F468516

General Info

Members Datasets Scaffolds Average Seq Length
605 286 605 208

Family's Representative Sequence

Representative Sequence 3300048910|Ga0496107_0102247|Ga0496107_0102247_1168_1893
Length 241
Sequence MAEAAASGAQAATSGGLKAPVLGKQAKADLPKEIFSEPFHESLVHEAARADLAARRRGTHSSLTRGEVAMTTAKAWRQKGTGRARAGALSVPHRYGGGAAFGPKPRHYTVKVNRKARRRALRSALTVHAERGTIGVLDGSTFSEPATKQAAEALRKWGADAPTLVVVTGDEDAVAKSFRNIEGATVALSDAAGVADVIGASSLLVSQAALEELASRASERPSTDAKPRAKRGEVSGEGRAS

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
55 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
58 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
59 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
60 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
150 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
151 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
152 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
153 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
154 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
155 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
156 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
157 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
158 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
159 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
160 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
161 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
162 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
163 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
164 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
165 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
166 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
168 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
169 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
170 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
171 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
172 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
173 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
174 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
175 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
176 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
177 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
178 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
179 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
180 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
181 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
182 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
183 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
184 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
185 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
186 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
187 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
188 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
189 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
190 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
191 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
192 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
193 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
194 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
195 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
196 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
197 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
198 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
199 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
200 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
201 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
202 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
203 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
204 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
205 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
206 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
207 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
208 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
209 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
210 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
211 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
212 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
213 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
214 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
215 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
216 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
217 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
218 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
219 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
220 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
221 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
222 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
223 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
224 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
225 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
226 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
227 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
228 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
229 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
230 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
231 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
232 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
233 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
234 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
235 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
236 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
237 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
238 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
239 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
240 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
241 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
251 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
252 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
253 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
254 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
255 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
256 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
257 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
258 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
259 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
260 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
261 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
264 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
265 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
266 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
267 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
268 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
269 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
270 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
271 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
272 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
273 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
274 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
275 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
276 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
277 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
278 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
279 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
280 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
281 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
282 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
283 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
284 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
285 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
286 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.34
Metatranscriptomes 0.66
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.97
Nodule 0
Rhizoplane 8.76
Rhizosphere 83.97
Stem 0
Stem Tuber 0
Unclassified 3.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10003124 3300001979 Bacteria 7308
2 JGI24748J21848_1000332 3300002074 Bacteria 5454
3 JGI24034J26672_10000068 3300002239 Bacteria 28347
4 JGI24742J22300_10000389 3300002244 Bacteria 6508
5 JGI25407J50210_10001250 3300003373 Bacteria 5684
6 JGI25407J50210_10002048 3300003373 Bacteria 4700
7 JGI25407J50210_10002196 3300003373 Bacteria 4567
8 JGI25407J50210_10007914 3300003373 Bacteria 2672
9 Ga0070683_100138936 3300005329 Bacteria 2301
10 Ga0070683_100620967 3300005329 Bacteria 1035
11 Ga0070683_100774059 3300005329 Bacteria 920
12 Ga0070690_100269847 3300005330 Bacteria 1210
13 Ga0070690_100453756 3300005330 Bacteria 951
14 Ga0070670_100085569 3300005331 Bacteria 2709
15 Ga0070670_101031762 3300005331 Unclassified 748
16 Ga0070666_10019547 3300005335 Bacteria 4374
17 Ga0070666_10696449 3300005335 Bacteria 745
18 Ga0070680_100002655 3300005336 Bacteria 13257
19 Ga0070682_100015047 3300005337 Bacteria 4479
20 Ga0070682_100106785 3300005337 Bacteria 1858
21 Ga0070682_100125847 3300005337 Bacteria 1727
22 Ga0068868_100009889 3300005338 Bacteria 6887
23 Ga0068868_100269192 3300005338 Bacteria 1439
24 Ga0068868_100862139 3300005338 Bacteria 821
25 Ga0070689_100128041 3300005340 Bacteria 2034
26 Ga0070691_10000257 3300005341 Bacteria 18341
27 Ga0070661_100000236 3300005344 Bacteria 45535
28 Ga0070661_100082633 3300005344 Bacteria 2372
29 Ga0070692_10087921 3300005345 Bacteria 1685
