049575 Bacteria 1711
537 Ga0501040_0084447 3300049576 Bacteria 2203
538 Ga0501040_0105707 3300049576 Bacteria 1967
539 Ga0501041_0075180 3300049577 Bacteria 2077
540 Ga0501041_0112300 3300049577 Bacteria 1691
541 Ga0501041_0124569 3300049577 Bacteria 1603
542 Ga0501043_0113291 3300049579 Bacteria 2130
543 Ga0501067_0030844 3300049583 Bacteria 2974
544 Ga0501068_0065527 3300049584 Bacteria 2211
545 Ga0501069_0024610 3300049585 Bacteria 3284
546 Ga0501069_0057290 3300049585 Bacteria 2171
547 Ga0501069_0086145 3300049585 Bacteria 1773
548 Ga0501070_0001690 3300049586 Bacteria 19562
549 Ga0501070_0109344 3300049586 Bacteria 2284
550 Ga0501071_0129109 3300049587 Bacteria 1877
551 Ga0501072_0091059 3300049588 Bacteria 2421
552 Ga0501073_0085144 3300049589 Bacteria 2200
553 Ga0501074_0043348 3300049590 Bacteria 3256
554 Ga0501075_0010180 3300049591 Bacteria 6601
555 Ga0501076_0013731 3300049592 Bacteria 6076
556 Ga0501076_0014008 3300049592 Bacteria 6026
557 Ga0501076_0078554 3300049592 Bacteria 2648
558 Ga0501079_0020662 3300049741 Bacteria 5033
559 Ga0501079_0242910 3300049741 Bacteria 1407
560 Ga0501080_0000790 3300049742 Bacteria 25827
561 Ga0501080_0107594 3300049742 Bacteria 2584
562 Ga0501083_0001358 3300049744 Bacteria 16628
563 Ga0501035_0003711 3300049822 Bacteria 14559
564 Ga0501035_0069282 3300049822 Bacteria 3127
565 Ga0501035_0078062 3300049822 Bacteria 2926
566 Ga0501044_0000024 3300049823 Bacteria 194302
567 Ga0501044_0040160 3300049823 Bacteria 4878
568 nmdc:mga0yw44_36808_c1 3300050492 Bacteria 2886
569 nmdc:mga0k408_143766_c1 3300050493 Bacteria 1419
570 nmdc:mga0k408_50396_c1 3300050493 Bacteria 2411
571 nmdc:mga06z11_125646_c1 3300050494 Bacteria 1435
572 nmdc:mga06z11_19555_c1 3300050494 Bacteria 3116
573 nmdc:mga06z11_34409_c1 3300050494 Bacteria 2487
574 nmdc:mga06z11_3557_c1 3300050494 Bacteria 6034
575 nmdc:mga04h51_19876_c1 3300050495 Bacteria 1997
576 nmdc:mga07m45_5086_c1 3300050496 Bacteria 6509
577 nmdc:mga05p37_113161_c1 3300050507 Bacteria 3337
578 nmdc:mga05p37_131624_c1 3300050507 Bacteria 3069
579 nmdc:mga05p37_1863_c1 3300050507 Bacteria 24556
580 nmdc:mga05p37_61614_c1 3300050507 Bacteria 4618
581 nmdc:mga05p37_69916_c1 3300050507 Bacteria 2299
582 nmdc:mga05p37_98941_c1 3300050507 Bacteria 3593
583 nmdc:mga09592_19269_c1 3300050508 Bacteria 5602
584 nmdc:mga09592_205088_c1 3300050508 Bacteria 1708
585 nmdc:mga09592_217996_c1 3300050508 Bacteria 1653
586 nmdc:mga09592_2682_c1 3300050508 Bacteria 14394
587 nmdc:mga09592_31887_c1 3300050508 Bacteria 4392
588 nmdc:mga09592_54673_c1 3300050508 Bacteria 3373
589 nmdc:mga0qj67_314533_c1 3300050509 Bacteria 1268
590 nmdc:mga06r32_1717_c1 3300050510 Bacteria 19727
591 nmdc:mga06r32_180028_c1 3300050510 Bacteria 2099
592 nmdc:mga06r32_48741_c1 3300050510 Bacteria 4050
593 nmdc:mga08y16_11988_c1 3300050511 Bacteria 9102
594 nmdc:mga08y16_3313_c1 3300050511 Bacteria 16684
595 nmdc:mga0n895_166472_c1 3300050512 Bacteria 2236
596 nmdc:mga0n895_383551_c1 3300050512 Bacteria 1422
597 nmdc:mga0rr50_255926_c1 3300050513 Bacteria 1455
598 nmdc:mga0a205_23008_c1 3300050515 Bacteria 5908
599 nmdc:mga0a205_295831_c1 3300050515 Bacteria 1492
600 Ga0501084_0210827 3300054114 Bacteria 1639
601 Ga0501084_0252281 3300054114 Bacteria 1489
602 Ga0501082_0021513 3300060353 Bacteria 5563
603 Ga0501082_0066638 3300060353 Bacteria 3101
604 Ga0466962_0000874 3300061719 Bacteria 13664
605 Ga0530510_0070335 3300061734 Bacteria 2540

