F468516
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 605 | 286 | 605 | 208 |
Family's Representative Sequence
| Representative Sequence | 3300048910|Ga0496107_0102247|Ga0496107_0102247_1168_1893 |
| Length | 241 |
| Sequence | MAEAAASGAQAATSGGLKAPVLGKQAKADLPKEIFSEPFHESLVHEAARADLAARRRGTHSSLTRGEVAMTTAKAWRQKGTGRARAGALSVPHRYGGGAAFGPKPRHYTVKVNRKARRRALRSALTVHAERGTIGVLDGSTFSEPATKQAAEALRKWGADAPTLVVVTGDEDAVAKSFRNIEGATVALSDAAGVADVIGASSLLVSQAALEELASRASERPSTDAKPRAKRGEVSGEGRAS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 2 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 3 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 4 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 5 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 36 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 43 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 44 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 46 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 47 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 48 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 49 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 50 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 51 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 52 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 53 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 54 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 55 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 56 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 57 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 58 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 59 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 60 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 64 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 65 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 66 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 67 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 68 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 69 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 70 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 71 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 97 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 98 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 99 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 100 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 146 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 150 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 151 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 152 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 153 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 154 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 155 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 156 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 157 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 158 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 159 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 160 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 161 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 162 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 163 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 164 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 165 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 166 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 167 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 168 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 