30 Ga0070692_10506087 3300005345 Bacteria 784
31 Ga0070668_100198128 3300005347 Bacteria 1648
32 Ga0070675_100000930 3300005354 Bacteria 20823
33 Ga0070674_100003700 3300005356 Bacteria 8616
34 Ga0070688_100002914 3300005365 Bacteria 8725
35 Ga0070659_100004067 3300005366 Bacteria 10429
36 Ga0070659_100013450 3300005366 Bacteria 6092
37 Ga0070667_100001611 3300005367 Bacteria 20202
38 Ga0070667_100287165 3300005367 Bacteria 1479
39 Ga0070714_100583970 3300005435 Bacteria 1072
40 Ga0070713_100000171 3300005436 Bacteria 43503
41 Ga0070711_100053395 3300005439 Bacteria 2785
42 Ga0070700_100279103 3300005441 Bacteria 1210
43 Ga0070700_100422397 3300005441 Bacteria 1008
44 Ga0070700_100657995 3300005441 Bacteria 828
45 Ga0070694_100097215 3300005444 Bacteria 2077
46 Ga0070663_100083061 3300005455 Bacteria 2358
47 Ga0070663_100266823 3300005455 Bacteria 1359
48 Ga0070663_100354826 3300005455 Bacteria 1188
49 Ga0070678_100021818 3300005456 Bacteria 4230
50 Ga0070678_100089186 3300005456 Bacteria 2360
51 Ga0070681_10002266 3300005458 Bacteria 17575
52 Ga0070681_10240863 3300005458 Bacteria 1722
53 Ga0068867_100003683 3300005459 Bacteria 10787
54 Ga0068867_100227734 3300005459 Bacteria 1505
55 Ga0068867_100389792 3300005459 Bacteria 1172
56 Ga0070685_10001772 3300005466 Bacteria 11292
57 Ga0070685_10066247 3300005466 Bacteria 2128
58 Ga0070685_10183462 3300005466 Bacteria 1349
59 Ga0070685_10218804 3300005466 Bacteria 1247
60 Ga0070679_100000832 3300005530 Bacteria 26815
61 Ga0070679_100036793 3300005530 Bacteria 4858
62 Ga0070684_100024708 3300005535 Bacteria 5042
63 Ga0070684_100115588 3300005535 Bacteria 2409
64 Ga0070684_100697080 3300005535 Bacteria 947
65 Ga0068853_100005341 3300005539 Bacteria 10057
66 Ga0070672_100000104 3300005543 Bacteria 42077
67 Ga0070686_100036335 3300005544 Bacteria 3049
68 Ga0070686_100172281 3300005544 Bacteria 1532
69 Ga0070695_100128981 3300005545 Bacteria 1741
70 Ga0070665_100777443 3300005548 Bacteria 970
71 Ga0070665_100851965 3300005548 Bacteria 924
72 Ga0070665_101137954 3300005548 Bacteria 792
73 Ga0070704_100414054 3300005549 Bacteria 1153
74 Ga0070704_100451731 3300005549 Bacteria 1107
75 Ga0070664_100027426 3300005564 Bacteria 4733
76 Ga0070664_100083028 3300005564 Bacteria 2764
77 Ga0070664_100633711 3300005564 Bacteria 993
78 Ga0068854_100014383 3300005578 Bacteria 5217
79 Ga0068854_100151099 3300005578 Bacteria 1791
80 Ga0068854_100414314 3300005578 Bacteria 1118
81 Ga0068854_100846022 3300005578 Bacteria 800
82 Ga0068856_100007453 3300005614 Bacteria 10677
83 Ga0068856_100031746 3300005614 Bacteria 5168
84 Ga0068856_100174723 3300005614 Bacteria 2160
85 Ga0068856_100816683 3300005614 Bacteria 952
86 Ga0070702_100204009 3300005615 Bacteria 1311
87 Ga0070702_100580723 3300005615 Bacteria 837
88 Ga0070702_100599186 3300005615 Bacteria 826
89 Ga0068852_100001042 3300005616 Bacteria 18249
90 Ga0068852_100048086 3300005616 Bacteria 3643
91 Ga0068852_100050655 3300005616 Bacteria 3559
92 Ga0068859_100398541 3300005617 Bacteria 1472
93 Ga0068866_10140603 3300005718 Bacteria 1385
94 Ga0068861_100155163 3300005719 Bacteria 1882
95 Ga0068861_100328039 3300005719 Bacteria 1335
96 Ga0068861_100518363 3300005719 Bacteria 1081
97 Ga0068851_10004857 3300005834 Bacteria 6084
98 Ga0068851_10047591 3300005834 Bacteria 2172
99 Ga0068870_10481152 3300005840 Bacteria 824
100 Ga0068860_100166222 3300005843 Bacteria 2129
101 Ga0068860_100492719 3300005843 Bacteria 1223
102 Ga0068862_100001247 3300005844 Bacteria 23931
103 Ga0068862_101052156 3300005844 Bacteria 807
104 Ga0081455_10010355 3300005937 Bacteria 9474
105 Ga0081455_10011025 3300005937 Bacteria 9104
106 Ga0081455_10011092 3300005937 Bacteria 9072
107 Ga0081455_10030723 3300005937 Bacteria 4875
108 Ga0081455_10063369 3300005937 Bacteria 3102
109 Ga0081455_10094536 3300005937 Bacteria 2414
110 Ga0081455_10163236 3300005937 Bacteria 1705
111 Ga0081455_10257704 3300005937 Bacteria 1272
112 Ga0081455_10268855 3300005937 Bacteria 1238
113 Ga0081455_10295633 3300005937 Bacteria 1164
114 Ga0081538_10000396 3300005981 Bacteria 49639
115 Ga0081538_10001771 3300005981 Bacteria 21857
116 Ga0081538_10003058 3300005981 Bacteria 15941
117 Ga0081538_10003213 3300005981 Bacteria 15534
118 Ga0081538_10004998 3300005981 Bacteria 12070
119 Ga0081538_10005868 3300005981 Bacteria 10942
120 Ga0081538_10008306 3300005981 Bacteria 8839
121 Ga0081538_10028056 3300005981 Bacteria 3884
122 Ga0081538_10031989 3300005981 Bacteria 3537
123 Ga0081538_10044033 3300005981 Bacteria 2791
124 Ga0081538_10059993 3300005981 Bacteria 2192
125 Ga0081538_10077500 3300005981 Bacteria 1790
126 Ga0081538_10084777 3300005981 Bacteria 1668
127 Ga0081538_10085553 3300005981 Bacteria 1656
128 Ga0081538_10133600 3300005981 Unclassified 1160
129 Ga0081538_10148825 3300005981 Bacteria 1064
130 Ga0081540_1000553 3300005983 Bacteria 36267
131 Ga0081540_1082547 3300005983 Bacteria 1441
132 Ga0081539_10002195 3300005985 Bacteria 28613
133 Ga0081539_10053821 3300005985 Bacteria 2251
134 Ga0075365_10000565 3300006038 Bacteria 14356
135 Ga0075365_10009057 3300006038 Bacteria 5694
136 Ga0075365_10233250 3300006038 Bacteria 1292
137 Ga0075363_100165933 3300006048 Bacteria 1252
138 Ga0075364_10020535 3300006051 Bacteria 4154
139 Ga0075364_10055344 3300006051 Bacteria 2595
140 Ga0075364_10147590 3300006051 Bacteria 1584
141 Ga0075364_10304670 3300006051 Bacteria 1085
142 Ga0075364_10365607 3300006051 Bacteria 984
143 Ga0070715_10205567 3300006163 Bacteria 1003
144 Ga0070716_100135126 3300006173 Bacteria 1565
145 Ga0070712_100003252 3300006175 Bacteria 10001
146 Ga0070712_100014893 3300006175 Bacteria 4998
147 Ga0075367_10174856 3300006178 Bacteria 1338
148 Ga0068871_100525748 3300006358 Bacteria 1069
149 Ga0075428_100022531 3300006844 Bacteria 6973
150 Ga0075428_100059133 3300006844 Bacteria 4197
151 Ga0075428_100456441 3300006844 Bacteria 1368
152 Ga0075430_100016384 3300006846 Bacteria 6311
153 Ga0075431_100008449 3300006847 Bacteria 10310
154 Ga0075431_100128099 3300006847 Bacteria 2619
155 Ga0075431_100271416 3300006847 Bacteria 1719
156 Ga0075434_100034388 3300006871 Bacteria 5005
157 Ga0075429_100121873 3300006880 Bacteria 2279
158 Ga0068865_100000056 3300006881 Bacteria 62122
159 Ga0097620_100398531 3300006931 Bacteria 1472
160 Ga0105240_10067591 3300009093 Bacteria 4429
161 Ga0111539_10094044 3300009094 Bacteria 3521
162 Ga0111539_10157492 3300009094 Bacteria 2657
163 Ga0111539_10239303 3300009094 Bacteria 2113
164 Ga0111539_10243969 3300009094 Bacteria 2091
165 Ga0111539_10466319 3300009094 Bacteria 1471
166 Ga0105245_10000528 3300009098 Bacteria 35016
167 Ga0105245_10014245 3300009098 Bacteria 6928
168 Ga0105245_10174160 3300009098 Bacteria 2051
169 Ga0105245_10275687 3300009098 Bacteria 1642
170 Ga0105245_10427748 3300009098 Bacteria 1328
171 Ga0105245_10725480 3300009098 Bacteria 1028
172 Ga0105247_10000064 3300009101 Bacteria 123994
173 Ga0105247_10056313 3300009101 Bacteria 2428
174 Ga0114129_10050964 3300009147 Bacteria 5812
175 Ga0114129_10087401 3300009147 Bacteria 4323
176 Ga0114129_10094967 3300009147 Bacteria 4129
177 Ga0114129_10127157 3300009147 Bacteria 3503
178 Ga0114129_10165092 3300009147 Bacteria 3022
179 Ga0114129_10529424 3300009147 Bacteria 1535
180 Ga0114129_11133455 3300009147 Bacteria 977
181 Ga0105243_10080350 3300009148 Bacteria 2659
182 Ga0105243_10144764 3300009148 Bacteria 2032
183 Ga0105243_10171682 3300009148 Bacteria 1879
184 Ga0105243_10200695 3300009148 Bacteria 1749
185 Ga0105243_10367335 3300009148 Bacteria 1326
186 Ga0105242_10000123 3300009176 Bacteria 56900
187 Ga0105242_10003277 3300009176 Bacteria 12618
188 Ga0105242_10044398 3300009176 Bacteria 3600
189 Ga0105248_10001735 3300009177 Bacteria 24226
190 Ga0105248_10074556 3300009177 Bacteria 3814
191 Ga0105238_10231599 3300009551 Bacteria 1824
192 Ga0105249_10003640 3300009553 Bacteria 13325
193 Ga0105249_10374126 3300009553 Bacteria 1449
194 Ga0105239_10965151 3300010375 Bacteria 979
195 Ga0105246_10175137 3300011119 Bacteria 1647
196 Ga0105246_10974260 3300011119 Bacteria 766
197 Ga0157371_10358486 3300013102 Bacteria 1062
198 Ga0157370_10005533 3300013104 Bacteria 14161
199 Ga0157370_10059005 3300013104 Bacteria 3647
200 Ga0157370_10132352 3300013104 Bacteria 2326
201 Ga0157369_10000068 3300013105 Bacteria 144274
202 Ga0157369_10066099 3300013105 Bacteria 3890
203 Ga0157378_10030690 3300013297 Bacteria 4747
204 Ga0157378_10258957 3300013297 Bacteria 1668
205 Ga0157378_10297293 3300013297 Bacteria 1561
206 Ga0163162_10322361 3300013306 Bacteria 1678
207 Ga0157372_10000809 3300013307 Bacteria 33940
208 Ga0157372_10007045 3300013307 Bacteria 11975
209 Ga0157375_10008331 3300013308 Bacteria 9080
210 Ga0157375_10237203 3300013308 Bacteria 1983
211 Ga0163163_10197122 3300014325 Bacteria 2062
212 Ga0163163_10461850 3300014325 Bacteria 1330
213 Ga0163163_10536951 3300014325 Bacteria 1232
214 Ga0157380_10000808 3300014326 Bacteria 19608
215 Ga0157380_10550426 3300014326 Bacteria 1132
216 Ga0157379_10087707 3300014968 Bacteria 2790
217 Ga0157379_10138083 3300014968 Bacteria 2197
218 Ga0157376_10028182 3300014969 Bacteria 4461
219 Ga0157376_10164943 3300014969 Bacteria 2012
220 Ga0157376_10483943 3300014969 Bacteria 1213
221 Ga0163161_10054161 3300017792 Bacteria 2911
222 Ga0163161_10054996 3300017792 Bacteria 2889
223 Ga0197907_10671781 3300020069 Bacteria 1721
224 Ga0206356_11300597 3300020070 Bacteria 2050
225 Ga0206354_11524261 3300020081 Bacteria 1324
226 Ga0206353_11509509 3300020082 Bacteria 4996
227 Ga0207656_10004334 3300025321 Bacteria 4948
228 Ga0207692_10132901 3300025898 Bacteria 1407