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046689 Ga0495613_0046528 Ga0495613_0046528_2191_3180 321
2 3300036712 Ga0316584_0306392 Ga0316584_0306392_16_1014 327
3 3300054114 Ga0501084_0252281 Ga0501084_0252281_82_1212 335
4 3300047320 Ga0495672_0001766 Ga0495672_0001766_1682_2836 337
5 3300021361 Ga0213872_10087362 Ga0213872_100873622 345
6 3300039447 Ga0436361_0449901 Ga0436361_0449901_748_1821 345
7 3300005441 Ga0070700_100016277 Ga0070700_1000162774 346
8 3300050513 nmdc:mga0rr50_255926_c1 nmdc:mga0rr50_255926_c1_138_1328 347
9 3300007076 Ga0075435_100170144 Ga0075435_1001701442 348
10 3300031691 Ga0316579_10010485 Ga0316579_100104851 349
11 3300037418 Ga0395900_0031075 Ga0395900_0031075_21_1127 350
12 3300042156 Ga0439446_0022219 Ga0439446_0022219_478_1608 350
13 3300021384 Ga0213876_10000099 Ga0213876_1000009937 352
14 3300037312 Ga0395899_0081153 Ga0395899_0081153_1253_2347 352
15 3300039437 Ga0436365_0243335 Ga0436365_0243335_52619_53836 352
16 3300009094 Ga0111539_10005541 Ga0111539_1000554114 353
17 3300027907 Ga0207428_10129029 Ga0207428_101290292 353
18 3300031241 Ga0265325_10012954 Ga0265325_100129542 353
19 3300050511 nmdc:mga08y16_11988_c1 nmdc:mga08y16_11988_c1_116_1330 353
20 3300005617 Ga0068859_100302369 Ga0068859_1003023692 354
21 3300006931 Ga0097620_100302413 Ga0097620_1003024132 354
22 3300050510 nmdc:mga06r32_48741_c1 nmdc:mga06r32_48741_c1_857_2011 354
23 3300005355 Ga0070671_100118589 Ga0070671_1001185892 355
24 3300005518 Ga0070699_100167319 Ga0070699_1001673192 356
25 3300006028 Ga0070717_10002462 Ga0070717_1000246210 356
26 3300025929 Ga0207664_10040347 Ga0207664_100403474 356
27 3300026075 Ga0207708_10022921 Ga0207708_100229212 356
28 3300044694 Ga0466963_0002833 Ga0466963_0002833_7934_9169 356
29 3300046454 Ga0495592_0008014 Ga0495592_0008014_11_1096 356
30 3300024225 Ga0224572_1014186 Ga0224572_10141862 357
31 3300031090 Ga0265760_10001214 Ga0265760_100012149 357
32 3300031241 Ga0265325_10027993 Ga0265325_100279933 357
33 3300044694 Ga0466963_0070351 Ga0466963_0070351_798_2021 357
34 3300037466 Ga0395898_0008286 Ga0395898_0008286_8841_9992 358
35 3300005329 Ga0070683_100030105 Ga0070683_1000301052 359
36 3300005436 Ga0070713_100081604 Ga0070713_1000816042 359
37 3300005841 Ga0068863_100058335 Ga0068863_1000583353 359
38 3300006881 Ga0068865_100011862 Ga0068865_1000118622 359
39 3300025944 Ga0207661_10177240 Ga0207661_101772402 359
40 3300026089 Ga0207648_10024974 Ga0207648_100249743 359
41 3300038443 Ga0395901_0194192 Ga0395901_0194192_633_1850 359
42 3300045976 Ga0466967_0009640 Ga0466967_0009640_5354_6577 359
43 3300028800 Ga0265338_10065919 Ga0265338_100659192 360
44 3300031235 Ga0265330_10065362 Ga0265330_100653622 360
45 3300031249 Ga0265339_10003685 Ga0265339_100036854 360
46 3300031344 Ga0265316_10007894 Ga0265316_100078944 360
47 3300031344 Ga0265316_10054548 Ga0265316_100545482 360
48 3300031595 Ga0265313_10026209 Ga0265313_100262092 360
49 3300031711 Ga0265314_10033302 Ga0265314_100333024 360
50 3300031711 Ga0265314_10116439 Ga0265314_101164391 360
51 3300044693 Ga0466961_0022687 Ga0466961_0022687_2188_3366 360
52 3300044719 Ga0466971_0024358 Ga0466971_0024358_1355_2533 360
53 3300045049 Ga0466959_0081904 Ga0466959_0081904_181_1359 360
54 3300045836 Ga0466958_0046096 Ga0466958_0046096_619_1797 360
55 3300061719 Ga0466962_0000874 Ga0466962_0000874_3374_4552 360
56 3300038443 Ga0395901_0132487 Ga0395901_0132487_163_1323 362
57 3300045051 Ga0451576_0070874 Ga0451576_0070874_1901_3103 362
58 3300005330 Ga0070690_100021471 Ga0070690_1000214712 363
59 3300005338 Ga0068868_100082652 Ga0068868_1000826523 363
60 3300005459 Ga0068867_100236012 Ga0068867_1002360122 363
61 3300010375 Ga0105239_10017617 Ga0105239_100176173 363
62 3300013306 Ga0163162_10013066 Ga0163162_100130666 363
63 3300014968 Ga0157379_10069084 Ga0157379_100690842 363
64 3300035171 Ga0373946_0002216 Ga0373946_0002216_3325_4446 363
65 3300045976 Ga0466967_0021947 Ga0466967_0021947_2165_3376 363
66 3300005334 Ga0068869_100011381 Ga0068869_1000113816 364
67 3300028800 Ga0265338_10016304 Ga0265338_100163046 364
68 3300037418 Ga0395900_0286839 Ga0395900_0286839_41_1201 364
69 3300049571 Ga0501034_0052299 Ga0501034_0052299_2804_4021 364
70 3300049586 Ga0501070_0001690 Ga0501070_0001690_13101_14318 364
71 3300049590 Ga0501074_0043348 Ga0501074_0043348_1433_2650 364
72 3300049742 Ga0501080_0000790 Ga0501080_0000790_15592_16809 364
73 3300039437 Ga0436365_0529836 Ga0436365_0529836_136_1308 365
74 3300005334 Ga0068869_100002310 Ga0068869_1000023107 366
75 3300005466 Ga0070685_10023854 Ga0070685_100238542 366
76 3300005539 Ga0068853_100236443 Ga0068853_1002364432 366
77 3300005617 Ga0068859_100023044 Ga0068859_1000230443 366
78 3300005842 Ga0068858_100009346 Ga0068858_1000093462 366
79 3300006931 Ga0097620_100023044 Ga0097620_1000230443 366
80 3300009093 Ga0105240_10032877 Ga0105240_100328774 366
81 3300013296 Ga0157374_10013937 Ga0157374_100139375 366
82 3300013307 Ga0157372_10169948 Ga0157372_101699483 366
83 3300013308 Ga0157375_10010268 Ga0157375_100102685 366
84 3300014497 Ga0182008_10009538 Ga0182008_100095382 366
85 3300021384 Ga0213876_10000499 Ga0213876_1000049913 366
86 3300025904 Ga0207647_10006481 Ga0207647_100064814 366
87 3300025913 Ga0207695_10040587 Ga0207695_100405872 366
88 3300025938 Ga0207704_10040395 Ga0207704_100403951 366
89 3300025942 Ga0207689_10000068 Ga0207689_1000006875 366
90 3300026035 Ga0207703_10004361 Ga0207703_100043615 366
91 3300044842 Ga0466957_0014120 Ga0466957_0014120_871_2088 366
92 3300045836 Ga0466958_0023765 Ga0466958_0023765_23_1240 366
93 3300045976 Ga0466967_0318065 Ga0466967_0318065_36_1253 366
94 3300048915 Ga0496112_0018723 Ga0496112_0018723_2995_4191 366
95 3300005545 Ga0070695_100000332 Ga0070695_10000033212 367
96 3300005563 Ga0068855_100330392 Ga0068855_1003303921 367
97 3300006178 Ga0075367_10003400 Ga0075367_100034006 367
98 3300006880 Ga0075429_100036051 Ga0075429_1000360514 367
99 3300009147 Ga0114129_10006424 Ga0114129_1000642411 367
100 3300025949 Ga0207667_10304926 Ga0207667_103049261 367
101 3300048905 Ga0496102_0205408 Ga0496102_0205408_95_1312 367
102 3300048909 Ga0496106_0087848 Ga0496106_0087848_541_1755 367