169 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 170 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 171 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 172 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 173 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 174 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 175 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 176 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 177 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 178 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 179 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 180 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 219 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 220 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 221 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 222 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 223 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 224 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 225 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 226 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 227 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 228 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 229 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 230 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 231 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 232 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 233 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 234 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 235 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 236 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 237 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 238 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 239 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 240 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 241 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 243 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 245 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 248 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 250 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 265 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 266 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 267 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 270 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 271 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 272 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 273 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 274 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 280 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 281 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 282 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 283 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 285 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.34 |
| Metatranscriptomes | 0.66 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.97 |
| Nodule | 0 |
| Rhizoplane | 8.76 |
| Rhizosphere | 83.97 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.31 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10003124 | 3300001979 | Bacteria | 7308 |
| 2 | JGI24748J21848_1000332 | 3300002074 | Bacteria | 5454 |
| 3 | JGI24034J26672_10000068 | 3300002239 | Bacteria | 28347 |
| 4 | JGI24742J22300_10000389 | 3300002244 | Bacteria | 6508 |
| 5 | JGI25407J50210_10001250 | 3300003373 | Bacteria | 5684 |
| 6 | JGI25407J50210_10002048 | 3300003373 | Bacteria | 4700 |
| 7 | JGI25407J50210_10002196 | 3300003373 | Bacteria | 4567 |
| 8 | JGI25407J50210_10007914 | 3300003373 | Bacteria | 2672 |
| 9 | Ga0070683_100138936 | 3300005329 | Bacteria | 2301 |
| 10 | Ga0070683_100620967 | 3300005329 | Bacteria | 1035 |
| 11 | Ga0070683_100774059 | 3300005329 | Bacteria | 920 |
| 12 | Ga0070690_100269847 | 3300005330 | Bacteria | 1210 |
| 13 | Ga0070690_100453756 | 3300005330 | Bacteria | 951 |
| 14 | Ga0070670_100085569 | 3300005331 | Bacteria | 2709 |
| 15 | Ga0070670_101031762 | 3300005331 | Unclassified | 748 |
| 16 | Ga0070666_10019547 | 3300005335 | Bacteria | 4374 |
| 17 | Ga0070666_10696449 | 3300005335 | Bacteria | 745 |
| 18 | Ga0070680_100002655 | 3300005336 | Bacteria | 13257 |
| 19 | Ga0070682_100015047 | 3300005337 | Bacteria | 4479 |
| 20 | Ga0070682_100106785 | 3300005337 | Bacteria | 1858 |
| 21 | Ga0070682_100125847 | 3300005337 | Bacteria | 1727 |
| 22 | Ga0068868_100009889 | 3300005338 | Bacteria | 6887 |
| 23 | Ga0068868_100269192 | 3300005338 | Bacteria | 1439 |
| 24 | Ga0068868_100862139 | 3300005338 | Bacteria | 821 |
| 25 | Ga0070689_100128041 | 3300005340 | Bacteria | 2034 |
| 26 | Ga0070691_10000257 | 3300005341 | Bacteria | 18341 |
| 27 | Ga0070661_100000236 | 3300005344 | Bacteria | 45535 |
| 28 | Ga0070661_100082633 | 3300005344 | Bacteria | 2372 |
| 29 | Ga0070692_10087921 | 3300005345 | Bacteria | 1685 |
| 30 | Ga0070692_10506087 | 3300005345 | Bacteria | 784 |
| 31 | Ga0070668_100198128 | 3300005347 | Bacteria | 1648 |
| 32 | Ga0070675_100000930 | 3300005354 | Bacteria | 20823 |
| 33 | Ga0070674_100003700 | 3300005356 | Bacteria | 8616 |
| 34 | Ga0070688_100002914 | 3300005365 | Bacteria | 8725 |
| 35 | Ga0070659_100004067 | 3300005366 | Bacteria | 10429 |
| 36 | Ga0070659_100013450 | 3300005366 | Bacteria | 6092 |
| 37 | Ga0070667_100001611 | 3300005367 | Bacteria | 20202 |
| 38 | Ga0070667_100287165 | 3300005367 | Bacteria | 1479 |
| 39 | Ga0070714_100583970 | 3300005435 | Bacteria | 1072 |
| 40 | Ga0070713_100000171 | 3300005436 | Bacteria | 43503 |
| 41 | Ga0070711_100053395 | 3300005439 | Bacteria | 2785 |
| 42 | Ga0070700_100279103 | 3300005441 | Bacteria | 1210 |
| 43 | Ga0070700_100422397 | 3300005441 | Bacteria | 1008 |
| 44 | Ga0070700_100657995 | 3300005441 | Bacteria | 828 |
| 45 | Ga0070694_100097215 | 3300005444 | Bacteria | 2077 |
| 46 | Ga0070663_100083061 | 3300005455 | Bacteria | 2358 |
| 47 | Ga0070663_100266823 | 3300005455 | Bacteria | 1359 |
| 48 | Ga0070663_100354826 | 3300005455 | Bacteria | 1188 |
| 49 | Ga0070678_100021818 | 3300005456 | Bacteria | 4230 |
| 50 | Ga0070678_100089186 | 3300005456 | Bacteria | 2360 |
| 51 | Ga0070681_10002266 | 3300005458 | Bacteria | 17575 |
| 52 | Ga0070681_10240863 | 3300005458 | Bacteria | 1722 |
| 53 | Ga0068867_100003683 | 3300005459 | Bacteria | 10787 |
| 54 | Ga0068867_100227734 | 3300005459 | Bacteria | 1505 |
| 55 | Ga0068867_100389792 | 3300005459 | Bacteria | 1172 |
| 56 | Ga0070685_10001772 | 3300005466 | Bacteria | 11292 |
| 57 | Ga0070685_10066247 | 3300005466 | Bacteria | 2128 |
| 58 | Ga0070685_10183462 | 3300005466 | Bacteria | 1349 |
| 59 | Ga0070685_10218804 | 3300005466 | Bacteria | 1247 |
| 60 | Ga0070679_100000832 | 3300005530 | Bacteria | 26815 |
| 61 | Ga0070679_100036793 | 3300005530 | Bacteria | 4858 |
| 62 | Ga0070684_100024708 | 3300005535 | Bacteria | 5042 |
| 63 | Ga0070684_100115588 | 3300005535 | Bacteria | 2409 |
| 64 | Ga0070684_100697080 | 3300005535 | Bacteria | 947 |
| 65 | Ga0068853_100005341 | 3300005539 | Bacteria | 10057 |
| 66 | Ga0070672_100000104 | 3300005543 | Bacteria | 42077 |