229 Ga0207642_10019085 3300025899 Bacteria 2647
230 Ga0207710_10000220 3300025900 Bacteria 50023
231 Ga0207710_10015681 3300025900 Bacteria 3205
232 Ga0207688_10026332 3300025901 Bacteria 3198
233 Ga0207680_10024081 3300025903 Bacteria 3335
234 Ga0207685_10089012 3300025905 Bacteria 1295
235 Ga0207654_10054051 3300025911 Bacteria 2320
236 Ga0207707_10005637 3300025912 Bacteria 10957
237 Ga0207707_10048171 3300025912 Bacteria 3712
238 Ga0207695_10251205 3300025913 Bacteria 1668
239 Ga0207695_10479024 3300025913 Bacteria 1127
240 Ga0207693_10001647 3300025915 Bacteria 19699
241 Ga0207693_10002588 3300025915 Bacteria 15717
242 Ga0207663_10037091 3300025916 Bacteria 2937
243 Ga0207660_10023884 3300025917 Bacteria 4133
244 Ga0207649_10000388 3300025920 Bacteria 32980
245 Ga0207649_10057089 3300025920 Bacteria 2439
246 Ga0207649_10158646 3300025920 Bacteria 1566
247 Ga0207652_10000666 3300025921 Bacteria 33621
248 Ga0207652_10009613 3300025921 Bacteria 7779
249 Ga0207652_10168460 3300025921 Bacteria 1965
250 Ga0207694_10452250 3300025924 Bacteria 1072
251 Ga0207650_10043384 3300025925 Bacteria 3301
252 Ga0207650_10667621 3300025925 Bacteria 877
253 Ga0207659_10000138 3300025926 Bacteria 42755
254 Ga0207687_10000025 3300025927 Bacteria 175177
255 Ga0207687_10005977 3300025927 Bacteria 8048
256 Ga0207687_10110444 3300025927 Bacteria 2039
257 Ga0207687_10206679 3300025927 Bacteria 1538
258 Ga0207687_10259197 3300025927 Bacteria 1385
259 Ga0207687_10310645 3300025927 Bacteria 1273
260 Ga0207700_10000019 3300025928 Bacteria 183117
261 Ga0207664_10104740 3300025929 Bacteria 2343
262 Ga0207690_10001935 3300025932 Bacteria 12700
263 Ga0207690_10008867 3300025932 Bacteria 5969
264 Ga0207686_10000066 3300025934 Bacteria 95095
265 Ga0207686_10001614 3300025934 Bacteria 12622
266 Ga0207709_10040649 3300025935 Bacteria 2785
267 Ga0207709_10319971 3300025935 Bacteria 1161
268 Ga0207709_10387641 3300025935 Bacteria 1065
269 Ga0207670_10108744 3300025936 Bacteria 1994
270 Ga0207669_10005898 3300025937 Bacteria 5544
271 Ga0207669_10329950 3300025937 Bacteria 1171
272 Ga0207704_10011990 3300025938 Bacteria 4287
273 Ga0207665_10019306 3300025939 Bacteria 4480
274 Ga0207691_10000430 3300025940 Bacteria 41789
275 Ga0207711_10000011 3300025941 Bacteria 518817
276 Ga0207661_10002381 3300025944 Bacteria 12947
277 Ga0207661_10002385 3300025944 Bacteria 12935
278 Ga0207661_10058350 3300025944 Bacteria 3105
279 Ga0207661_10107996 3300025944 Bacteria 2348
280 Ga0207661_10653359 3300025944 Bacteria 966
281 Ga0207679_10064235 3300025945 Bacteria 2743
282 Ga0207679_10069455 3300025945 Bacteria 2651
283 Ga0207679_10135579 3300025945 Bacteria 1982
284 Ga0207679_10312940 3300025945 Unclassified 1357
285 Ga0207712_10003459 3300025961 Bacteria 9970
286 Ga0207712_10124409 3300025961 Bacteria 1956
287 Ga0207712_10129766 3300025961 Bacteria 1919
288 Ga0207712_10281223 3300025961 Bacteria 1358
289 Ga0207668_10002563 3300025972 Bacteria 10620
290 Ga0207668_10173476 3300025972 Bacteria 1693
291 Ga0207640_10000691 3300025981 Bacteria 19634
292 Ga0207640_10956987 3300025981 Bacteria 751
293 Ga0207658_10000840 3300025986 Bacteria 25652
294 Ga0207658_10122209 3300025986 Bacteria 2078
295 Ga0207677_10056601 3300026023 Bacteria 2688
296 Ga0207639_10026393 3300026041 Bacteria 4221
297 Ga0207639_10923962 3300026041 Bacteria 816
298 Ga0207678_10002630 3300026067 Bacteria 16356
299 Ga0207678_10155956 3300026067 Bacteria 1949
300 Ga0207708_10224638 3300026075 Bacteria 1506
301 Ga0207708_10243745 3300026075 Bacteria 1446
302 Ga0207702_10006219 3300026078 Bacteria 10321
303 Ga0207702_10015335 3300026078 Bacteria 6351
304 Ga0207702_10135029 3300026078 Bacteria 2225
305 Ga0207702_11328433 3300026078 Unclassified 713
306 Ga0207648_10005232 3300026089 Bacteria 13117
307 Ga0207648_10066179 3300026089 Bacteria 3151
308 Ga0207648_11012616 3300026089 Bacteria 778
309 Ga0207675_100087831 3300026118 Bacteria 2921
310 Ga0207675_100862903 3300026118 Bacteria 920
311 Ga0207675_100941842 3300026118 Bacteria 881
312 Ga0207683_10029338 3300026121 Bacteria 4762
313 Ga0207683_10051534 3300026121 Bacteria 3606
314 Ga0207698_10000014 3300026142 Bacteria 240703
315 Ga0207698_10021851 3300026142 Bacteria 4433
316 Ga0207698_10054216 3300026142 Bacteria 3084
317 Ga0207428_10039587 3300027907 Bacteria 3828
318 Ga0268266_10005543 3300028379 Bacteria 11749
319 Ga0268266_10985844 3300028379 Bacteria 815
320 Ga0268265_10005115 3300028380 Bacteria 8983
321 Ga0268265_10944848 3300028380 Bacteria 849
322 Ga0268264_10023259 3300028381 Bacteria 5056
323 Ga0265326_10020928 3300028558 Bacteria 1875
324 Ga0265319_1000030 3300028563 Bacteria 129742
325 Ga0265336_10120476 3300028666 Bacteria 781
326 Ga0265338_10000156 3300028800 Bacteria 125065
327 Ga0265325_10005113 3300031241 Bacteria 8165
328 Ga0307513_10200086 3300031456 Bacteria 1840
329 Ga0307405_10095388 3300031731 Bacteria 1981
330 Ga0307405_10814437 3300031731 Unclassified 783
331 Ga0307413_10494430 3300031824 Bacteria 981
332 Ga0307410_10517636 3300031852 Unclassified 984
333 Ga0307407_10326879 3300031903 Bacteria 1078
334 Ga0307409_100117811 3300031995 Bacteria 2242
335 Ga0307409_100245144 3300031995 Bacteria 1634
336 Ga0307409_100465396 3300031995 Bacteria 1223
337 Ga0307416_100619015 3300032002 Bacteria 1164
338 Ga0307416_101232801 3300032002 Bacteria 854
339 Ga0307415_100752719 3300032126 Unclassified 885
340 Ga0373960_0005767 3300035121 Bacteria 2880
341 Ga0373961_0103147 3300035241 Bacteria 926
342 Ga0373962_0022030 3300035242 Bacteria 1686
343 Ga0373947_0477718 3300035725 Bacteria 846
344 Ga0373937_0354465 3300036401 Bacteria 1390
345 Ga0395899_0444047 3300037312 Bacteria 851
346 Ga0395900_0584307 3300037418 Bacteria 1059
347 Ga0395898_0017781 3300037466 Bacteria 7254
348 Ga0395898_0024801 3300037466 Bacteria 6046
349 Ga0395898_0352683 3300037466 Bacteria 1403
350 Ga0395898_0974445 3300037466 Bacteria 784
351 Ga0395905_0013334 3300037471 Bacteria 7878
352 Ga0395905_0441187 3300037471 Bacteria 1199
353 Ga0395905_0712536 3300037471 Bacteria 906
354 Ga0395901_0011288 3300038443 Bacteria 9050
355 Ga0395901_0012327 3300038443 Bacteria 8674
356 Ga0395901_0045141 3300038443 Bacteria 4572
357 Ga0395901_0100695 3300038443 Bacteria 3031
358 Ga0395901_0252586 3300038443 Bacteria 1837
359 Ga0395901_0399211 3300038443 Bacteria 1413
360 Ga0395901_0699217 3300038443 Bacteria 1012
361 Ga0451849_1549853 3300041505 Bacteria 1209
362 Ga0439443_032238 3300042003 Bacteria 868
363 Ga0439448_0096937 3300042005 Bacteria 1000
364 Ga0439464_0012359 3300042439 Bacteria 2274
365 Ga0466963_0390591 3300044694 Bacteria 981
366 Ga0466963_0414124 3300044694 Bacteria 950
367 Ga0466957_0001797 3300044842 Bacteria 11298
368 Ga0466957_0047130 3300044842 Bacteria 2618
369 Ga0466957_0312582 3300044842 Bacteria 1058
370 Ga0466958_0043454 3300045836 Bacteria 2707
371 Ga0466967_0000003 3300045976 Bacteria 169144
372 Ga0466967_0078881 3300045976 Bacteria 2967
373 Ga0466967_0900267 3300045976 Bacteria 880
374 Ga0495629_0000543 3300046459 Bacteria 31107
375 Ga0495629_0004371 3300046459 Bacteria 10589
376 Ga0495629_0012223 3300046459 Bacteria 6217
377 Ga0495638_0020983 3300046460 Bacteria 4312
378 Ga0495641_0085891 3300046461 Bacteria 1408
379 Ga0495582_0092785 3300046473 Bacteria 1685
380 Ga0495662_0013224 3300046476 Bacteria 4017
381 Ga0495662_0217386 3300046476 Bacteria 942
382 Ga0495662_0437372 3300046476 Bacteria 642
383 Ga0495585_0154277 3300046492 Bacteria 1196
384 Ga0495596_0039775 3300046500 Bacteria 1857
385 Ga0495596_0048803 3300046500 Bacteria 1660
386 Ga0495606_0000283 3300046507 Bacteria 88309
387 Ga0495608_0000010 3300046511 Bacteria 258660
388 Ga0495618_0273469 3300046514 Bacteria 1055
389 Ga0495628_0000864 3300046516 Bacteria 28036
390 Ga0495630_0000148 3300046517 Bacteria 54619
391 Ga0495630_0000395 3300046517 Bacteria 34351
392 Ga0495631_0074288 3300046518 Bacteria 1468
393 Ga0495637_0075343 3300046520 Bacteria 1354
394 Ga0495644_0170311 3300046523 Bacteria 836
395 Ga0495644_0233003 3300046523 Bacteria 713
396 Ga0495663_0028842 3300046525 Bacteria 1636
397 Ga0495652_0000009 3300046529 Bacteria 311000
398 Ga0495652_0319637 3300046529 Bacteria 1122
399 Ga0495587_0262530 3300046536 Bacteria 970
400 Ga0495645_0018112 3300046543 Bacteria 5055
401 Ga0495633_0118628 3300046558 Bacteria 1226
402 Ga0495634_0000993 3300046642 Bacteria 26739
403 Ga0495634_0133082 3300046642 Bacteria 1584
404 Ga0495625_0000109 3300046660 Bacteria 125064
405 Ga0495588_0000175 3300046674 Bacteria 80911
406 Ga0495657_0000005 3300046675 Bacteria 254860
407 Ga0495599_0290938 3300046678 Bacteria 988
408 Ga0495647_0000114 3300046681 Bacteria 20349
409 Ga0495658_0001193 3300046683 Bacteria 13694
410 Ga0495613_0000087 3300046689 Bacteria 88644
411 Ga0495624_0000429 3300046690 Bacteria 33305
412 Ga0495589_0073363 3300046794 Bacteria 1670
413 Ga0495600_0072600 3300046809 Bacteria 2247
414 Ga0495604_0000322 3300047317 Bacteria 42966
415 Ga0495676_0000522 3300047321 Bacteria 31518
416 Ga0495676_0046499 3300047321 Bacteria 3521
417 Ga0495680_0009545 3300047322 Bacteria 8718
418 Ga0495680_0104929 3300047322 Bacteria 2102
419 Ga0495675_0000398 3300047444 Bacteria 30075
420 Ga0495684_0101777 3300047471 Bacteria 2172
421 Ga0495593_0134286 3300047673 Bacteria 1255
422 Ga0495602_0000038 3300048088 Bacteria 130758
423 Ga0495602_0003702 3300048088 Bacteria 15861
424 Ga0495602_0098658 3300048088 Bacteria 2403
425 Ga0496100_0000028 3300048903 Bacteria 113912
426 Ga0496100_0005219 3300048903 Bacteria 6975
427 Ga0496101_0000005 3300048904 Bacteria 331455
428 Ga0496101_0046252 3300048904 Bacteria 3120