103 3300050494 nmdc:mga06z11_34409_c1 nmdc:mga06z11_34409_c1_945_2096 367
104 3300050508 nmdc:mga09592_31887_c1 nmdc:mga09592_31887_c1_3136_4296 367
105 3300044658 Ga0466972_0003402 Ga0466972_0003402_4049_5263 368
106 3300044694 Ga0466963_0081390 Ga0466963_0081390_577_1716 368
107 3300044735 Ga0466968_0021140 Ga0466968_0021140_987_2201 368
108 3300049741 Ga0501079_0020662 Ga0501079_0020662_1793_3019 368
109 3300049742 Ga0501080_0107594 Ga0501080_0107594_905_2131 368
110 3300049744 Ga0501083_0001358 Ga0501083_0001358_8802_10028 368
111 3300050493 nmdc:mga0k408_143766_c1 nmdc:mga0k408_143766_c1_223_1392 368
112 3300054114 Ga0501084_0210827 Ga0501084_0210827_74_1300 368
113 3300005365 Ga0070688_100202389 Ga0070688_1002023892 369
114 3300005618 Ga0068864_100375158 Ga0068864_1003751582 369
115 3300006881 Ga0068865_100035764 Ga0068865_1000357643 369
116 3300009177 Ga0105248_10296378 Ga0105248_102963782 369
117 3300011119 Ga0105246_10047378 Ga0105246_100473783 369
118 3300013308 Ga0157375_10402228 Ga0157375_104022281 369
119 3300032137 Ga0316585_10021964 Ga0316585_100219642 369
120 3300035398 Ga0316574_0101247 Ga0316574_0101247_557_1786 369
121 3300049583 Ga0501067_0030844 Ga0501067_0030844_1566_2780 369
122 3300049585 Ga0501069_0024610 Ga0501069_0024610_1791_3005 369
123 3300049586 Ga0501070_0109344 Ga0501070_0109344_388_1602 369
124 3300005530 Ga0070679_100068279 Ga0070679_1000682793 370
125 3300044693 Ga0466961_0051602 Ga0466961_0051602_245_1390 370
126 3300045049 Ga0466959_0022745 Ga0466959_0022745_2982_4127 370
127 3300046455 Ga0495603_0074034 Ga0495603_0074034_565_1698 370
128 3300046461 Ga0495641_0040200 Ga0495641_0040200_617_1750 370
129 3300049587 Ga0501071_0129109 Ga0501071_0129109_136_1317 370
130 3300049589 Ga0501073_0085144 Ga0501073_0085144_405_1586 370
131 3300031691 Ga0316579_10036678 Ga0316579_100366782 371
132 3300031733 Ga0316577_10023621 Ga0316577_100236212 371
133 3300036712 Ga0316584_0001417 Ga0316584_0001417_760_1989 371
134 3300037853 Ga0436364_1048088 Ga0436364_1048088_206_1357 371
135 3300044712 Ga0453684_0000137 Ga0453684_0000137_70313_71455 371
136 3300005293 Ga0065715_10103480 Ga0065715_101034802 372
137 3300005471 Ga0070698_100008136 Ga0070698_10000813610 372
138 3300028800 Ga0265338_10013371 Ga0265338_100133713 372
139 3300050510 nmdc:mga06r32_180028_c1 nmdc:mga06r32_180028_c1_36_1193 372
140 3300005536 Ga0070697_100062942 Ga0070697_1000629422 373
141 3300036712 Ga0316584_0264232 Ga0316584_0264232_95_1225 373
142 3300049585 Ga0501069_0086145 Ga0501069_0086145_219_1394 373
143 3300005331 Ga0070670_100002462 Ga0070670_1000024627 374
144 3300005339 Ga0070660_100108286 Ga0070660_1001082861 374
145 3300005616 Ga0068852_100395111 Ga0068852_1003951111 374
146 3300009545 Ga0105237_10268904 Ga0105237_102689042 374
147 3300025912 Ga0207707_10089694 Ga0207707_100896942 374
148 3300025932 Ga0207690_10185670 Ga0207690_101856701 374
149 3300031727 Ga0316576_10006734 Ga0316576_100067345 374
150 3300049574 Ga0501038_0217698 Ga0501038_0217698_68_1258 374
151 3300049575 Ga0501039_0170552 Ga0501039_0170552_490_1692 374
152 3300049577 Ga0501041_0124569 Ga0501041_0124569_137_1327 374
153 3300049579 Ga0501043_0113291 Ga0501043_0113291_775_1977 374
154 3300049592 Ga0501076_0013731 Ga0501076_0013731_4700_5890 374
155 3300049822 Ga0501035_0078062 Ga0501035_0078062_1342_2544 374
156 3300060353 Ga0501082_0021513 Ga0501082_0021513_2864_4054 374
157 3300005344 Ga0070661_100152321 Ga0070661_1001523211 375
158 3300005367 Ga0070667_100002607 Ga0070667_1000026072 375
159 3300005548 Ga0070665_100108904 Ga0070665_1001089042 375
160 3300009174 Ga0105241_10227820 Ga0105241_102278202 375
161 3300013105 Ga0157369_10191034 Ga0157369_101910342 375
162 3300025909 Ga0207705_10007416 Ga0207705_100074166 375
163 3300025919 Ga0207657_10032292 Ga0207657_100322924 375
164 3300025921 Ga0207652_10084782 Ga0207652_100847823 375
165 3300025932 Ga0207690_10030148 Ga0207690_100301483 375
166 3300025986 Ga0207658_10104759 Ga0207658_101047592 375
167 3300026078 Ga0207702_10192745 Ga0207702_101927452 375
168 3300028379 Ga0268266_10050430 Ga0268266_100504303 375
169 3300035083 Ga0373926_0001985 Ga0373926_0001985_4304_5530 375
170 3300035695 Ga0373927_0000442 Ga0373927_0000442_4320_5546 375
171 3300035695 Ga0373927_0156714 Ga0373927_0156714_339_1475 375
172 3300035725 Ga0373947_0058315 Ga0373947_0058315_81_1307 375
173 3300037068 Ga0373925_0002451 Ga0373925_0002451_4332_5558 375
174 3300037418 Ga0395900_0009629 Ga0395900_0009629_3187_4359 375
175 3300037418 Ga0395900_0062833 Ga0395900_0062833_137_1309 375
176 3300037466 Ga0395898_0039951 Ga0395898_0039951_273_1445 375
177 3300037471 Ga0395905_0007990 Ga0395905_0007990_6067_7239 375
178 3300037471 Ga0395905_0376655 Ga0395905_0376655_109_1281 375
179 3300044694 Ga0466963_0074221 Ga0466963_0074221_354_1502 375
180 3300044694 Ga0466963_0192911 Ga0466963_0192911_133_1296 375
181 3300044706 Ga0466964_0006640 Ga0466964_0006640_2172_3335 375
182 3300045976 Ga0466967_0055088 Ga0466967_0055088_11_1174 375
183 3300045976 Ga0466967_0065363 Ga0466967_0065363_282_1430 375
184 3300046517 Ga0495630_0010815 Ga0495630_0010815_1046_2272 375
185 3300046526 Ga0495666_0039038 Ga0495666_0039038_384_1610 375
186 3300049584 Ga0501068_0065527 Ga0501068_0065527_169_1335 375
187 3300049585 Ga0501069_0057290 Ga0501069_0057290_994_2160 375
188 3300061734 Ga0530510_0070335 Ga0530510_0070335_201_1367 375
189 3300005344 Ga0070661_100042426 Ga0070661_1000424263 376
190 3300020070 Ga0206356_10199250 Ga0206356_101992501 376
191 3300025912 Ga0207707_10053250 Ga0207707_100532503 376
192 3300025915 Ga0207693_10183250 Ga0207693_101832502 376
193 3300025917 Ga0207660_10036316 Ga0207660_100363163 376
194 3300028653 Ga0265323_10000808 Ga0265323_1000080814 376
195 3300031344 Ga0265316_10162262 Ga0265316_101622621 376
196 3300049576 Ga0501040_0105707 Ga0501040_0105707_230_1426 376
197 3300060353 Ga0501082_0066638 Ga0501082_0066638_182_1378 376
198 3300005329 Ga0070683_100006797 Ga0070683_1000067979 377
199 3300005535 Ga0070684_100005906 Ga0070684_1000059069 377
200 3300005577 Ga0068857_100005362 Ga0068857_10000536212 377
201 3300025944 Ga0207661_10005618 Ga0207661_100056182 377
202 3300026116 Ga0207674_10003025 Ga0207674_1000302514 377