| 67 | Ga0070686_100036335 | 3300005544 | Bacteria | 3049 |
| 68 | Ga0070686_100172281 | 3300005544 | Bacteria | 1532 |
| 69 | Ga0070695_100128981 | 3300005545 | Bacteria | 1741 |
| 70 | Ga0070665_100777443 | 3300005548 | Bacteria | 970 |
| 71 | Ga0070665_100851965 | 3300005548 | Bacteria | 924 |
| 72 | Ga0070665_101137954 | 3300005548 | Bacteria | 792 |
| 73 | Ga0070704_100414054 | 3300005549 | Bacteria | 1153 |
| 74 | Ga0070704_100451731 | 3300005549 | Bacteria | 1107 |
| 75 | Ga0070664_100027426 | 3300005564 | Bacteria | 4733 |
| 76 | Ga0070664_100083028 | 3300005564 | Bacteria | 2764 |
| 77 | Ga0070664_100633711 | 3300005564 | Bacteria | 993 |
| 78 | Ga0068854_100014383 | 3300005578 | Bacteria | 5217 |
| 79 | Ga0068854_100151099 | 3300005578 | Bacteria | 1791 |
| 80 | Ga0068854_100414314 | 3300005578 | Bacteria | 1118 |
| 81 | Ga0068854_100846022 | 3300005578 | Bacteria | 800 |
| 82 | Ga0068856_100007453 | 3300005614 | Bacteria | 10677 |
| 83 | Ga0068856_100031746 | 3300005614 | Bacteria | 5168 |
| 84 | Ga0068856_100174723 | 3300005614 | Bacteria | 2160 |
| 85 | Ga0068856_100816683 | 3300005614 | Bacteria | 952 |
| 86 | Ga0070702_100204009 | 3300005615 | Bacteria | 1311 |
| 87 | Ga0070702_100580723 | 3300005615 | Bacteria | 837 |
| 88 | Ga0070702_100599186 | 3300005615 | Bacteria | 826 |
| 89 | Ga0068852_100001042 | 3300005616 | Bacteria | 18249 |
| 90 | Ga0068852_100048086 | 3300005616 | Bacteria | 3643 |
| 91 | Ga0068852_100050655 | 3300005616 | Bacteria | 3559 |
| 92 | Ga0068859_100398541 | 3300005617 | Bacteria | 1472 |
| 93 | Ga0068866_10140603 | 3300005718 | Bacteria | 1385 |
| 94 | Ga0068861_100155163 | 3300005719 | Bacteria | 1882 |
| 95 | Ga0068861_100328039 | 3300005719 | Bacteria | 1335 |
| 96 | Ga0068861_100518363 | 3300005719 | Bacteria | 1081 |
| 97 | Ga0068851_10004857 | 3300005834 | Bacteria | 6084 |
| 98 | Ga0068851_10047591 | 3300005834 | Bacteria | 2172 |
| 99 | Ga0068870_10481152 | 3300005840 | Bacteria | 824 |
| 100 | Ga0068860_100166222 | 3300005843 | Bacteria | 2129 |
| 101 | Ga0068860_100492719 | 3300005843 | Bacteria | 1223 |
| 102 | Ga0068862_100001247 | 3300005844 | Bacteria | 23931 |
| 103 | Ga0068862_101052156 | 3300005844 | Bacteria | 807 |
| 104 | Ga0081455_10010355 | 3300005937 | Bacteria | 9474 |
| 105 | Ga0081455_10011025 | 3300005937 | Bacteria | 9104 |
| 106 | Ga0081455_10011092 | 3300005937 | Bacteria | 9072 |
| 107 | Ga0081455_10030723 | 3300005937 | Bacteria | 4875 |
| 108 | Ga0081455_10063369 | 3300005937 | Bacteria | 3102 |
| 109 | Ga0081455_10094536 | 3300005937 | Bacteria | 2414 |
| 110 | Ga0081455_10163236 | 3300005937 | Bacteria | 1705 |
| 111 | Ga0081455_10257704 | 3300005937 | Bacteria | 1272 |
| 112 | Ga0081455_10268855 | 3300005937 | Bacteria | 1238 |
| 113 | Ga0081455_10295633 | 3300005937 | Bacteria | 1164 |
| 114 | Ga0081538_10000396 | 3300005981 | Bacteria | 49639 |
| 115 | Ga0081538_10001771 | 3300005981 | Bacteria | 21857 |
| 116 | Ga0081538_10003058 | 3300005981 | Bacteria | 15941 |
| 117 | Ga0081538_10003213 | 3300005981 | Bacteria | 15534 |
| 118 | Ga0081538_10004998 | 3300005981 | Bacteria | 12070 |
| 119 | Ga0081538_10005868 | 3300005981 | Bacteria | 10942 |
| 120 | Ga0081538_10008306 | 3300005981 | Bacteria | 8839 |
| 121 | Ga0081538_10028056 | 3300005981 | Bacteria | 3884 |
| 122 | Ga0081538_10031989 | 3300005981 | Bacteria | 3537 |
| 123 | Ga0081538_10044033 | 3300005981 | Bacteria | 2791 |
| 124 | Ga0081538_10059993 | 3300005981 | Bacteria | 2192 |
| 125 | Ga0081538_10077500 | 3300005981 | Bacteria | 1790 |
| 126 | Ga0081538_10084777 | 3300005981 | Bacteria | 1668 |