429 Ga0496102_0000021 3300048905 Bacteria 246920
430 Ga0496102_0006894 3300048905 Bacteria 9692
431 Ga0496102_0404993 3300048905 Bacteria 1282
432 Ga0496102_0442318 3300048905 Bacteria 1220
433 Ga0496102_0457202 3300048905 Unclassified 1197
434 Ga0496103_0000001 3300048906 Bacteria 643471
435 Ga0496103_0006645 3300048906 Bacteria 6900
436 Ga0496103_0194384 3300048906 Bacteria 1304
437 Ga0496104_0000029 3300048907 Bacteria 202968
438 Ga0496104_0007889 3300048907 Bacteria 9440
439 Ga0496105_0000002 3300048908 Bacteria 753215
440 Ga0496105_0044587 3300048908 Bacteria 3658
441 Ga0496105_0055620 3300048908 Bacteria 3267
442 Ga0496106_0000070 3300048909 Bacteria 82770
443 Ga0496106_0001451 3300048909 Bacteria 17805
444 Ga0496106_0083694 3300048909 Bacteria 2454
445 Ga0496107_0000004 3300048910 Bacteria 297680
446 Ga0496107_0003754 3300048910 Bacteria 10204
447 Ga0496107_0102247 3300048910 Bacteria 2101
448 Ga0496108_0000042 3300048911 Bacteria 146397
449 Ga0496108_0050264 3300048911 Bacteria 3489
450 Ga0496108_0146414 3300048911 Bacteria 2036
451 Ga0496108_0146776 3300048911 Bacteria 2034
452 Ga0496109_0000034 3300048912 Bacteria 160397
453 Ga0496109_0000062 3300048912 Bacteria 112843
454 Ga0496109_0016797 3300048912 Bacteria 6404
455 Ga0496109_0047839 3300048912 Bacteria 3890
456 Ga0496109_0193960 3300048912 Bacteria 1909
457 Ga0496109_0199889 3300048912 Bacteria 1879
458 Ga0496109_0213119 3300048912 Bacteria 1816
459 Ga0496110_0000325 3300048913 Bacteria 31707
460 Ga0496110_0049274 3300048913 Bacteria 3694
461 Ga0496110_0060865 3300048913 Bacteria 3331
462 Ga0496110_0330688 3300048913 Bacteria 1388
463 Ga0496111_0000171 3300048914 Bacteria 29367
464 Ga0496111_0022155 3300048914 Bacteria 4444
465 Ga0496111_0084895 3300048914 Bacteria 2315
466 Ga0496112_0007934 3300048915 Bacteria 9463
467 Ga0496112_0098738 3300048915 Bacteria 2889
468 Ga0496112_0725603 3300048915 Bacteria 921
469 Ga0496113_0000002 3300048916 Bacteria 220193
470 Ga0496113_0138665 3300048916 Bacteria 1912
471 Ga0496113_0231495 3300048916 Bacteria 1473
472 Ga0496114_0000097 3300048917 Bacteria 63410
473 Ga0496114_0002329 3300048917 Bacteria 14462
474 Ga0496114_0173892 3300048917 Bacteria 1878
475 Ga0496115_0000005 3300048918 Bacteria 290756
476 Ga0496115_0000151 3300048918 Bacteria 64493
477 Ga0496115_0000552 3300048918 Bacteria 29009
478 Ga0496117_0008580 3300048920 Bacteria 9688
479 Ga0496117_0138567 3300048920 Bacteria 1461
480 Ga0496117_0192031 3300048920 Bacteria 1162
481 Ga0496118_0011630 3300048921 Bacteria 8558
482 Ga0496118_0226027 3300048921 Bacteria 1084
483 Ga0496119_0003596 3300048922 Bacteria 15948
484 Ga0496119_0008336 3300048922 Bacteria 9135
485 Ga0496119_0011836 3300048922 Bacteria 7165
486 Ga0496120_0013670 3300048923 Bacteria 5453
487 Ga0496120_0024517 3300048923 Bacteria 3760
488 Ga0496121_0042207 3300048924 Bacteria 3972
489 Ga0496121_0244711 3300048924 Bacteria 1247
490 Ga0496121_0300513 3300048924 Bacteria 1089
491 Ga0496121_0429376 3300048924 Bacteria 857
492 Ga0496125_0036690 3300048928 Bacteria 4274
493 Ga0496125_0149885 3300048928 Bacteria 1604
494 Ga0496126_0061679 3300048929 Bacteria 3367
495 Ga0496126_0096085 3300048929 Bacteria 2598
496 Ga0501031_0233054 3300049568 Bacteria 1198
497 Ga0501033_0386891 3300049570 Bacteria 977
498 Ga0501036_0137584 3300049572 Bacteria 2061
499 Ga0501036_0583032 3300049572 Bacteria 928
500 Ga0501039_0074862 3300049575 Bacteria 2632
501 Ga0501040_0032892 3300049576 Bacteria 3510
502 Ga0501040_0254900 3300049576 Bacteria 1252
503 Ga0501040_0668859 3300049576 Unclassified 751
504 Ga0501041_0041348 3300049577 Bacteria 2800
505 Ga0501042_0033767 3300049578 Bacteria 3628
506 Ga0501042_0062229 3300049578 Bacteria 2667
507 Ga0501042_0084775 3300049578 Bacteria 2272
508 Ga0501042_0246819 3300049578 Bacteria 1288
509 Ga0501042_0557219 3300049578 Bacteria 833
510 Ga0501047_0061590 3300049581 Bacteria 3620
511 Ga0501047_0076497 3300049581 Bacteria 3221
512 Ga0501047_0199045 3300049581 Bacteria 1864
513 Ga0501048_0050531 3300049582 Bacteria 2961
514 Ga0501048_0201395 3300049582 Bacteria 1411
515 Ga0501048_0523487 3300049582 Bacteria 850
516 Ga0501067_0150215 3300049583 Bacteria 1298
517 Ga0501070_0158483 3300049586 Bacteria 1866
518 Ga0501070_0208757 3300049586 Bacteria 1603
519 Ga0501070_0801896 3300049586 Unclassified 739
520 Ga0501071_0100086 3300049587 Bacteria 2136
521 Ga0501071_0128689 3300049587 Bacteria 1880
522 Ga0501071_0240516 3300049587 Bacteria 1365
523 Ga0501072_0010149 3300049588 Bacteria 7171
524 Ga0501074_0097828 3300049590 Bacteria 2100
525 Ga0501074_0359990 3300049590 Bacteria 1032
526 Ga0501074_0361301 3300049590 Bacteria 1030
527 Ga0501075_0151092 3300049591 Bacteria 1770
528 Ga0501075_0157968 3300049591 Bacteria 1729
529 Ga0501076_0043911 3300049592 Bacteria 3524
530 Ga0501076_0052178 3300049592 Bacteria 3239
531 Ga0501079_0049546 3300049741 Bacteria 3242
532 Ga0501079_0399968 3300049741 Bacteria 1077
533 Ga0501079_0596192 3300049741 Bacteria 869
534 Ga0501080_0458977 3300049742 Bacteria 1141
535 Ga0501081_0072804 3300049743 Bacteria 2396
536 Ga0501081_0087548 3300049743 Bacteria 2188
537 Ga0501081_0394052 3300049743 Bacteria 1025
538 Ga0501083_0013469 3300049744 Bacteria 5715
539 Ga0501083_0025951 3300049744 Bacteria 4054
540 Ga0501035_0126212 3300049822 Bacteria 2234
541 Ga0501035_0537841 3300049822 Bacteria 958
542 Ga0501035_0568219 3300049822 Bacteria 927
543 Ga0501044_0021243 3300049823 Bacteria 6929
544 Ga0501044_0368048 3300049823 Bacteria 1354
545 Ga0501045_0046940 3300049824 Bacteria 3145
546 Ga0501045_0096873 3300049824 Bacteria 2183
547 Ga0501045_0158213 3300049824 Bacteria 1686
548 nmdc:mga00v17_126142_c1 3300050491 Bacteria 1633
549 nmdc:mga00v17_132396_c1 3300050491 Bacteria 1594
550 nmdc:mga00v17_301783_c1 3300050491 Bacteria 1040
551 nmdc:mga00v17_322826_c1 3300050491 Bacteria 1003
552 nmdc:mga00v17_80265_c1 3300050491 Bacteria 2036
553 nmdc:mga00v17_91224_c1 3300050491 Bacteria 1053
554 nmdc:mga0yw44_1227_c1 3300050492 Bacteria 10057
555 nmdc:mga0yw44_8217_c1 3300050492 Bacteria 5186
556 nmdc:mga06z11_175335_c1 3300050494 Unclassified 1233
557 nmdc:mga06z11_229377_c1 3300050494 Bacteria 1087
558 nmdc:mga05p37_160309_c1 3300050507 Bacteria 2748
559 nmdc:mga05p37_242619_c1 3300050507 Bacteria 2165
560 nmdc:mga05p37_343611_c1 3300050507 Bacteria 1759
561 nmdc:mga05p37_576969_c1 3300050507 Bacteria 1274
562 nmdc:mga05p37_780875_c1 3300050507 Bacteria 1048
563 nmdc:mga05p37_922316_c1 3300050507 Bacteria 939
564 nmdc:mga09592_20196_c1 3300050508 Bacteria 5474
565 nmdc:mga09592_366988_c1 3300050508 Bacteria 1245
566 nmdc:mga0qj67_186845_c1 3300050509 Bacteria 1683
567 nmdc:mga0qj67_251293_c1 3300050509 Bacteria 1435
568 nmdc:mga06r32_115058_c1 3300050510 Bacteria 2648
569 nmdc:mga06r32_133354_c1 3300050510 Bacteria 2458
570 nmdc:mga06r32_137843_c1 3300050510 Bacteria 2415
571 nmdc:mga06r32_491359_c1 3300050510 Bacteria 1205
572 nmdc:mga08y16_212067_c1 3300050511 Bacteria 2006
573 nmdc:mga08y16_336891_c1 3300050511 Bacteria 1551
574 nmdc:mga08y16_66629_c1 3300050511 Bacteria 3758
575 nmdc:mga08y16_69250_c1 3300050511 Bacteria 3678
576 nmdc:mga0n895_241244_c1 3300050512 Bacteria 1834
577 nmdc:mga0a205_101539_c1 3300050515 Bacteria 2775
578 nmdc:mga0a205_226631_c1 3300050515 Bacteria 1753
579 Ga0495601_0000065 3300053077 Bacteria 58386
580 Ga0495601_0019078 3300053077 Bacteria 4179
581 Ga0495601_0150356 3300053077 Bacteria 1520
582 Ga0495612_0004181 3300053078 Bacteria 5986
583 Ga0495655_0000013 3300053083 Bacteria 63264
584 Ga0495655_0001612 3300053083 Bacteria 3478
585 Ga0495595_0000005 3300053084 Bacteria 258660
586 Ga0495595_0029416 3300053084 Bacteria 2459
587 Ga0495595_0140061 3300053084 Bacteria 1186
588 Ga0495619_0000069 3300053085 Bacteria 82755
589 Ga0495619_0000489 3300053085 Bacteria 26595
590 Ga0495619_0001068 3300053085 Bacteria 17953
591 Ga0495619_0003847 3300053085 Bacteria 9666
592 Ga0500566_0001523 3300053094 Bacteria 13612
593 Ga0500628_000045 3300053129 Bacteria 45042
594 Ga0500658_0016931 3300053134 Bacteria 2719
595 Ga0500568_0111496 3300053139 Bacteria 1022
596 Ga0501084_0087286 3300054114 Bacteria 2619
597 Ga0501084_0107519 3300054114 Bacteria 2343
598 Ga0501084_0290107 3300054114 Bacteria 1382
599 Ga0590071_010548 3300059421 Bacteria 2164
600 Ga0501082_0043605 3300060353 Bacteria 3868
601 Ga0501082_0089866 3300060353 Bacteria 2652
602 Ga0501082_0201129 3300060353 Bacteria 1733
603 Ga0501082_0896419 3300060353 Bacteria 776
604 Ga0530510_0009741 3300061734 Bacteria 6742
605 Ga0530510_0069251 3300061734 Bacteria 2560

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046476 Ga0495662_0217386 Ga0495662_0217386_423_926 159
2 3300046476 Ga0495662_0437372 Ga0495662_0437372_118_621 159
3 3300005937 Ga0081455_10011025 Ga0081455_100110259 190
4 3300048905 Ga0496102_0442318 Ga0496102_0442318_406_1020 190
5 3300006847 Ga0075431_100128099 Ga0075431_1001280992 191
6 3300006871 Ga0075434_100034388 Ga0075434_1000343886 191
7 3300009147 Ga0114129_10087401 Ga0114129_100874012 191
8 3300048912 Ga0496109_0193960 Ga0496109_0193960_996_1613 191
9 3300050507 nmdc:mga05p37_780875_c1 nmdc:mga05p37_780875_c1_400_1032 191
10 3300050510 nmdc:mga06r32_133354_c1 nmdc:mga06r32_133354_c1_1772_2404 191
11 3300050511 nmdc:mga08y16_69250_c1 nmdc:mga08y16_69250_c1_1355_1987 191
12 3300005937 Ga0081455_10163236 Ga0081455_101632363 192
13 3300006051 Ga0075364_10304670 Ga0075364_103046702 192
14 3300042003 Ga0439443_032238 Ga0439443_032238_126_800 192
15 3300050494 nmdc:mga06z11_229377_c1 nmdc:mga06z11_229377_c1_458_1075 192
16 3300005459 Ga0068867_100003683 Ga0068867_1000036838 193