203 3300044684 Ga0466966_0003064 Ga0466966_0003064_1524_2693 377
204 3300045049 Ga0466959_0018530 Ga0466959_0018530_3438_4607 377
205 3300005614 Ga0068856_100041360 Ga0068856_1000413603 378
206 3300009093 Ga0105240_10076034 Ga0105240_100760342 378
207 3300009551 Ga0105238_10002928 Ga0105238_100029285 378
208 3300028556 Ga0265337_1009313 Ga0265337_10093133 378
209 3300028800 Ga0265338_10145659 Ga0265338_101456592 378
210 3300031249 Ga0265339_10013432 Ga0265339_100134322 378
211 3300031727 Ga0316576_10047770 Ga0316576_100477702 378
212 3300038443 Ga0395901_0074377 Ga0395901_0074377_31_1242 378
213 3300005330 Ga0070690_100007018 Ga0070690_1000070183 379
214 3300005458 Ga0070681_10054309 Ga0070681_100543094 379
215 3300009093 Ga0105240_10216818 Ga0105240_102168182 379
216 3300026078 Ga0207702_10020867 Ga0207702_100208674 379
217 3300026116 Ga0207674_10131333 Ga0207674_101313332 379
218 3300036401 Ga0373937_0006833 Ga0373937_0006833_2603_3766 379
219 3300046477 Ga0495664_0028784 Ga0495664_0028784_633_1796 379
220 3300046535 Ga0495586_0122090 Ga0495586_0122090_210_1373 379
221 3300047471 Ga0495684_0069611 Ga0495684_0069611_1404_2567 379
222 3300005444 Ga0070694_100206913 Ga0070694_1002069132 380
223 3300005549 Ga0070704_100038753 Ga0070704_1000387534 380
224 3300006195 Ga0075366_10047113 Ga0075366_100471132 380
225 3300005327 Ga0070658_10074775 Ga0070658_100747754 381
226 3300005339 Ga0070660_100005436 Ga0070660_1000054361 381
227 3300005471 Ga0070698_100004488 Ga0070698_10000448812 381
228 3300006051 Ga0075364_10065154 Ga0075364_100651543 381
229 3300006871 Ga0075434_100264670 Ga0075434_1002646702 381
230 3300006880 Ga0075429_100115633 Ga0075429_1001156332 381
231 3300025913 Ga0207695_10100345 Ga0207695_101003453 381
232 3300025923 Ga0207681_10112143 Ga0207681_101121432 381
233 3300025949 Ga0207667_10098053 Ga0207667_100980533 381
234 3300028380 Ga0268265_10024420 Ga0268265_100244203 381
235 3300049568 Ga0501031_0118618 Ga0501031_0118618_223_1422 381
236 3300049577 Ga0501041_0075180 Ga0501041_0075180_251_1450 381
237 3300049588 Ga0501072_0091059 Ga0501072_0091059_296_1495 381
238 3300049592 Ga0501076_0078554 Ga0501076_0078554_97_1296 381
239 3300049741 Ga0501079_0242910 Ga0501079_0242910_97_1296 381
240 3300050508 nmdc:mga09592_54673_c1 nmdc:mga09592_54673_c1_786_2003 381
241 3300005339 Ga0070660_100002320 Ga0070660_1000023208 382
242 3300005458 Ga0070681_10030459 Ga0070681_100304594 382
243 3300005563 Ga0068855_100045953 Ga0068855_1000459535 382
244 3300005615 Ga0070702_100127938 Ga0070702_1001279382 382
245 3300006881 Ga0068865_100115160 Ga0068865_1001151602 382
246 3300014497 Ga0182008_10071496 Ga0182008_100714962 382
247 3300025912 Ga0207707_10020321 Ga0207707_100203212 382
248 3300025919 Ga0207657_10002101 Ga0207657_1000210116 382
249 3300025921 Ga0207652_10027406 Ga0207652_100274062 382
250 3300028800 Ga0265338_10000808 Ga0265338_100008084 382
251 3300031247 Ga0265340_10000208 Ga0265340_1000020811 382
252 3300046454 Ga0495592_0157188 Ga0495592_0157188_300_1505 382
253 3300049568 Ga0501031_0021793 Ga0501031_0021793_2449_3666 382
254 3300049572 Ga0501036_0054509 Ga0501036_0054509_29_1246 382
255 3300049576 Ga0501040_0084447 Ga0501040_0084447_342_1559 382
256 3300049591 Ga0501075_0010180 Ga0501075_0010180_4257_5474 382
257 3300049592 Ga0501076_0014008 Ga0501076_0014008_1457_2674 382
258 3300005364 Ga0070673_100183679 Ga0070673_1001836792 383
259 3300005365 Ga0070688_100059959 Ga0070688_1000599592 383
260 3300005366 Ga0070659_100163212 Ga0070659_1001632122 383
261 3300005617 Ga0068859_100154498 Ga0068859_1001544982 383
262 3300005618 Ga0068864_100029683 Ga0068864_1000296833 383
263 3300006844 Ga0075428_100057093 Ga0075428_1000570932 383
264 3300006852 Ga0075433_10073451 Ga0075433_100734512 383
265 3300006880 Ga0075429_100046673 Ga0075429_1000466734 383
266 3300006931 Ga0097620_100154495 Ga0097620_1001544952 383
267 3300009094 Ga0111539_10198647 Ga0111539_101986472 383
268 3300009177 Ga0105248_10052164 Ga0105248_100521642 383
269 3300025960 Ga0207651_10149597 Ga0207651_101495972 383
270 3300027907 Ga0207428_10182139 Ga0207428_101821392 383
271 3300028800 Ga0265338_10015698 Ga0265338_100156982 383
272 3300044683 Ga0466965_0053540 Ga0466965_0053540_728_1942 383
273 3300044693 Ga0466961_0006703 Ga0466961_0006703_4686_5900 383
274 3300044694 Ga0466963_0028739 Ga0466963_0028739_1135_2349 383
275 3300044719 Ga0466971_0001127 Ga0466971_0001127_8306_9520 383
276 3300044842 Ga0466957_0034198 Ga0466957_0034198_1037_2251 383
277 3300045049 Ga0466959_0165675 Ga0466959_0165675_106_1320 383
278 3300045836 Ga0466958_0006784 Ga0466958_0006784_4161_5375 383
279 3300046529 Ga0495652_0220923 Ga0495652_0220923_12_1181 383
280 3300046543 Ga0495645_0061296 Ga0495645_0061296_357_1526 383
281 3300047320 Ga0495672_0000882 Ga0495672_0000882_21265_22449 383
282 3300050508 nmdc:mga09592_19269_c1 nmdc:mga09592_19269_c1_1736_2917 383
283 3300005549 Ga0070704_100220523 Ga0070704_1002205232 384
284 3300006844 Ga0075428_100006228 Ga0075428_1000062285 384
285 3300006847 Ga0075431_100243744 Ga0075431_1002437442 384
286 3300009177 Ga0105248_10209096 Ga0105248_102090962 384
287 3300013104 Ga0157370_10146551 Ga0157370_101465512 384
288 3300025921 Ga0207652_10024327 Ga0207652_100243273 384
289 3300025931 Ga0207644_10145282 Ga0207644_101452821 384
290 3300025940 Ga0207691_10027345 Ga0207691_100273452 384
291 3300029957 Ga0265324_10016597 Ga0265324_100165972 384
292 3300031247 Ga0265340_10002875 Ga0265340_100028755 384
293 3300050507 nmdc:mga05p37_98941_c1 nmdc:mga05p37_98941_c1_1793_2977 384
294 3300005327 Ga0070658_10056106 Ga0070658_100561064 385
295 3300005329 Ga0070683_100202931 Ga0070683_1002029311 385
296 3300005445 Ga0070708_100046444 Ga0070708_1000464443 385
297 3300005467 Ga0070706_100002661 Ga0070706_10000266110 385
298 3300005467 Ga0070706_100203695 Ga0070706_1002036952 385
299 3300005518 Ga0070699_100024049 Ga0070699_1000240492 385
300 3300005536 Ga0070697_100004973 Ga0070697_1000049738 385
301 3300005563 Ga0068855_100125625 Ga0068855_1001256254 385
302 3300005615 Ga0070702_100149438 Ga0070702_1001494381 385
303 3300006871 Ga0075434_100250915 Ga0075434_1002509151 385