| 127 | Ga0081538_10085553 | 3300005981 | Bacteria | 1656 |
| 128 | Ga0081538_10133600 | 3300005981 | Unclassified | 1160 |
| 129 | Ga0081538_10148825 | 3300005981 | Bacteria | 1064 |
| 130 | Ga0081540_1000553 | 3300005983 | Bacteria | 36267 |
| 131 | Ga0081540_1082547 | 3300005983 | Bacteria | 1441 |
| 132 | Ga0081539_10002195 | 3300005985 | Bacteria | 28613 |
| 133 | Ga0081539_10053821 | 3300005985 | Bacteria | 2251 |
| 134 | Ga0075365_10000565 | 3300006038 | Bacteria | 14356 |
| 135 | Ga0075365_10009057 | 3300006038 | Bacteria | 5694 |
| 136 | Ga0075365_10233250 | 3300006038 | Bacteria | 1292 |
| 137 | Ga0075363_100165933 | 3300006048 | Bacteria | 1252 |
| 138 | Ga0075364_10020535 | 3300006051 | Bacteria | 4154 |
| 139 | Ga0075364_10055344 | 3300006051 | Bacteria | 2595 |
| 140 | Ga0075364_10147590 | 3300006051 | Bacteria | 1584 |
| 141 | Ga0075364_10304670 | 3300006051 | Bacteria | 1085 |
| 142 | Ga0075364_10365607 | 3300006051 | Bacteria | 984 |
| 143 | Ga0070715_10205567 | 3300006163 | Bacteria | 1003 |
| 144 | Ga0070716_100135126 | 3300006173 | Bacteria | 1565 |
| 145 | Ga0070712_100003252 | 3300006175 | Bacteria | 10001 |
| 146 | Ga0070712_100014893 | 3300006175 | Bacteria | 4998 |
| 147 | Ga0075367_10174856 | 3300006178 | Bacteria | 1338 |
| 148 | Ga0068871_100525748 | 3300006358 | Bacteria | 1069 |
| 149 | Ga0075428_100022531 | 3300006844 | Bacteria | 6973 |
| 150 | Ga0075428_100059133 | 3300006844 | Bacteria | 4197 |
| 151 | Ga0075428_100456441 | 3300006844 | Bacteria | 1368 |
| 152 | Ga0075430_100016384 | 3300006846 | Bacteria | 6311 |
| 153 | Ga0075431_100008449 | 3300006847 | Bacteria | 10310 |
| 154 | Ga0075431_100128099 | 3300006847 | Bacteria | 2619 |
| 155 | Ga0075431_100271416 | 3300006847 | Bacteria | 1719 |
| 156 | Ga0075434_100034388 | 3300006871 | Bacteria | 5005 |
| 157 | Ga0075429_100121873 | 3300006880 | Bacteria | 2279 |
| 158 | Ga0068865_100000056 | 3300006881 | Bacteria | 62122 |
| 159 | Ga0097620_100398531 | 3300006931 | Bacteria | 1472 |
| 160 | Ga0105240_10067591 | 3300009093 | Bacteria | 4429 |
| 161 | Ga0111539_10094044 | 3300009094 | Bacteria | 3521 |
| 162 | Ga0111539_10157492 | 3300009094 | Bacteria | 2657 |
| 163 | Ga0111539_10239303 | 3300009094 | Bacteria | 2113 |
| 164 | Ga0111539_10243969 | 3300009094 | Bacteria | 2091 |
| 165 | Ga0111539_10466319 | 3300009094 | Bacteria | 1471 |
| 166 | Ga0105245_10000528 | 3300009098 | Bacteria | 35016 |
| 167 | Ga0105245_10014245 | 3300009098 | Bacteria | 6928 |
| 168 | Ga0105245_10174160 | 3300009098 | Bacteria | 2051 |
| 169 | Ga0105245_10275687 | 3300009098 | Bacteria | 1642 |
| 170 | Ga0105245_10427748 | 3300009098 | Bacteria | 1328 |
| 171 | Ga0105245_10725480 | 3300009098 | Bacteria | 1028 |
| 172 | Ga0105247_10000064 | 3300009101 | Bacteria | 123994 |
| 173 | Ga0105247_10056313 | 3300009101 | Bacteria | 2428 |
| 174 | Ga0114129_10050964 | 3300009147 | Bacteria | 5812 |
| 175 | Ga0114129_10087401 | 3300009147 | Bacteria | 4323 |
| 176 | Ga0114129_10094967 | 3300009147 | Bacteria | 4129 |
| 177 | Ga0114129_10127157 | 3300009147 | Bacteria | 3503 |
| 178 | Ga0114129_10165092 | 3300009147 | Bacteria | 3022 |
| 179 | Ga0114129_10529424 | 3300009147 | Bacteria | 1535 |
| 180 | Ga0114129_11133455 | 3300009147 | Bacteria | 977 |
| 181 | Ga0105243_10080350 | 3300009148 | Bacteria | 2659 |
| 182 | Ga0105243_10144764 | 3300009148 | Bacteria | 2032 |
| 183 | Ga0105243_10171682 | 3300009148 | Bacteria | 1879 |
| 184 | Ga0105243_10200695 | 3300009148 | Bacteria | 1749 |
| 185 | Ga0105243_10367335 | 3300009148 | Bacteria | 1326 |
| 186 | Ga0105242_10000123 | 3300009176 | Bacteria | 56900 |