17 3300005937 Ga0081455_10094536 Ga0081455_100945363 193
18 3300005981 Ga0081538_10077500 Ga0081538_100775002 193
19 3300005983 Ga0081540_1000553 Ga0081540_100055344 193
20 3300005985 Ga0081539_10053821 Ga0081539_100538211 193
21 3300006051 Ga0075364_10147590 Ga0075364_101475903 193
22 3300009098 Ga0105245_10174160 Ga0105245_101741604 193
23 3300025927 Ga0207687_10110444 Ga0207687_101104444 193
24 3300026089 Ga0207648_10005232 Ga0207648_1000523212 193
25 3300037418 Ga0395900_0584307 Ga0395900_0584307_280_948 193
26 3300038443 Ga0395901_0045141 Ga0395901_0045141_832_1506 193
27 3300049576 Ga0501040_0254900 Ga0501040_0254900_557_1216 193
28 3300050491 nmdc:mga00v17_132396_c1 nmdc:mga00v17_132396_c1_726_1379 193
29 3300009551 Ga0105238_10231599 Ga0105238_102315993 194
30 3300025920 Ga0207649_10158646 Ga0207649_101586462 194
31 3300025924 Ga0207694_10452250 Ga0207694_104522502 194
32 3300035725 Ga0373947_0477718 Ga0373947_0477718_112_729 194
33 3300038443 Ga0395901_0699217 Ga0395901_0699217_175_792 194
34 3300046517 Ga0495630_0000395 Ga0495630_0000395_31858_32478 194
35 3300046529 Ga0495652_0319637 Ga0495652_0319637_154_774 194
36 3300046642 Ga0495634_0000993 Ga0495634_0000993_16789_17400 194
37 3300046642 Ga0495634_0133082 Ga0495634_0133082_621_1238 194
38 3300046678 Ga0495599_0290938 Ga0495599_0290938_62_682 194
39 3300047322 Ga0495680_0104929 Ga0495680_0104929_1020_1640 194
40 3300047471 Ga0495684_0101777 Ga0495684_0101777_1315_1932 194
41 3300053077 Ga0495601_0019078 Ga0495601_0019078_908_1528 194
42 3300053085 Ga0495619_0001068 Ga0495619_0001068_14612_15229 194
43 3300053085 Ga0495619_0003847 Ga0495619_0003847_7256_7876 194
44 3300060353 Ga0501082_0896419 Ga0501082_0896419_44_685 194
45 3300002074 JGI24748J21848_1000332 JGI24748J21848_10003325 195
46 3300002239 JGI24034J26672_10000068 JGI24034J26672_1000006826 195
47 3300002244 JGI24742J22300_10000389 JGI24742J22300_100003894 195
48 3300006038 Ga0075365_10233250 Ga0075365_102332502 195
49 3300006051 Ga0075364_10365607 Ga0075364_103656072 195
50 3300006358 Ga0068871_100525748 Ga0068871_1005257482 195
51 3300009148 Ga0105243_10171682 Ga0105243_101716823 195
52 3300050491 nmdc:mga00v17_322826_c1 nmdc:mga00v17_322826_c1_98_778 195
53 3300050491 nmdc:mga00v17_80265_c1 nmdc:mga00v17_80265_c1_515_1195 195
54 3300037466 Ga0395898_0352683 Ga0395898_0352683_18_644 196
55 3300048909 Ga0496106_0083694 Ga0496106_0083694_1419_2144 196
56 3300005331 Ga0070670_101031762 Ga0070670_1010317621 198
57 3300005338 Ga0068868_100862139 Ga0068868_1008621392 198
58 3300005564 Ga0070664_100633711 Ga0070664_1006337111 198
59 3300013297 Ga0157378_10297293 Ga0157378_102972933 198
60 3300014325 Ga0163163_10461850 Ga0163163_104618503 198
61 3300014969 Ga0157376_10028182 Ga0157376_100281826 198
62 3300025925 Ga0207650_10667621 Ga0207650_106676212 198
63 3300025945 Ga0207679_10064235 Ga0207679_100642353 198
64 3300037471 Ga0395905_0441187 Ga0395905_0441187_356_967 198
65 3300037471 Ga0395905_0712536 Ga0395905_0712536_189_800 198
66 3300038443 Ga0395901_0252586 Ga0395901_0252586_941_1552 198
67 3300048908 Ga0496105_0055620 Ga0496105_0055620_1466_2092 198
68 3300048912 Ga0496109_0199889 Ga0496109_0199889_1186_1797 198
69 3300048912 Ga0496109_0213119 Ga0496109_0213119_965_1576 198
70 3300048913 Ga0496110_0049274 Ga0496110_0049274_1307_1918 198
71 3300048915 Ga0496112_0725603 Ga0496112_0725603_202_813 198
72 3300048916 Ga0496113_0231495 Ga0496113_0231495_175_786 198
73 3300048922 Ga0496119_0011836 Ga0496119_0011836_1325_1951 198
74 3300048924 Ga0496121_0042207 Ga0496121_0042207_2218_2844 198
75 3300048928 Ga0496125_0149885 Ga0496125_0149885_718_1344 198
76 3300049572 Ga0501036_0583032 Ga0501036_0583032_200_880 198
77 3300049586 Ga0501070_0801896 Ga0501070_0801896_17_643 198
78 3300049590 Ga0501074_0361301 Ga0501074_0361301_249_935 198
79 3300049822 Ga0501035_0537841 Ga0501035_0537841_102_728 198
80 3300050510 nmdc:mga06r32_115058_c1 nmdc:mga06r32_115058_c1_1901_2509 198
81 3300005549 Ga0070704_100451731 Ga0070704_1004517311 199
82 3300048912 Ga0496109_0047839 Ga0496109_0047839_2671_3396 199
83 3300005441 Ga0070700_100657995 Ga0070700_1006579951 201
84 3300005614 Ga0068856_100007453 Ga0068856_1000074535 201
85 3300005719 Ga0068861_100328039 Ga0068861_1003280391 201
86 3300005937 Ga0081455_10010355 Ga0081455_100103557 201
87 3300006048 Ga0075363_100165933 Ga0075363_1001659332 201
88 3300026078 Ga0207702_10006219 Ga0207702_1000621912 201
89 3300046683 Ga0495658_0001193 Ga0495658_0001193_1307_1918 201
90 3300048911 Ga0496108_0000042 Ga0496108_0000042_126314_126925 201
91 3300048912 Ga0496109_0000034 Ga0496109_0000034_158953_159564 201
92 3300049591 Ga0501075_0157968 Ga0501075_0157968_89_823 201
93 3300049822 Ga0501035_0568219 Ga0501035_0568219_134_868 201
94 3300054114 Ga0501084_0290107 Ga0501084_0290107_113_847 201
95 3300003373 JGI25407J50210_10001250 JGI25407J50210_100012503 202
96 3300003373 JGI25407J50210_10002048 JGI25407J50210_100020486 202
97 3300003373 JGI25407J50210_10002196 JGI25407J50210_100021961 202
98 3300003373 JGI25407J50210_10007914 JGI25407J50210_100079143 202
99 3300005329 Ga0070683_100620967 Ga0070683_1006209672 202
100 3300005331 Ga0070670_100085569 Ga0070670_1000855694 202
101 3300005336 Ga0070680_100002655 Ga0070680_1000026559 202
102 3300005344 Ga0070661_100082633 Ga0070661_1000826335 202
103 3300005345 Ga0070692_10087921 Ga0070692_100879212 202
104 3300005345 Ga0070692_10506087 Ga0070692_105060871 202
105 3300005347 Ga0070668_100198128 Ga0070668_1001981282 202
106 3300005356 Ga0070674_100003700 Ga0070674_1000037004 202
107 3300005365 Ga0070688_100002914 Ga0070688_1000029146 202
108 3300005366 Ga0070659_100004067 Ga0070659_1000040675 202
109 3300005367 Ga0070667_100001611 Ga0070667_10000161128 202
110 3300005441 Ga0070700_100279103 Ga0070700_1002791033 202
111 3300005441 Ga0070700_100422397 Ga0070700_1004223971 202
112 3300005455 Ga0070663_100354826 Ga0070663_1003548261 202
113 3300005458 Ga0070681_10002266 Ga0070681_1000226613 202
114 3300005458 Ga0070681_10240863 Ga0070681_102408633 202
115 3300005459 Ga0068867_100389792 Ga0068867_1003897922 202
116 3300005466 Ga0070685_10001772 Ga0070685_100017725 202
117 3300005530 Ga0070679_100036793 Ga0070679_1000367935 202
118 3300005535 Ga0070684_100024708 Ga0070684_1000247084 202
119 3300005535 Ga0070684_100115588 Ga0070684_1001155884 202
120 3300005539 Ga0068853_100005341 Ga0068853_1000053413 202
121 3300005548 Ga0070665_100851965 Ga0070665_1008519652 202
122 3300005564 Ga0070664_100083028 Ga0070664_1000830282 202
123 3300005578 Ga0068854_100151099 Ga0068854_1001510993 202
124 3300005578 Ga0068854_100846022 Ga0068854_1008460222 202
125 3300005614 Ga0068856_100031746 Ga0068856_1000317464 202
126 3300005614 Ga0068856_100174723 Ga0068856_1001747232 202
127 3300005615 Ga0070702_100599186 Ga0070702_1005991861 202
128 3300005616 Ga0068852_100001042 Ga0068852_10000104217 202
129 3300005616 Ga0068852_100050655 Ga0068852_1000506554 202
130 3300005719 Ga0068861_100155163 Ga0068861_1001551633 202
131 3300005843 Ga0068860_100166222 Ga0068860_1001662223 202
132 3300005844 Ga0068862_100001247 Ga0068862_10000124728 202
133 3300005844 Ga0068862_101052156 Ga0068862_1010521561 202
134 3300005937 Ga0081455_10011092 Ga0081455_1001109219 202
135 3300005937 Ga0081455_10257704 Ga0081455_102577042 202
136 3300005937 Ga0081455_10268855 Ga0081455_102688552 202
137 3300005937 Ga0081455_10295633 Ga0081455_102956332 202
138 3300005981 Ga0081538_10001771 Ga0081538_1000177120 202
139 3300005981 Ga0081538_10003058 Ga0081538_100030589 202
140 3300005981 Ga0081538_10003213 Ga0081538_1000321312 202
141 3300005981 Ga0081538_10004998 Ga0081538_100049986 202
142 3300005981 Ga0081538_10005868 Ga0081538_1000586813 202
143 3300005981 Ga0081538_10008306 Ga0081538_1000830617 202
144 3300005981 Ga0081538_10031989 Ga0081538_100319896 202
145 3300005981 Ga0081538_10044033 Ga0081538_100440335 202
146 3300005981 Ga0081538_10059993 Ga0081538_100599933 202
147 3300005981 Ga0081538_10084777 Ga0081538_100847772 202
148 3300005981 Ga0081538_10085553 Ga0081538_100855531 202
149 3300005981 Ga0081538_10133600 Ga0081538_101336002 202
150 3300005981 Ga0081538_10148825 Ga0081538_101488252 202
151 3300006038 Ga0075365_10000565 Ga0075365_100005655 202
152 3300006051 Ga0075364_10020535 Ga0075364_100205353 202
153 3300006178 Ga0075367_10174856 Ga0075367_101748562 202
154 3300006844 Ga0075428_100059133 Ga0075428_1000591336 202
155 3300006844 Ga0075428_100456441 Ga0075428_1004564411 202
156 3300006846 Ga0075430_100016384 Ga0075430_1000163846 202
157 3300006847 Ga0075431_100271416 Ga0075431_1002714163 202
158 3300006880 Ga0075429_100121873 Ga0075429_1001218731 202
159 3300006881 Ga0068865_100000056 Ga0068865_10000005617 202
160 3300009093 Ga0105240_10067591 Ga0105240_100675916 202
161 3300009094 Ga0111539_10239303 Ga0111539_102393034 202
162 3300009094 Ga0111539_10243969 Ga0111539_102439693 202
163 3300009094 Ga0111539_10466319 Ga0111539_104663192 202
164 3300009098 Ga0105245_10000528 Ga0105245_1000052845 202
165 3300009098 Ga0105245_10725480 Ga0105245_107254802 202
166 3300009147 Ga0114129_10094967 Ga0114129_100949675 202
167 3300009147 Ga0114129_10127157 Ga0114129_101271574 202
168 3300009147 Ga0114129_10165092 Ga0114129_101650922 202
169 3300009147 Ga0114129_11133455 Ga0114129_111334552 202
170 3300009148 Ga0105243_10200695 Ga0105243_102006953 202
171 3300009148 Ga0105243_10367335 Ga0105243_103673352 202
172 3300009177 Ga0105248_10001735 Ga0105248_1000173525 202
173 3300009553 Ga0105249_10003640 Ga0105249_100036405 202
174 3300010375 Ga0105239_10965151 Ga0105239_109651511 202
175 3300011119 Ga0105246_10175137 Ga0105246_101751373 202