304 3300013307 Ga0157372_10257909 Ga0157372_102579091 385
305 3300021384 Ga0213876_10063781 Ga0213876_100637811 385
306 3300025922 Ga0207646_10001967 Ga0207646_100019679 385
307 3300028800 Ga0265338_10017598 Ga0265338_100175982 385
308 3300028800 Ga0265338_10021100 Ga0265338_100211008 385
309 3300029957 Ga0265324_10000275 Ga0265324_100002753 385
310 3300031665 Ga0316575_10000137 Ga0316575_1000013710 385
311 3300031665 Ga0316575_10003349 Ga0316575_100033492 385
312 3300031665 Ga0316575_10013470 Ga0316575_100134702 385
313 3300031691 Ga0316579_10011595 Ga0316579_100115952 385
314 3300031691 Ga0316579_10017849 Ga0316579_100178494 385
315 3300031691 Ga0316579_10046136 Ga0316579_100461362 385
316 3300031727 Ga0316576_10007773 Ga0316576_100077735 385
317 3300031727 Ga0316576_10023339 Ga0316576_100233392 385
318 3300031727 Ga0316576_10024125 Ga0316576_100241253 385
319 3300031727 Ga0316576_10049913 Ga0316576_100499132 385
320 3300031727 Ga0316576_10067626 Ga0316576_100676262 385
321 3300031727 Ga0316576_10076170 Ga0316576_100761701 385
322 3300031728 Ga0316578_10002110 Ga0316578_100021102 385
323 3300031728 Ga0316578_10003250 Ga0316578_100032504 385
324 3300031728 Ga0316578_10004444 Ga0316578_100044442 385
325 3300031728 Ga0316578_10026658 Ga0316578_100266582 385
326 3300031728 Ga0316578_10028855 Ga0316578_100288552 385
327 3300031728 Ga0316578_10136752 Ga0316578_101367522 385
328 3300031733 Ga0316577_10003305 Ga0316577_100033057 385
329 3300031733 Ga0316577_10011104 Ga0316577_100111042 385
330 3300031733 Ga0316577_10021614 Ga0316577_100216143 385
331 3300031733 Ga0316577_10042046 Ga0316577_100420463 385
332 3300031733 Ga0316577_10043114 Ga0316577_100431142 385
333 3300032133 Ga0316583_10001633 Ga0316583_100016339 385
334 3300032133 Ga0316583_10008407 Ga0316583_100084072 385
335 3300032133 Ga0316583_10010921 Ga0316583_100109212 385
336 3300032133 Ga0316583_10017925 Ga0316583_100179253 385
337 3300032133 Ga0316583_10027753 Ga0316583_100277532 385
338 3300032137 Ga0316585_10002173 Ga0316585_100021732 385
339 3300032137 Ga0316585_10023486 Ga0316585_100234862 385
340 3300032137 Ga0316585_10041778 Ga0316585_100417781 385
341 3300032139 Ga0316580_10006464 Ga0316580_100064643 385
342 3300032168 Ga0316593_10006804 Ga0316593_100068045 385
343 3300033524 Ga0316592_1016432 Ga0316592_10164322 385
344 3300035398 Ga0316574_0002636 Ga0316574_0002636_521_1687 385
345 3300035398 Ga0316574_0090720 Ga0316574_0090720_290_1462 385
346 3300035398 Ga0316574_0121083 Ga0316574_0121083_370_1533 385
347 3300036647 Ga0316582_0000276 Ga0316582_0000276_9657_10820 385
348 3300036647 Ga0316582_0000544 Ga0316582_0000544_12580_13746 385
349 3300036647 Ga0316582_0000865 Ga0316582_0000865_371_1534 385
350 3300036647 Ga0316582_0007404 Ga0316582_0007404_2095_3264 385
351 3300036647 Ga0316582_0018348 Ga0316582_0018348_2101_3267 385
352 3300036647 Ga0316582_0121905 Ga0316582_0121905_563_1726 385
353 3300036712 Ga0316584_0005032 Ga0316584_0005032_3802_4965 385
354 3300036712 Ga0316584_0013494 Ga0316584_0013494_3314_4486 385
355 3300036712 Ga0316584_0017467 Ga0316584_0017467_522_1685 385
356 3300036712 Ga0316584_0024858 Ga0316584_0024858_426_1595 385
357 3300036712 Ga0316584_0038300 Ga0316584_0038300_519_1685 385
358 3300036712 Ga0316584_0083163 Ga0316584_0083163_51_1214 385
359 3300036712 Ga0316584_0087525 Ga0316584_0087525_861_2027 385
360 3300036712 Ga0316584_0128813 Ga0316584_0128813_364_1530 385
361 3300036712 Ga0316584_0145687 Ga0316584_0145687_118_1281 385
362 3300036712 Ga0316584_0156528 Ga0316584_0156528_216_1385 385
363 3300037588 Ga0316581_0005654 Ga0316581_0005654_1415_2581 385
364 3300038726 Ga0400490_08090 Ga0400490_08090_796_1962 385
365 3300038726 Ga0400490_08299 Ga0400490_08299_94_1260 385
366 3300038726 Ga0400490_16839 Ga0400490_16839_11439_12605 385
367 3300038727 Ga0400491_08615 Ga0400491_08615_1138_2304 385
368 3300038727 Ga0400491_24515 Ga0400491_24515_536_1702 385
369 3300038735 Ga0400485_00122 Ga0400485_00122_10837_12003 385
370 3300038735 Ga0400485_17873 Ga0400485_17873_16727_17893 385
371 3300038742 Ga0400486_21674 Ga0400486_21674_3150_4316 385
372 3300038742 Ga0400486_23273 Ga0400486_23273_12640_13806 385
373 3300039062 Ga0400483_129331 Ga0400483_129331_904_2079 385
374 3300039062 Ga0400483_204894 Ga0400483_204894_241_1404 385
375 3300039093 Ga0400489_04024 Ga0400489_04024_10234_11400 385
376 3300039093 Ga0400489_24971 Ga0400489_24971_1862_3028 385
377 3300039093 Ga0400489_26114 Ga0400489_26114_12974_14137 385
378 3300039093 Ga0400489_29570 Ga0400489_29570_2130_3296 385
379 3300039110 Ga0400487_63934 Ga0400487_63934_14644_15810 385
380 3300039437 Ga0436365_0178835 Ga0436365_0178835_14870_16036 385
381 3300050494 nmdc:mga06z11_125646_c1 nmdc:mga06z11_125646_c1_15_1250 385
382 3300050494 nmdc:mga06z11_19555_c1 nmdc:mga06z11_19555_c1_194_1393 385
383 3300050495 nmdc:mga04h51_19876_c1 nmdc:mga04h51_19876_c1_408_1607 385
384 3300050507 nmdc:mga05p37_131624_c1 nmdc:mga05p37_131624_c1_402_1598 385
385 3300050512 nmdc:mga0n895_383551_c1 nmdc:mga0n895_383551_c1_40_1239 385
386 3300005330 Ga0070690_100129028 Ga0070690_1001290282 386
387 3300005445 Ga0070708_100011673 Ga0070708_1000116734 386
388 3300005468 Ga0070707_100099636 Ga0070707_1000996362 386
389 3300005471 Ga0070698_100036805 Ga0070698_1000368053 386
390 3300005536 Ga0070697_100088508 Ga0070697_1000885082 386
391 3300005618 Ga0068864_100354739 Ga0068864_1003547392 386
392 3300006880 Ga0075429_100000847 Ga0075429_10000084724 386
393 3300009147 Ga0114129_10000576 Ga0114129_1000057627 386
394 3300014968 Ga0157379_10325323 Ga0157379_103253231 386
395 3300025910 Ga0207684_10042749 Ga0207684_100427492 386
396 3300025922 Ga0207646_10011019 Ga0207646_100110197 386
397 3300050507 nmdc:mga05p37_1863_c1 nmdc:mga05p37_1863_c1_8127_9323 386
398 3300050508 nmdc:mga09592_2682_c1 nmdc:mga09592_2682_c1_7073_8269 386
399 3300050509 nmdc:mga0qj67_314533_c1 nmdc:mga0qj67_314533_c1_14_1210 386
400 3300006178 Ga0075367_10022928 Ga0075367_100229282 387
401 3300006847 Ga0075431_100037924 Ga0075431_1000379244 387
402 3300006847 Ga0075431_100078369 Ga0075431_1000783695 387
403 3300009147 Ga0114129_10040693 Ga0114129_100406933 387
404 3300009147 Ga0114129_10042343 Ga0114129_100423436 387