| 187 | Ga0105242_10003277 | 3300009176 | Bacteria | 12618 |
| 188 | Ga0105242_10044398 | 3300009176 | Bacteria | 3600 |
| 189 | Ga0105248_10001735 | 3300009177 | Bacteria | 24226 |
| 190 | Ga0105248_10074556 | 3300009177 | Bacteria | 3814 |
| 191 | Ga0105238_10231599 | 3300009551 | Bacteria | 1824 |
| 192 | Ga0105249_10003640 | 3300009553 | Bacteria | 13325 |
| 193 | Ga0105249_10374126 | 3300009553 | Bacteria | 1449 |
| 194 | Ga0105239_10965151 | 3300010375 | Bacteria | 979 |
| 195 | Ga0105246_10175137 | 3300011119 | Bacteria | 1647 |
| 196 | Ga0105246_10974260 | 3300011119 | Bacteria | 766 |
| 197 | Ga0157371_10358486 | 3300013102 | Bacteria | 1062 |
| 198 | Ga0157370_10005533 | 3300013104 | Bacteria | 14161 |
| 199 | Ga0157370_10059005 | 3300013104 | Bacteria | 3647 |
| 200 | Ga0157370_10132352 | 3300013104 | Bacteria | 2326 |
| 201 | Ga0157369_10000068 | 3300013105 | Bacteria | 144274 |
| 202 | Ga0157369_10066099 | 3300013105 | Bacteria | 3890 |
| 203 | Ga0157378_10030690 | 3300013297 | Bacteria | 4747 |
| 204 | Ga0157378_10258957 | 3300013297 | Bacteria | 1668 |
| 205 | Ga0157378_10297293 | 3300013297 | Bacteria | 1561 |
| 206 | Ga0163162_10322361 | 3300013306 | Bacteria | 1678 |
| 207 | Ga0157372_10000809 | 3300013307 | Bacteria | 33940 |
| 208 | Ga0157372_10007045 | 3300013307 | Bacteria | 11975 |
| 209 | Ga0157375_10008331 | 3300013308 | Bacteria | 9080 |
| 210 | Ga0157375_10237203 | 3300013308 | Bacteria | 1983 |
| 211 | Ga0163163_10197122 | 3300014325 | Bacteria | 2062 |
| 212 | Ga0163163_10461850 | 3300014325 | Bacteria | 1330 |
| 213 | Ga0163163_10536951 | 3300014325 | Bacteria | 1232 |
| 214 | Ga0157380_10000808 | 3300014326 | Bacteria | 19608 |
| 215 | Ga0157380_10550426 | 3300014326 | Bacteria | 1132 |
| 216 | Ga0157379_10087707 | 3300014968 | Bacteria | 2790 |
| 217 | Ga0157379_10138083 | 3300014968 | Bacteria | 2197 |
| 218 | Ga0157376_10028182 | 3300014969 | Bacteria | 4461 |
| 219 | Ga0157376_10164943 | 3300014969 | Bacteria | 2012 |
| 220 | Ga0157376_10483943 | 3300014969 | Bacteria | 1213 |
| 221 | Ga0163161_10054161 | 3300017792 | Bacteria | 2911 |
| 222 | Ga0163161_10054996 | 3300017792 | Bacteria | 2889 |
| 223 | Ga0197907_10671781 | 3300020069 | Bacteria | 1721 |
| 224 | Ga0206356_11300597 | 3300020070 | Bacteria | 2050 |
| 225 | Ga0206354_11524261 | 3300020081 | Bacteria | 1324 |
| 226 | Ga0206353_11509509 | 3300020082 | Bacteria | 4996 |
| 227 | Ga0207656_10004334 | 3300025321 | Bacteria | 4948 |
| 228 | Ga0207692_10132901 | 3300025898 | Bacteria | 1407 |
| 229 | Ga0207642_10019085 | 3300025899 | Bacteria | 2647 |
| 230 | Ga0207710_10000220 | 3300025900 | Bacteria | 50023 |
| 231 | Ga0207710_10015681 | 3300025900 | Bacteria | 3205 |
| 232 | Ga0207688_10026332 | 3300025901 | Bacteria | 3198 |
| 233 | Ga0207680_10024081 | 3300025903 | Bacteria | 3335 |
| 234 | Ga0207685_10089012 | 3300025905 | Bacteria | 1295 |
| 235 | Ga0207654_10054051 | 3300025911 | Bacteria | 2320 |
| 236 | Ga0207707_10005637 | 3300025912 | Bacteria | 10957 |
| 237 | Ga0207707_10048171 | 3300025912 | Bacteria | 3712 |
| 238 | Ga0207695_10251205 | 3300025913 | Bacteria | 1668 |
| 239 | Ga0207695_10479024 | 3300025913 | Bacteria | 1127 |
| 240 | Ga0207693_10001647 | 3300025915 | Bacteria | 19699 |
| 241 | Ga0207693_10002588 | 3300025915 | Bacteria | 15717 |
| 242 | Ga0207663_10037091 | 3300025916 | Bacteria | 2937 |
| 243 | Ga0207660_10023884 | 3300025917 | Bacteria | 4133 |
| 244 | Ga0207649_10000388 | 3300025920 | Bacteria | 32980 |
| 245 | Ga0207649_10057089 | 3300025920 | Bacteria | 2439 |
| 246 | Ga0207649_10158646 | 3300025920 | Bacteria | 1566 |