176 3300013104 Ga0157370_10005533 Ga0157370_1000553312 202
177 3300013105 Ga0157369_10000068 Ga0157369_10000068153 202
178 3300013105 Ga0157369_10066099 Ga0157369_100660992 202
179 3300013307 Ga0157372_10007045 Ga0157372_1000704512 202
180 3300014968 Ga0157379_10087707 Ga0157379_100877073 202
181 3300014969 Ga0157376_10164943 Ga0157376_101649433 202
182 3300017792 Ga0163161_10054996 Ga0163161_100549962 202
183 3300020069 Ga0197907_10671781 Ga0197907_106717812 202
184 3300020070 Ga0206356_11300597 Ga0206356_113005972 202
185 3300020082 Ga0206353_11509509 Ga0206353_115095097 202
186 3300025911 Ga0207654_10054051 Ga0207654_100540513 202
187 3300025912 Ga0207707_10005637 Ga0207707_1000563721 202
188 3300025913 Ga0207695_10251205 Ga0207695_102512051 202
189 3300025913 Ga0207695_10479024 Ga0207695_104790242 202
190 3300025917 Ga0207660_10023884 Ga0207660_100238845 202
191 3300025920 Ga0207649_10057089 Ga0207649_100570894 202
192 3300025921 Ga0207652_10009613 Ga0207652_100096135 202
193 3300025921 Ga0207652_10168460 Ga0207652_101684602 202
194 3300025925 Ga0207650_10043384 Ga0207650_100433846 202
195 3300025927 Ga0207687_10000025 Ga0207687_1000002511 202
196 3300025927 Ga0207687_10206679 Ga0207687_102066793 202
197 3300025932 Ga0207690_10001935 Ga0207690_100019356 202
198 3300025935 Ga0207709_10319971 Ga0207709_103199711 202
199 3300025937 Ga0207669_10005898 Ga0207669_100058988 202
200 3300025937 Ga0207669_10329950 Ga0207669_103299502 202
201 3300025938 Ga0207704_10011990 Ga0207704_100119904 202
202 3300025941 Ga0207711_10000011 Ga0207711_1000001124 202
203 3300025944 Ga0207661_10002381 Ga0207661_1000238112 202
204 3300025944 Ga0207661_10002385 Ga0207661_100023855 202
205 3300025945 Ga0207679_10069455 Ga0207679_100694556 202
206 3300025945 Ga0207679_10312940 Ga0207679_103129402 202
207 3300025961 Ga0207712_10003459 Ga0207712_1000345917 202
208 3300025972 Ga0207668_10002563 Ga0207668_100025632 202
209 3300025972 Ga0207668_10173476 Ga0207668_101734762 202
210 3300025986 Ga0207658_10000840 Ga0207658_1000084010 202
211 3300026041 Ga0207639_10026393 Ga0207639_100263932 202
212 3300026067 Ga0207678_10155956 Ga0207678_101559562 202
213 3300026075 Ga0207708_10243745 Ga0207708_102437452 202
214 3300026078 Ga0207702_10015335 Ga0207702_100153354 202
215 3300026078 Ga0207702_10135029 Ga0207702_101350292 202
216 3300026089 Ga0207648_10066179 Ga0207648_100661793 202
217 3300026089 Ga0207648_11012616 Ga0207648_110126162 202
218 3300026118 Ga0207675_100087831 Ga0207675_1000878313 202
219 3300026118 Ga0207675_100862903 Ga0207675_1008629032 202
220 3300026118 Ga0207675_100941842 Ga0207675_1009418422 202
221 3300026142 Ga0207698_10000014 Ga0207698_1000001442 202
222 3300026142 Ga0207698_10054216 Ga0207698_100542164 202
223 3300027907 Ga0207428_10039587 Ga0207428_100395872 202
224 3300028380 Ga0268265_10005115 Ga0268265_100051157 202
225 3300028380 Ga0268265_10944848 Ga0268265_109448482 202
226 3300028381 Ga0268264_10023259 Ga0268264_100232593 202
227 3300031731 Ga0307405_10095388 Ga0307405_100953883 202
228 3300031731 Ga0307405_10814437 Ga0307405_108144372 202
229 3300031824 Ga0307413_10494430 Ga0307413_104944302 202
230 3300031903 Ga0307407_10326879 Ga0307407_103268792 202
231 3300031995 Ga0307409_100117811 Ga0307409_1001178113 202
232 3300031995 Ga0307409_100245144 Ga0307409_1002451443 202
233 3300031995 Ga0307409_100465396 Ga0307409_1004653962 202
234 3300032002 Ga0307416_100619015 Ga0307416_1006190152 202
235 3300032126 Ga0307415_100752719 Ga0307415_1007527192 202
236 3300035121 Ga0373960_0005767 Ga0373960_0005767_670_1293 202
237 3300035242 Ga0373962_0022030 Ga0373962_0022030_77_700 202
238 3300038443 Ga0395901_0100695 Ga0395901_0100695_1376_1999 202
239 3300038443 Ga0395901_0399211 Ga0395901_0399211_100_744 202
240 3300042005 Ga0439448_0096937 Ga0439448_0096937_19_642 202
241 3300042439 Ga0439464_0012359 Ga0439464_0012359_1284_1907 202
242 3300044694 Ga0466963_0390591 Ga0466963_0390591_194_808 202
243 3300045976 Ga0466967_0900267 Ga0466967_0900267_14_649 202
244 3300046492 Ga0495585_0154277 Ga0495585_0154277_366_989 202
245 3300046500 Ga0495596_0039775 Ga0495596_0039775_82_705 202
246 3300046500 Ga0495596_0048803 Ga0495596_0048803_211_825 202
247 3300046518 Ga0495631_0074288 Ga0495631_0074288_20_643 202
248 3300046520 Ga0495637_0075343 Ga0495637_0075343_168_791 202
249 3300046523 Ga0495644_0170311 Ga0495644_0170311_56_679 202
250 3300046523 Ga0495644_0233003 Ga0495644_0233003_58_681 202
251 3300046558 Ga0495633_0118628 Ga0495633_0118628_361_984 202
252 3300046794 Ga0495589_0073363 Ga0495589_0073363_767_1390 202
253 3300048913 Ga0496110_0330688 Ga0496110_0330688_510_1124 202
254 3300049568 Ga0501031_0233054 Ga0501031_0233054_455_1078 202
255 3300049570 Ga0501033_0386891 Ga0501033_0386891_336_959 202
256 3300049572 Ga0501036_0137584 Ga0501036_0137584_369_992 202
257 3300049575 Ga0501039_0074862 Ga0501039_0074862_1667_2290 202
258 3300049576 Ga0501040_0032892 Ga0501040_0032892_1289_1912 202
259 3300049577 Ga0501041_0041348 Ga0501041_0041348_732_1355 202
260 3300049578 Ga0501042_0033767 Ga0501042_0033767_2429_3052 202
261 3300049578 Ga0501042_0062229 Ga0501042_0062229_1237_1860 202
262 3300049581 Ga0501047_0061590 Ga0501047_0061590_1965_2606 202
263 3300049582 Ga0501048_0050531 Ga0501048_0050531_527_1150 202
264 3300049582 Ga0501048_0523487 Ga0501048_0523487_33_656 202
265 3300049583 Ga0501067_0150215 Ga0501067_0150215_213_836 202
266 3300049587 Ga0501071_0100086 Ga0501071_0100086_670_1311 202
267 3300049587 Ga0501071_0240516 Ga0501071_0240516_345_968 202
268 3300049590 Ga0501074_0097828 Ga0501074_0097828_449_1090 202
269 3300049590 Ga0501074_0359990 Ga0501074_0359990_88_711 202
270 3300049591 Ga0501075_0151092 Ga0501075_0151092_585_1208 202
271 3300049741 Ga0501079_0049546 Ga0501079_0049546_2441_3064 202
272 3300049741 Ga0501079_0399968 Ga0501079_0399968_111_734 202
273 3300049741 Ga0501079_0596192 Ga0501079_0596192_26_667 202
274 3300049742 Ga0501080_0458977 Ga0501080_0458977_26_667 202
275 3300049743 Ga0501081_0072804 Ga0501081_0072804_448_1071 202
276 3300049743 Ga0501081_0087548 Ga0501081_0087548_70_693 202
277 3300049744 Ga0501083_0025951 Ga0501083_0025951_3258_3899 202
278 3300049823 Ga0501044_0021243 Ga0501044_0021243_970_1611 202
279 3300049824 Ga0501045_0046940 Ga0501045_0046940_1921_2544 202
280 3300049824 Ga0501045_0158213 Ga0501045_0158213_231_854 202
281 3300050491 nmdc:mga00v17_301783_c1 nmdc:mga00v17_301783_c1_16_657 202
282 3300050491 nmdc:mga00v17_91224_c1 nmdc:mga00v17_91224_c1_246_881 202
283 3300050492 nmdc:mga0yw44_1227_c1 nmdc:mga0yw44_1227_c1_6833_7468 202
284 3300050494 nmdc:mga06z11_175335_c1 nmdc:mga06z11_175335_c1_160_783 202
285 3300050507 nmdc:mga05p37_160309_c1 nmdc:mga05p37_160309_c1_1600_2223 202
286 3300050507 nmdc:mga05p37_576969_c1 nmdc:mga05p37_576969_c1_584_1207 202
287 3300050507 nmdc:mga05p37_922316_c1 nmdc:mga05p37_922316_c1_116_739 202
288 3300050508 nmdc:mga09592_20196_c1 nmdc:mga09592_20196_c1_62_718 202
289 3300050508 nmdc:mga09592_366988_c1 nmdc:mga09592_366988_c1_461_1084 202
290 3300050509 nmdc:mga0qj67_251293_c1 nmdc:mga0qj67_251293_c1_598_1254 202
291 3300050510 nmdc:mga06r32_137843_c1 nmdc:mga06r32_137843_c1_681_1337 202
292 3300050510 nmdc:mga06r32_491359_c1 nmdc:mga06r32_491359_c1_280_903 202
293 3300050511 nmdc:mga08y16_212067_c1 nmdc:mga08y16_212067_c1_266_889 202
294 3300050511 nmdc:mga08y16_336891_c1 nmdc:mga08y16_336891_c1_820_1443 202
295 3300050511 nmdc:mga08y16_66629_c1 nmdc:mga08y16_66629_c1_2277_2900 202
296 3300050512 nmdc:mga0n895_241244_c1 nmdc:mga0n895_241244_c1_909_1532 202
297 3300050515 nmdc:mga0a205_101539_c1 nmdc:mga0a205_101539_c1_1865_2488 202
298 3300050515 nmdc:mga0a205_226631_c1 nmdc:mga0a205_226631_c1_858_1481 202
299 3300054114 Ga0501084_0107519 Ga0501084_0107519_229_852 202
300 3300059421 Ga0590071_010548 Ga0590071_010548_1033_1656 202
301 3300060353 Ga0501082_0089866 Ga0501082_0089866_235_858 202
302 3300060353 Ga0501082_0201129 Ga0501082_0201129_197_820 202
303 3300061734 Ga0530510_0009741 Ga0530510_0009741_3662_4285 202
304 3300001979 JGI24740J21852_10003124 JGI24740J21852_1000312412 203
305 3300005329 Ga0070683_100138936 Ga0070683_1001389363 203
306 3300005329 Ga0070683_100774059 Ga0070683_1007740592 203
307 3300005330 Ga0070690_100269847 Ga0070690_1002698473 203
308 3300005330 Ga0070690_100453756 Ga0070690_1004537561 203
309 3300005335 Ga0070666_10019547 Ga0070666_100195476 203
310 3300005335 Ga0070666_10696449 Ga0070666_106964491 203
311 3300005337 Ga0070682_100015047 Ga0070682_1000150473 203
312 3300005337 Ga0070682_100106785 Ga0070682_1001067853 203
313 3300005337 Ga0070682_100125847 Ga0070682_1001258472 203
314 3300005338 Ga0068868_100009889 Ga0068868_1000098895 203
315 3300005338 Ga0068868_100269192 Ga0068868_1002691923 203
316 3300005340 Ga0070689_100128041 Ga0070689_1001280413 203
317 3300005341 Ga0070691_10000257 Ga0070691_1000025710 203
318 3300005344 Ga0070661_100000236 Ga0070661_10000023639 203
319 3300005354 Ga0070675_100000930 Ga0070675_10000093011 203
320 3300005366 Ga0070659_100013450 Ga0070659_1000134504 203
321 3300005367 Ga0070667_100287165 Ga0070667_1002871652 203
322 3300005435 Ga0070714_100583970 Ga0070714_1005839701 203
323 3300005436 Ga0070713_100000171 Ga0070713_10000017157 203
324 3300005439 Ga0070711_100053395 Ga0070711_1000533954 203
325 3300005444 Ga0070694_100097215 Ga0070694_1000972151 203
326 3300005455 Ga0070663_100083061 Ga0070663_1000830613 203
327 3300005455 Ga0070663_100266823 Ga0070663_1002668232 203
328 3300005456 Ga0070678_100021818 Ga0070678_1000218185 203