405 3300050507 nmdc:mga05p37_113161_c1 nmdc:mga05p37_113161_c1_153_1358 387
406 3300050507 nmdc:mga05p37_69916_c1 nmdc:mga05p37_69916_c1_761_1963 387
407 3300050508 nmdc:mga09592_217996_c1 nmdc:mga09592_217996_c1_69_1307 387
408 3300050510 nmdc:mga06r32_1717_c1 nmdc:mga06r32_1717_c1_1276_2478 387
409 3300050515 nmdc:mga0a205_23008_c1 nmdc:mga0a205_23008_c1_1159_2361 387
410 3300050515 nmdc:mga0a205_295831_c1 nmdc:mga0a205_295831_c1_113_1315 387
411 3300005334 Ga0068869_100014927 Ga0068869_1000149275 388
412 3300005335 Ga0070666_10031519 Ga0070666_100315193 388
413 3300005340 Ga0070689_100052289 Ga0070689_1000522891 388
414 3300005347 Ga0070668_100127101 Ga0070668_1001271011 388
415 3300005353 Ga0070669_100129148 Ga0070669_1001291482 388
416 3300005354 Ga0070675_100010502 Ga0070675_1000105027 388
417 3300005356 Ga0070674_100021050 Ga0070674_1000210502 388
418 3300005438 Ga0070701_10006287 Ga0070701_100062871 388
419 3300005456 Ga0070678_100104839 Ga0070678_1001048391 388
420 3300005459 Ga0068867_100033566 Ga0068867_1000335663 388
421 3300005471 Ga0070698_100012216 Ga0070698_1000122165 388
422 3300005543 Ga0070672_100032584 Ga0070672_1000325842 388
423 3300005548 Ga0070665_100078493 Ga0070665_1000784932 388
424 3300005549 Ga0070704_100127547 Ga0070704_1001275472 388
425 3300005563 Ga0068855_100133062 Ga0068855_1001330622 388
426 3300005617 Ga0068859_100108923 Ga0068859_1001089233 388
427 3300005719 Ga0068861_100196693 Ga0068861_1001966931 388
428 3300005841 Ga0068863_100045249 Ga0068863_1000452492 388
429 3300005842 Ga0068858_100013534 Ga0068858_1000135347 388
430 3300005844 Ga0068862_100059002 Ga0068862_1000590023 388
431 3300006038 Ga0075365_10009882 Ga0075365_100098826 388
432 3300006051 Ga0075364_10041319 Ga0075364_100413193 388
433 3300006177 Ga0075362_10005868 Ga0075362_100058684 388
434 3300006186 Ga0075369_10015744 Ga0075369_100157443 388
435 3300006195 Ga0075366_10000451 Ga0075366_1000045110 388
436 3300006353 Ga0075370_10017369 Ga0075370_100173692 388
437 3300006871 Ga0075434_100077099 Ga0075434_1000770992 388
438 3300006880 Ga0075429_100027456 Ga0075429_1000274565 388
439 3300006931 Ga0097620_100108925 Ga0097620_1001089253 388
440 3300007076 Ga0075435_100091424 Ga0075435_1000914241 388
441 3300009094 Ga0111539_10000113 Ga0111539_1000011334 388
442 3300009148 Ga0105243_10019388 Ga0105243_100193883 388
443 3300009177 Ga0105248_10020953 Ga0105248_100209535 388
444 3300025899 Ga0207642_10010166 Ga0207642_100101663 388
445 3300025907 Ga0207645_10018651 Ga0207645_100186512 388
446 3300025908 Ga0207643_10049752 Ga0207643_100497522 388
447 3300025926 Ga0207659_10015782 Ga0207659_100157822 388
448 3300025935 Ga0207709_10044125 Ga0207709_100441253 388
449 3300025936 Ga0207670_10028908 Ga0207670_100289082 388
450 3300025938 Ga0207704_10009641 Ga0207704_100096415 388
451 3300025940 Ga0207691_10001566 Ga0207691_1000156616 388
452 3300025941 Ga0207711_10111400 Ga0207711_101114002 388
453 3300025942 Ga0207689_10047058 Ga0207689_100470583 388
454 3300025960 Ga0207651_10046661 Ga0207651_100466612 388
455 3300026023 Ga0207677_10020219 Ga0207677_100202194 388
456 3300026035 Ga0207703_10021316 Ga0207703_100213163 388
457 3300026075 Ga0207708_10018651 Ga0207708_100186515 388
458 3300026088 Ga0207641_10019532 Ga0207641_100195322 388
459 3300026089 Ga0207648_10013312 Ga0207648_100133122 388
460 3300026118 Ga0207675_100037088 Ga0207675_1000370885 388
461 3300026121 Ga0207683_10082157 Ga0207683_100821572 388
462 3300027907 Ga0207428_10000197 Ga0207428_1000019768 388
463 3300028380 Ga0268265_10021110 Ga0268265_100211102 388
464 3300028381 Ga0268264_10034012 Ga0268264_100340125 388
465 3300050492 nmdc:mga0yw44_36808_c1 nmdc:mga0yw44_36808_c1_720_1928 388
466 3300050493 nmdc:mga0k408_50396_c1 nmdc:mga0k408_50396_c1_119_1327 388
467 3300050494 nmdc:mga06z11_3557_c1 nmdc:mga06z11_3557_c1_2453_3661 388
468 3300050496 nmdc:mga07m45_5086_c1 nmdc:mga07m45_5086_c1_302_1510 388
469 3300050508 nmdc:mga09592_205088_c1 nmdc:mga09592_205088_c1_333_1541 388
470 3300050511 nmdc:mga08y16_3313_c1 nmdc:mga08y16_3313_c1_14151_15359 388
471 3300050512 nmdc:mga0n895_166472_c1 nmdc:mga0n895_166472_c1_84_1295 388
472 3300005347 Ga0070668_100122503 Ga0070668_1001225032 389
473 3300005844 Ga0068862_100042914 Ga0068862_1000429145 389
474 3300006847 Ga0075431_100363379 Ga0075431_1003633792 389
475 3300009147 Ga0114129_10001509 Ga0114129_1000150911 389
476 3300026116 Ga0207674_10180666 Ga0207674_101806662 389
477 3300031251 Ga0265327_10016400 Ga0265327_100164003 389
478 3300031727 Ga0316576_10011164 Ga0316576_100111644 389
479 3300035398 Ga0316574_0013133 Ga0316574_0013133_1518_2732 389
480 3300050507 nmdc:mga05p37_61614_c1 nmdc:mga05p37_61614_c1_1184_2440 389
481 3300025885 Ga0207653_10030449 Ga0207653_100304491 390
482 3300025949 Ga0207667_10154276 Ga0207667_101542762 390
483 3300049577 Ga0501041_0112300 Ga0501041_0112300_383_1609 390
484 3300005444 Ga0070694_100027022 Ga0070694_1000270221 391
485 3300005467 Ga0070706_100036392 Ga0070706_1000363926 391
486 3300005471 Ga0070698_100022136 Ga0070698_1000221365 391
487 3300005545 Ga0070695_100056111 Ga0070695_1000561112 391
488 3300005546 Ga0070696_100216558 Ga0070696_1002165581 391
489 3300013104 Ga0157370_10087563 Ga0157370_100875632 391
490 3300028800 Ga0265338_10000032 Ga0265338_1000003247 391
491 3300029957 Ga0265324_10000434 Ga0265324_100004347 391
492 3300042876 Ga0451577_0237047 Ga0451577_0237047_305_1525 391
493 3300005435 Ga0070714_100015285 Ga0070714_1000152853 392
494 3300025929 Ga0207664_10024852 Ga0207664_100248525 392
495 3300028800 Ga0265338_10004439 Ga0265338_1000443916 392
496 3300029957 Ga0265324_10008137 Ga0265324_100081375 392
497 3300036401 Ga0373937_0058419 Ga0373937_0058419_1732_2925 392
498 3300026088 Ga0207641_10049937 Ga0207641_100499372 393
499 3300028800 Ga0265338_10107801 Ga0265338_101078012 393
500 3300042876 Ga0451577_0015600 Ga0451577_0015600_4628_5827 393
501 3300044712 Ga0453684_0194504 Ga0453684_0194504_985_2190 393
502 3300049570 Ga0501033_0012811 Ga0501033_0012811_2469_3674 393
503 3300005335 Ga0070666_10028244 Ga0070666_100282444 394
504 3300005341 Ga0070691_10024267 Ga0070691_100242672 394
505 3300005364 Ga0070673_100152841 Ga0070673_1001528412 394
506 3300005614 Ga0068856_100029138 Ga0068856_1000291383 394
507 3300006358 Ga0068871_100014149 Ga0068871_1000141492 394
508 3300006931 Ga0097620_100321597 Ga0097620_1003215972 394
509 3300007076 Ga0075435_100129022 Ga0075435_1001290222 394
510 3300013308 Ga0157375_10000006 Ga0157375_10000006213 394
511 3300014325 Ga0163163_10368666 Ga0163163_103686661 394
512 3300025938 Ga0207704_10135741 Ga0207704_101357412 394
513 3300026116 Ga0207674_10096275 Ga0207674_100962753 394
514 3300028800 Ga0265338_10000605 Ga0265338_100006058 394
515 3300028800 Ga0265338_10003037 Ga0265338_100030377 394
516 3300042876 Ga0451577_0003436 Ga0451577_0003436_11335_12537 394
517 3300044712 Ga0453684_0004628 Ga0453684_0004628_22353_23555 394
518 3300045051 Ga0451576_0028983 Ga0451576_0028983_94_1296 394
519 3300045051 Ga0451576_0101374 Ga0451576_0101374_691_1893 394
520 3300045051 Ga0451576_0119407 Ga0451576_0119407_1021_2238 394
521 3300046473 Ga0495582_0008132 Ga0495582_0008132_4034_5236 394
522 3300046517 Ga0495630_0000010 Ga0495630_0000010_110262_111464 394
523 3300046535 Ga0495586_0000048 Ga0495586_0000048_54577_55779 394
524 3300046642 Ga0495634_0018314 Ga0495634_0018314_1396_2598 394
525 3300046678 Ga0495599_0022090 Ga0495599_0022090_2362_3567 394
526 3300047319 Ga0495674_0001886 Ga0495674_0001886_8786_9988 394
527 3300005330 Ga0070690_100150748 Ga0070690_1001507482 395
528 3300005365 Ga0070688_100098166 Ga0070688_1000981662 395
529 3300005458 Ga0070681_10074824 Ga0070681_100748243 395
530 3300005530 Ga0070679_100132479 Ga0070679_1001324792 395
531 3300005563 Ga0068855_100039565 Ga0068855_1000395656 395
532 3300005614 Ga0068856_100001681 Ga0068856_10000168123 395
533 3300025913 Ga0207695_10049797 Ga0207695_100497972 395
534 3300025921 Ga0207652_10162013 Ga0207652_101620132 395
535 3300025949 Ga0207667_10256321 Ga0207667_102563212 395
536 3300026078 Ga0207702_10000808 Ga0207702_100008082 395
537 3300028563 Ga0265319_1011301 Ga0265319_10113013 395
538 3300028653 Ga0265323_10009676 Ga0265323_100096764 395
539 3300028800 Ga0265338_10000487 Ga0265338_1000048725 395
540 3300028800 Ga0265338_10006433 Ga0265338_1000643312 395
541 3300028800 Ga0265338_10032281 Ga0265338_100322813 395
542 3300028800 Ga0265338_10036354 Ga0265338_100363544 395
543 3300029957 Ga0265324_10027158 Ga0265324_100271583 395
544 3300031240 Ga0265320_10015186 Ga0265320_100151863 395
545 3300031241 Ga0265325_10073717 Ga0265325_100737172 395
546 3300031249 Ga0265339_10043425 Ga0265339_100434253 395
547 3300031251 Ga0265327_10001424 Ga0265327_1000142420 395
548 3300031344 Ga0265316_10001616 Ga0265316_1000161621 395
549 3300031595 Ga0265313_10026169 Ga0265313_100261693 395
550 3300031711 Ga0265314_10011022 Ga0265314_100110228 395
551 3300035118 Ga0373954_0019754 Ga0373954_0019754_321_1508 395
552 3300035119 Ga0373956_0071153 Ga0373956_0071153_192_1394 395
553 3300035692 Ga0373935_0018453 Ga0373935_0018453_2159_3364 395
554 3300035692 Ga0373935_0127303 Ga0373935_0127303_374_1576 395
555 3300035725 Ga0373947_0018292 Ga0373947_0018292_1318_2523 395
556 3300036401 Ga0373937_0047621 Ga0373937_0047621_2354_3541 395
557 3300045051 Ga0451576_0125277 Ga0451576_0125277_1290_2495 395
558 3300046517 Ga0495630_0015375 Ga0495630_0015375_3895_5082 395
559 3300046517 Ga0495630_0044356 Ga0495630_0044356_345_1550 395
560 3300046533 Ga0495640_0112665 Ga0495640_0112665_25_1212 395
561 3300046535 Ga0495586_0001538 Ga0495586_0001538_8726_9913 395
562 3300046543 Ga0495645_0136467 Ga0495645_0136467_277_1479 395
563 3300046642 Ga0495634_0018945 Ga0495634_0018945_1407_2594 395
564 3300046678 Ga0495599_0091371 Ga0495599_0091371_643_1845 395
565 3300046681 Ga0495647_0017659 Ga0495647_0017659_248_1435 395
566 3300046689 Ga0495613_0001643 Ga0495613_0001643_3184_4371 395
567 3300046690 Ga0495624_0032378 Ga0495624_0032378_761_1966 395
568 3300047319 Ga0495674_0024817 Ga0495674_0024817_138_1340 395
569 3300047322 Ga0495680_0002831 Ga0495680_0002831_5003_6190 395
570 3300028556 Ga0265337_1000420 Ga0265337_100042016 396
571 3300028563 Ga0265319_1010521 Ga0265319_10105214 396
572 3300028800 Ga0265338_10006466 Ga0265338_100064664 396
573 3300028800 Ga0265338_10009600 Ga0265338_100096004 396
574 3300028800 Ga0265338_10012683 Ga0265338_1001268310 396
575 3300031344 Ga0265316_10066286 Ga0265316_100662862 396
576 3300031711 Ga0265314_10029742 Ga0265314_100297423 396
577 3300031711 Ga0265314_10064052 Ga0265314_100640522 396
578 3300005439 Ga0070711_100006453 Ga0070711_1000064535 397
579 3300005841 Ga0068863_100216170 Ga0068863_1002161702 397
580 3300025916 Ga0207663_10006313 Ga0207663_100063135 397
581 3300028800 Ga0265338_10052764 Ga0265338_100527642 397
582 3300034816 Ga0373930_0001976 Ga0373930_0001976_1891_3093 397
583 3300035085 Ga0373929_0004550 Ga0373929_0004550_225_1427 397
584 3300035089 Ga0373944_0002365 Ga0373944_0002365_1413_2615 397
585 3300035090 Ga0373949_0001197 Ga0373949_0001197_4812_6014 397
586 3300035091 Ga0373951_0002160 Ga0373951_0002160_206_1408 397
587 3300035112 Ga0373932_0000003 Ga0373932_0000003_94565_95767 397
588 3300035116 Ga0373945_0044889 Ga0373945_0044889_387_1589 397
589 3300035242 Ga0373962_0000106 Ga0373962_0000106_12843_14045 397
590 3300035691 Ga0373931_0000017 Ga0373931_0000017_94423_95625 397
591 3300035725 Ga0373947_0023833 Ga0373947_0023833_1167_2369 397
592 3300037068 Ga0373925_0001370 Ga0373925_0001370_11118_12320 397
593 3300037068 Ga0373925_0009024 Ga0373925_0009024_4530_5732 397
594 3300047444 Ga0495675_0132473 Ga0495675_0132473_211_1407 397
595 3300049569 Ga0501032_0020292 Ga0501032_0020292_3111_4313 397
596 3300049822 Ga0501035_0069282 Ga0501035_0069282_1640_2842 397
597 3300049823 Ga0501044_0040160 Ga0501044_0040160_2262_3464 397
598 3300009093 Ga0105240_10246365 Ga0105240_102463652 398
599 3300049568 Ga0501031_0000012 Ga0501031_0000012_18536_19741 398
600 3300049569 Ga0501032_0007666 Ga0501032_0007666_1199_2404 398
601 3300049570 Ga0501033_0001607 Ga0501033_0001607_3442_4647 398
602 3300049822 Ga0501035_0003711 Ga0501035_0003711_10274_11479 398
603 3300049823 Ga0501044_0000024 Ga0501044_0000024_15397_16602 398
604 3300003320 rootH2_10054090 rootH2_100540907 401
605 3300029957 Ga0265324_10013737 Ga0265324_100137372 401