329 3300005456 Ga0070678_100089186 Ga0070678_1000891863 203
330 3300005459 Ga0068867_100227734 Ga0068867_1002277342 203
331 3300005466 Ga0070685_10066247 Ga0070685_100662472 203
332 3300005466 Ga0070685_10183462 Ga0070685_101834622 203
333 3300005466 Ga0070685_10218804 Ga0070685_102188042 203
334 3300005530 Ga0070679_100000832 Ga0070679_10000083235 203
335 3300005535 Ga0070684_100697080 Ga0070684_1006970801 203
336 3300005543 Ga0070672_100000104 Ga0070672_10000010437 203
337 3300005544 Ga0070686_100036335 Ga0070686_1000363352 203
338 3300005544 Ga0070686_100172281 Ga0070686_1001722812 203
339 3300005545 Ga0070695_100128981 Ga0070695_1001289812 203
340 3300005548 Ga0070665_100777443 Ga0070665_1007774431 203
341 3300005548 Ga0070665_101137954 Ga0070665_1011379542 203
342 3300005549 Ga0070704_100414054 Ga0070704_1004140542 203
343 3300005564 Ga0070664_100027426 Ga0070664_1000274265 203
344 3300005578 Ga0068854_100014383 Ga0068854_1000143839 203
345 3300005578 Ga0068854_100414314 Ga0068854_1004143142 203
346 3300005614 Ga0068856_100816683 Ga0068856_1008166831 203
347 3300005615 Ga0070702_100204009 Ga0070702_1002040093 203
348 3300005615 Ga0070702_100580723 Ga0070702_1005807231 203
349 3300005616 Ga0068852_100048086 Ga0068852_1000480865 203
350 3300005617 Ga0068859_100398541 Ga0068859_1003985412 203
351 3300005718 Ga0068866_10140603 Ga0068866_101406032 203
352 3300005719 Ga0068861_100518363 Ga0068861_1005183632 203
353 3300005834 Ga0068851_10004857 Ga0068851_100048576 203
354 3300005834 Ga0068851_10047591 Ga0068851_100475914 203
355 3300005840 Ga0068870_10481152 Ga0068870_104811521 203
356 3300005843 Ga0068860_100492719 Ga0068860_1004927193 203
357 3300005937 Ga0081455_10030723 Ga0081455_100307235 203
358 3300005937 Ga0081455_10063369 Ga0081455_100633693 203
359 3300005981 Ga0081538_10000396 Ga0081538_100003968 203
360 3300005981 Ga0081538_10028056 Ga0081538_100280566 203
361 3300005983 Ga0081540_1082547 Ga0081540_10825472 203
362 3300005985 Ga0081539_10002195 Ga0081539_1000219513 203
363 3300006038 Ga0075365_10009057 Ga0075365_100090574 203
364 3300006051 Ga0075364_10055344 Ga0075364_100553445 203
365 3300006163 Ga0070715_10205567 Ga0070715_102055672 203
366 3300006173 Ga0070716_100135126 Ga0070716_1001351262 203
367 3300006175 Ga0070712_100003252 Ga0070712_10000325219 203
368 3300006175 Ga0070712_100014893 Ga0070712_1000148935 203
369 3300006844 Ga0075428_100022531 Ga0075428_1000225316 203
370 3300006847 Ga0075431_100008449 Ga0075431_10000844920 203
371 3300006931 Ga0097620_100398531 Ga0097620_1003985312 203
372 3300009094 Ga0111539_10094044 Ga0111539_100940444 203
373 3300009094 Ga0111539_10157492 Ga0111539_101574922 203
374 3300009098 Ga0105245_10014245 Ga0105245_100142456 203
375 3300009098 Ga0105245_10275687 Ga0105245_102756873 203
376 3300009098 Ga0105245_10427748 Ga0105245_104277482 203
377 3300009101 Ga0105247_10000064 Ga0105247_10000064130 203
378 3300009101 Ga0105247_10056313 Ga0105247_100563133 203
379 3300009147 Ga0114129_10050964 Ga0114129_100509645 203
380 3300009147 Ga0114129_10529424 Ga0114129_105294243 203
381 3300009148 Ga0105243_10080350 Ga0105243_100803503 203
382 3300009148 Ga0105243_10144764 Ga0105243_101447642 203
383 3300009176 Ga0105242_10000123 Ga0105242_100001234 203
384 3300009176 Ga0105242_10003277 Ga0105242_1000327722 203
385 3300009176 Ga0105242_10044398 Ga0105242_100443983 203
386 3300009177 Ga0105248_10074556 Ga0105248_100745564 203
387 3300009553 Ga0105249_10374126 Ga0105249_103741262 203
388 3300011119 Ga0105246_10974260 Ga0105246_109742602 203
389 3300013102 Ga0157371_10358486 Ga0157371_103584862 203
390 3300013104 Ga0157370_10059005 Ga0157370_100590056 203
391 3300013104 Ga0157370_10132352 Ga0157370_101323522 203
392 3300013297 Ga0157378_10030690 Ga0157378_100306906 203
393 3300013297 Ga0157378_10258957 Ga0157378_102589572 203
394 3300013306 Ga0163162_10322361 Ga0163162_103223613 203
395 3300013307 Ga0157372_10000809 Ga0157372_100008094 203
396 3300013308 Ga0157375_10008331 Ga0157375_100083315 203
397 3300013308 Ga0157375_10237203 Ga0157375_102372032 203
398 3300014325 Ga0163163_10197122 Ga0163163_101971222 203
399 3300014325 Ga0163163_10536951 Ga0163163_105369512 203
400 3300014326 Ga0157380_10000808 Ga0157380_1000080812 203
401 3300014326 Ga0157380_10550426 Ga0157380_105504262 203
402 3300014968 Ga0157379_10138083 Ga0157379_101380831 203
403 3300014969 Ga0157376_10483943 Ga0157376_104839432 203
404 3300017792 Ga0163161_10054161 Ga0163161_100541614 203
405 3300020081 Ga0206354_11524261 Ga0206354_115242611 203
406 3300025321 Ga0207656_10004334 Ga0207656_100043345 203
407 3300025898 Ga0207692_10132901 Ga0207692_101329013 203
408 3300025899 Ga0207642_10019085 Ga0207642_100190854 203
409 3300025900 Ga0207710_10000220 Ga0207710_1000022030 203
410 3300025900 Ga0207710_10015681 Ga0207710_100156812 203
411 3300025901 Ga0207688_10026332 Ga0207688_100263326 203
412 3300025903 Ga0207680_10024081 Ga0207680_100240814 203
413 3300025905 Ga0207685_10089012 Ga0207685_100890122 203
414 3300025912 Ga0207707_10048171 Ga0207707_100481715 203
415 3300025915 Ga0207693_10001647 Ga0207693_1000164717 203
416 3300025915 Ga0207693_10002588 Ga0207693_1000258812 203
417 3300025916 Ga0207663_10037091 Ga0207663_100370912 203
418 3300025920 Ga0207649_10000388 Ga0207649_1000038832 203
419 3300025921 Ga0207652_10000666 Ga0207652_1000066627 203
420 3300025926 Ga0207659_10000138 Ga0207659_1000013853 203
421 3300025927 Ga0207687_10005977 Ga0207687_100059776 203
422 3300025927 Ga0207687_10259197 Ga0207687_102591972 203
423 3300025927 Ga0207687_10310645 Ga0207687_103106452 203
424 3300025928 Ga0207700_10000019 Ga0207700_10000019195 203
425 3300025929 Ga0207664_10104740 Ga0207664_101047404 203
426 3300025932 Ga0207690_10008867 Ga0207690_100088675 203
427 3300025934 Ga0207686_10000066 Ga0207686_10000066102 203
428 3300025934 Ga0207686_10001614 Ga0207686_100016143 203
429 3300025935 Ga0207709_10040649 Ga0207709_100406493 203
430 3300025935 Ga0207709_10387641 Ga0207709_103876412 203
431 3300025936 Ga0207670_10108744 Ga0207670_101087443 203
432 3300025939 Ga0207665_10019306 Ga0207665_100193066 203
433 3300025940 Ga0207691_10000430 Ga0207691_1000043037 203
434 3300025944 Ga0207661_10058350 Ga0207661_100583503 203
435 3300025944 Ga0207661_10107996 Ga0207661_101079965 203
436 3300025944 Ga0207661_10653359 Ga0207661_106533592 203
437 3300025945 Ga0207679_10135579 Ga0207679_101355791 203
438 3300025961 Ga0207712_10124409 Ga0207712_101244093 203
439 3300025961 Ga0207712_10129766 Ga0207712_101297662 203
440 3300025961 Ga0207712_10281223 Ga0207712_102812232 203
441 3300025981 Ga0207640_10000691 Ga0207640_1000069110 203
442 3300025981 Ga0207640_10956987 Ga0207640_109569871 203
443 3300025986 Ga0207658_10122209 Ga0207658_101222093 203
444 3300026023 Ga0207677_10056601 Ga0207677_100566012 203
445 3300026041 Ga0207639_10923962 Ga0207639_109239622 203
446 3300026067 Ga0207678_10002630 Ga0207678_100026304 203
447 3300026075 Ga0207708_10224638 Ga0207708_102246382 203
448 3300026078 Ga0207702_11328433 Ga0207702_113284331 203
449 3300026121 Ga0207683_10029338 Ga0207683_100293383 203
450 3300026121 Ga0207683_10051534 Ga0207683_100515343 203
451 3300026142 Ga0207698_10021851 Ga0207698_100218514 203
452 3300028379 Ga0268266_10005543 Ga0268266_1000554320 203
453 3300028379 Ga0268266_10985844 Ga0268266_109858441 203
454 3300028558 Ga0265326_10020928 Ga0265326_100209282 203
455 3300028563 Ga0265319_1000030 Ga0265319_100003035 203
456 3300028666 Ga0265336_10120476 Ga0265336_101204761 203
457 3300028800 Ga0265338_10000156 Ga0265338_1000015635 203
458 3300031241 Ga0265325_10005113 Ga0265325_100051139 203
459 3300031456 Ga0307513_10200086 Ga0307513_102000863 203
460 3300031852 Ga0307410_10517636 Ga0307410_105176362 203
461 3300032002 Ga0307416_101232801 Ga0307416_1012328012 203
462 3300035241 Ga0373961_0103147 Ga0373961_0103147_133_771 203
463 3300036401 Ga0373937_0354465 Ga0373937_0354465_181_792 203
464 3300037312 Ga0395899_0444047 Ga0395899_0444047_167_829 203
465 3300037466 Ga0395898_0017781 Ga0395898_0017781_2466_3104 203
466 3300037466 Ga0395898_0024801 Ga0395898_0024801_4586_5224 203
467 3300037466 Ga0395898_0974445 Ga0395898_0974445_140_772 203
468 3300037471 Ga0395905_0013334 Ga0395905_0013334_2962_3600 203
469 3300038443 Ga0395901_0011288 Ga0395901_0011288_7524_8162 203
470 3300038443 Ga0395901_0012327 Ga0395901_0012327_2526_3164 203
471 3300041505 Ga0451849_1549853 Ga0451849_1549853_546_1157 203
472 3300044694 Ga0466963_0414124 Ga0466963_0414124_94_705 203
473 3300044842 Ga0466957_0001797 Ga0466957_0001797_4516_5133 203
474 3300044842 Ga0466957_0047130 Ga0466957_0047130_963_1574 203
475 3300044842 Ga0466957_0312582 Ga0466957_0312582_327_938 203
476 3300045836 Ga0466958_0043454 Ga0466958_0043454_1304_1921 203
477 3300045976 Ga0466967_0000003 Ga0466967_0000003_46142_46753 203
478 3300045976 Ga0466967_0078881 Ga0466967_0078881_1531_2145 203
479 3300046459 Ga0495629_0000543 Ga0495629_0000543_6316_6927 203
480 3300046459 Ga0495629_0004371 Ga0495629_0004371_1370_1981 203
481 3300046459 Ga0495629_0012223 Ga0495629_0012223_1399_2010 203
482 3300046460 Ga0495638_0020983 Ga0495638_0020983_1112_1723 203
483 3300046461 Ga0495641_0085891 Ga0495641_0085891_718_1329 203
484 3300046473 Ga0495582_0092785 Ga0495582_0092785_861_1499 203
485 3300046476 Ga0495662_0013224 Ga0495662_0013224_117_728 203
486 3300046507 Ga0495606_0000283 Ga0495606_0000283_65511_66122 203
487 3300046511 Ga0495608_0000010 Ga0495608_0000010_235831_236442 203
488 3300046514 Ga0495618_0273469 Ga0495618_0273469_241_855 203
489 3300046516 Ga0495628_0000864 Ga0495628_0000864_12330_12941 203