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13401

AAA_22

AAA domain

129

250

0.84

PF00437

T2SSE

Type II/IV secretion system protein

28

282

0.83

PF06414

Zeta_toxin

Zeta toxin

126

208

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
2eyu-assembly2.cif.gz_B the crystal structure of the c-terminal domain of aquifex aeolicus pilt 0.9276 115 361
2eyu-assembly2.cif.gz_B the crystal structure of the c-terminal domain of aquifex aeolicus pilt 0.9205 115 361
3jvv-assembly1.cif.gz_A-2 crystal structure of p. aeruginosa pilt with bound amp-pcp 0.9151 7 340
3jvu-assembly1.cif.gz_A-2 crystal structure of unliganded p. aeruginosa pilt 0.9106 1 354
2ewv-assembly1.cif.gz_A crystal structure of the pilus retraction motor pilt and bound adp 0.9058 6 359
ID Description Score Start End Superfamily
3jvvC02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9659 113 354 3.40.50.300
3jvvC02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9539 113 354 3.40.50.300
5fl3A01 Alpha Beta;2-Layer Sandwich;Beta-Lactamase; 0.9122 5 111 3.30.450.90
3jvvA01 Alpha Beta;2-Layer Sandwich;Beta-Lactamase; 0.8988 7 111 3.30.450.90
5fl3A01 Alpha Beta;2-Layer Sandwich;Beta-Lactamase; 0.8953 5 111 3.30.450.90
ID Description Score Start End GO Terms
AF-A0A2V5W608-F1-model_v4 Twitching motility protein 0.9993 128 225 GO:0016887
AF-A0A6I1IXX6-F1-model_v4 deleted 0.9868 108 255
AF-A0A3C0R2S6-F1-model_v4 Type IV pili twitching motility protein PilT 0.9849 122 247 GO:0016887
AF-K8BJ71-F1-model_v4 deleted 0.9832 132 241
AF-X1KSN6-F1-model_v4 Bacterial type II secretion system protein E domain-containing protein 0.9805 71 295 GO:0005524
GO:0016887

Feature Viewer

pLDDT pTM Quality
87.61 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map