490 3300046517 Ga0495630_0000148 Ga0495630_0000148_52085_52696 203
491 3300046525 Ga0495663_0028842 Ga0495663_0028842_350_961 203
492 3300046529 Ga0495652_0000009 Ga0495652_0000009_234496_235107 203
493 3300046536 Ga0495587_0262530 Ga0495587_0262530_185_796 203
494 3300046543 Ga0495645_0018112 Ga0495645_0018112_2205_2819 203
495 3300046660 Ga0495625_0000109 Ga0495625_0000109_88614_89225 203
496 3300046674 Ga0495588_0000175 Ga0495588_0000175_34212_34826 203
497 3300046675 Ga0495657_0000005 Ga0495657_0000005_18419_19030 203
498 3300046681 Ga0495647_0000114 Ga0495647_0000114_18230_18841 203
499 3300046689 Ga0495613_0000087 Ga0495613_0000087_72082_72693 203
500 3300046690 Ga0495624_0000429 Ga0495624_0000429_24344_24955 203
501 3300046809 Ga0495600_0072600 Ga0495600_0072600_91_702 203
502 3300047317 Ga0495604_0000322 Ga0495604_0000322_27723_28334 203
503 3300047321 Ga0495676_0000522 Ga0495676_0000522_1661_2272 203
504 3300047321 Ga0495676_0046499 Ga0495676_0046499_1985_2623 203
505 3300047322 Ga0495680_0009545 Ga0495680_0009545_7715_8326 203
506 3300047444 Ga0495675_0000398 Ga0495675_0000398_14597_15208 203
507 3300047673 Ga0495593_0134286 Ga0495593_0134286_618_1229 203
508 3300048088 Ga0495602_0000038 Ga0495602_0000038_13989_14600 203
509 3300048088 Ga0495602_0003702 Ga0495602_0003702_153_764 203
510 3300048088 Ga0495602_0098658 Ga0495602_0098658_1473_2090 203
511 3300048903 Ga0496100_0000028 Ga0496100_0000028_103256_103867 203
512 3300048903 Ga0496100_0005219 Ga0496100_0005219_3455_4093 203
513 3300048904 Ga0496101_0000005 Ga0496101_0000005_253255_253866 203
514 3300048904 Ga0496101_0046252 Ga0496101_0046252_810_1448 203
515 3300048905 Ga0496102_0000021 Ga0496102_0000021_180999_181610 203
516 3300048905 Ga0496102_0006894 Ga0496102_0006894_2858_3496 203
517 3300048905 Ga0496102_0404993 Ga0496102_0404993_147_791 203
518 3300048905 Ga0496102_0457202 Ga0496102_0457202_94_738 203
519 3300048906 Ga0496103_0000001 Ga0496103_0000001_414297_414908 203
520 3300048906 Ga0496103_0006645 Ga0496103_0006645_2994_3632 203
521 3300048906 Ga0496103_0194384 Ga0496103_0194384_333_977 203
522 3300048907 Ga0496104_0000029 Ga0496104_0000029_193881_194492 203
523 3300048907 Ga0496104_0007889 Ga0496104_0007889_2218_2856 203
524 3300048908 Ga0496105_0000002 Ga0496105_0000002_193881_194492 203
525 3300048908 Ga0496105_0044587 Ga0496105_0044587_1358_1969 203
526 3300048909 Ga0496106_0000070 Ga0496106_0000070_72152_72763 203
527 3300048909 Ga0496106_0001451 Ga0496106_0001451_12348_12986 203
528 3300048910 Ga0496107_0000004 Ga0496107_0000004_253472_254083 203
529 3300048910 Ga0496107_0003754 Ga0496107_0003754_1422_2060 203
530 3300048910 Ga0496107_0102247 Ga0496107_0102247_1168_1893 203
531 3300048911 Ga0496108_0050264 Ga0496108_0050264_2151_2789 203
532 3300048911 Ga0496108_0146414 Ga0496108_0146414_586_1203 203
533 3300048911 Ga0496108_0146776 Ga0496108_0146776_391_1116 203
534 3300048912 Ga0496109_0000062 Ga0496109_0000062_20460_21077 203
535 3300048912 Ga0496109_0016797 Ga0496109_0016797_4920_5564 203
536 3300048913 Ga0496110_0000325 Ga0496110_0000325_26579_27190 203
537 3300048913 Ga0496110_0060865 Ga0496110_0060865_2557_3168 203
538 3300048914 Ga0496111_0000171 Ga0496111_0000171_2417_3028 203
539 3300048914 Ga0496111_0022155 Ga0496111_0022155_298_936 203
540 3300048914 Ga0496111_0084895 Ga0496111_0084895_938_1549 203
541 3300048915 Ga0496112_0007934 Ga0496112_0007934_846_1463 203
542 3300048915 Ga0496112_0098738 Ga0496112_0098738_753_1391 203
543 3300048916 Ga0496113_0000002 Ga0496113_0000002_12118_12735 203
544 3300048916 Ga0496113_0138665 Ga0496113_0138665_1180_1824 203
545 3300048917 Ga0496114_0000097 Ga0496114_0000097_23167_23778 203
546 3300048917 Ga0496114_0002329 Ga0496114_0002329_8990_9628 203
547 3300048917 Ga0496114_0173892 Ga0496114_0173892_501_1142 203
548 3300048918 Ga0496115_0000005 Ga0496115_0000005_135305_135916 203
549 3300048918 Ga0496115_0000151 Ga0496115_0000151_24269_24880 203
550 3300048918 Ga0496115_0000552 Ga0496115_0000552_17402_18040 203
551 3300048920 Ga0496117_0008580 Ga0496117_0008580_6734_7378 203
552 3300048920 Ga0496117_0138567 Ga0496117_0138567_336_983 203
553 3300048920 Ga0496117_0192031 Ga0496117_0192031_115_756 203
554 3300048921 Ga0496118_0011630 Ga0496118_0011630_3453_4097 203
555 3300048921 Ga0496118_0226027 Ga0496118_0226027_36_680 203
556 3300048922 Ga0496119_0003596 Ga0496119_0003596_326_973 203
557 3300048922 Ga0496119_0008336 Ga0496119_0008336_2039_2650 203
558 3300048923 Ga0496120_0013670 Ga0496120_0013670_2629_3276 203
559 3300048923 Ga0496120_0024517 Ga0496120_0024517_1419_2030 203
560 3300048924 Ga0496121_0244711 Ga0496121_0244711_196_843 203
561 3300048924 Ga0496121_0300513 Ga0496121_0300513_123_770 203
562 3300048924 Ga0496121_0429376 Ga0496121_0429376_196_843 203
563 3300048928 Ga0496125_0036690 Ga0496125_0036690_2244_2888 203
564 3300048929 Ga0496126_0061679 Ga0496126_0061679_644_1285 203
565 3300048929 Ga0496126_0096085 Ga0496126_0096085_1309_1950 203
566 3300049576 Ga0501040_0668859 Ga0501040_0668859_85_699 203
567 3300049578 Ga0501042_0084775 Ga0501042_0084775_1565_2176 203
568 3300049578 Ga0501042_0246819 Ga0501042_0246819_79_690 203
569 3300049578 Ga0501042_0557219 Ga0501042_0557219_71_808 203
570 3300049581 Ga0501047_0076497 Ga0501047_0076497_2540_3187 203
571 3300049581 Ga0501047_0199045 Ga0501047_0199045_768_1412 203
572 3300049582 Ga0501048_0201395 Ga0501048_0201395_385_1122 203
573 3300049586 Ga0501070_0158483 Ga0501070_0158483_1090_1731 203
574 3300049586 Ga0501070_0208757 Ga0501070_0208757_22_636 203
575 3300049587 Ga0501071_0128689 Ga0501071_0128689_702_1439 203
576 3300049588 Ga0501072_0010149 Ga0501072_0010149_3477_4214 203
577 3300049592 Ga0501076_0043911 Ga0501076_0043911_2073_2810 203
578 3300049592 Ga0501076_0052178 Ga0501076_0052178_1102_1713 203
579 3300049743 Ga0501081_0394052 Ga0501081_0394052_119_802 203
580 3300049744 Ga0501083_0013469 Ga0501083_0013469_3163_3810 203
581 3300049822 Ga0501035_0126212 Ga0501035_0126212_984_1721 203
582 3300049823 Ga0501044_0368048 Ga0501044_0368048_459_1106 203
583 3300049824 Ga0501045_0096873 Ga0501045_0096873_181_918 203
584 3300050491 nmdc:mga00v17_126142_c1 nmdc:mga00v17_126142_c1_567_1193 203
585 3300050492 nmdc:mga0yw44_8217_c1 nmdc:mga0yw44_8217_c1_423_1058 203
586 3300050507 nmdc:mga05p37_242619_c1 nmdc:mga05p37_242619_c1_532_1170 203
587 3300050507 nmdc:mga05p37_343611_c1 nmdc:mga05p37_343611_c1_1043_1702 203
588 3300050509 nmdc:mga0qj67_186845_c1 nmdc:mga0qj67_186845_c1_903_1559 203
589 3300053077 Ga0495601_0000065 Ga0495601_0000065_8128_8742 203
590 3300053077 Ga0495601_0150356 Ga0495601_0150356_853_1467 203
591 3300053078 Ga0495612_0004181 Ga0495612_0004181_1727_2338 203
592 3300053083 Ga0495655_0000013 Ga0495655_0000013_36955_37566 203
593 3300053083 Ga0495655_0001612 Ga0495655_0001612_2238_2849 203
594 3300053084 Ga0495595_0000005 Ga0495595_0000005_22219_22830 203
595 3300053084 Ga0495595_0029416 Ga0495595_0029416_901_1515 203
596 3300053084 Ga0495595_0140061 Ga0495595_0140061_228_839 203
597 3300053085 Ga0495619_0000069 Ga0495619_0000069_72341_72958 203
598 3300053085 Ga0495619_0000489 Ga0495619_0000489_11390_12001 203
599 3300053094 Ga0500566_0001523 Ga0500566_0001523_9983_10594 203
600 3300053129 Ga0500628_000045 Ga0500628_000045_4915_5526 203
601 3300053134 Ga0500658_0016931 Ga0500658_0016931_618_1265 203
602 3300053139 Ga0500568_0111496 Ga0500568_0111496_221_868 203
603 3300054114 Ga0501084_0087286 Ga0501084_0087286_1369_2106 203
604 3300060353 Ga0501082_0043605 Ga0501082_0043605_359_1096 203
605 3300061734 Ga0530510_0069251 Ga0530510_0069251_577_1314 203

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00573

Ribosomal_L4

Ribosomal protein L4/L1 family

28

216

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
8c9a-assembly1.cif.gz_E cryo-em captures early ribosome assembly in action 0.8244 6 203
8c9b-assembly1.cif.gz_E cryo-em captures early ribosome assembly in action 0.8226 3 203
8c97-assembly1.cif.gz_E cryo-em captures early ribosome assembly in action 0.8197 3 203
8c9a-assembly1.cif.gz_E cryo-em captures early ribosome assembly in action 0.8195 6 203
8c9b-assembly1.cif.gz_E cryo-em captures early ribosome assembly in action 0.8129 3 203
ID Description Score Start End Superfamily
af_P9WH85_1_222_3.40.1370.10 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 0.7487 2 200 3.40.1370.10
af_Q2FW07_2_206_3.40.1370.10 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 0.7358 2 200 3.40.1370.10
af_P9WH85_1_222_3.40.1370.10 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 0.7328 2 200 3.40.1370.10
af_Q54RB5_40_257_3.40.1370.10 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 0.7232 3 202 3.40.1370.10
af_Q2FW07_2_206_3.40.1370.10 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 0.7202 2 200 3.40.1370.10
ID Description Score Start End GO Terms
AF-A0A538BFB4-F1-model_v4 50S ribosomal protein L4 0.9656 117 203 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A538BFB4-F1-model_v4 50S ribosomal protein L4 0.955 117 203 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A0H4TTC6-F1-model_v4 Large ribosomal subunit protein uL4 (50S ribosomal protein L4) 0.9328 97 203 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A0H4TTC6-F1-model_v4 Large ribosomal subunit protein uL4 (50S ribosomal protein L4) 0.9246 97 203 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A6V8P0A4-F1-model_v4 Large ribosomal subunit protein uL4 (50S ribosomal protein L4) 0.9203 95 203 GO:0003735
GO:0005840
GO:0006412
GO:1990904

Feature Viewer

pLDDT pTM Quality
81.76 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map