| 247 | Ga0207652_10000666 | 3300025921 | Bacteria | 33621 |
| 248 | Ga0207652_10009613 | 3300025921 | Bacteria | 7779 |
| 249 | Ga0207652_10168460 | 3300025921 | Bacteria | 1965 |
| 250 | Ga0207694_10452250 | 3300025924 | Bacteria | 1072 |
| 251 | Ga0207650_10043384 | 3300025925 | Bacteria | 3301 |
| 252 | Ga0207650_10667621 | 3300025925 | Bacteria | 877 |
| 253 | Ga0207659_10000138 | 3300025926 | Bacteria | 42755 |
| 254 | Ga0207687_10000025 | 3300025927 | Bacteria | 175177 |
| 255 | Ga0207687_10005977 | 3300025927 | Bacteria | 8048 |
| 256 | Ga0207687_10110444 | 3300025927 | Bacteria | 2039 |
| 257 | Ga0207687_10206679 | 3300025927 | Bacteria | 1538 |
| 258 | Ga0207687_10259197 | 3300025927 | Bacteria | 1385 |
| 259 | Ga0207687_10310645 | 3300025927 | Bacteria | 1273 |
| 260 | Ga0207700_10000019 | 3300025928 | Bacteria | 183117 |
| 261 | Ga0207664_10104740 | 3300025929 | Bacteria | 2343 |
| 262 | Ga0207690_10001935 | 3300025932 | Bacteria | 12700 |
| 263 | Ga0207690_10008867 | 3300025932 | Bacteria | 5969 |
| 264 | Ga0207686_10000066 | 3300025934 | Bacteria | 95095 |
| 265 | Ga0207686_10001614 | 3300025934 | Bacteria | 12622 |
| 266 | Ga0207709_10040649 | 3300025935 | Bacteria | 2785 |
| 267 | Ga0207709_10319971 | 3300025935 | Bacteria | 1161 |
| 268 | Ga0207709_10387641 | 3300025935 | Bacteria | 1065 |
| 269 | Ga0207670_10108744 | 3300025936 | Bacteria | 1994 |
| 270 | Ga0207669_10005898 | 3300025937 | Bacteria | 5544 |
| 271 | Ga0207669_10329950 | 3300025937 | Bacteria | 1171 |
| 272 | Ga0207704_10011990 | 3300025938 | Bacteria | 4287 |
| 273 | Ga0207665_10019306 | 3300025939 | Bacteria | 4480 |
| 274 | Ga0207691_10000430 | 3300025940 | Bacteria | 41789 |
| 275 | Ga0207711_10000011 | 3300025941 | Bacteria | 518817 |
| 276 | Ga0207661_10002381 | 3300025944 | Bacteria | 12947 |
| 277 | Ga0207661_10002385 | 3300025944 | Bacteria | 12935 |
| 278 | Ga0207661_10058350 | 3300025944 | Bacteria | 3105 |
| 279 | Ga0207661_10107996 | 3300025944 | Bacteria | 2348 |
| 280 | Ga0207661_10653359 | 3300025944 | Bacteria | 966 |
| 281 | Ga0207679_10064235 | 3300025945 | Bacteria | 2743 |
| 282 | Ga0207679_10069455 | 3300025945 | Bacteria | 2651 |
| 283 | Ga0207679_10135579 | 3300025945 | Bacteria | 1982 |
| 284 | Ga0207679_10312940 | 3300025945 | Unclassified | 1357 |
| 285 | Ga0207712_10003459 | 3300025961 | Bacteria | 9970 |
| 286 | Ga0207712_10124409 | 3300025961 | Bacteria | 1956 |
| 287 | Ga0207712_10129766 | 3300025961 | Bacteria | 1919 |
| 288 | Ga0207712_10281223 | 3300025961 | Bacteria | 1358 |
| 289 | Ga0207668_10002563 | 3300025972 | Bacteria | 10620 |
| 290 | Ga0207668_10173476 | 3300025972 | Bacteria | 1693 |
| 291 | Ga0207640_10000691 | 3300025981 | Bacteria | 19634 |
| 292 | Ga0207640_10956987 | 3300025981 | Bacteria | 751 |
| 293 | Ga0207658_10000840 | 3300025986 | Bacteria | 25652 |
| 294 | Ga0207658_10122209 | 3300025986 | Bacteria | 2078 |
| 295 | Ga0207677_10056601 | 3300026023 | Bacteria | 2688 |
| 296 | Ga0207639_10026393 | 3300026041 | Bacteria | 4221 |
| 297 | Ga0207639_10923962 | 3300026041 | Bacteria | 816 |
| 298 | Ga0207678_10002630 | 3300026067 | Bacteria | 16356 |
| 299 | Ga0207678_10155956 | 3300026067 | Bacteria | 1949 |
| 300 | Ga0207708_10224638 | 3300026075 | Bacteria | 1506 |
| 301 | Ga0207708_10243745 | 3300026075 | Bacteria | 1446 |
| 302 | Ga0207702_10006219 | 3300026078 | Bacteria | 10321 |
| 303 | Ga0207702_10015335 | 3300026078 | Bacteria | 6351 |
| 304 | Ga0207702_10135029 | 3300026078 | Bacteria | 2225 |
| 305 | Ga0207702_11328433 | 3300026078 | Unclassified | 713 |
| 306 | Ga0207648_10005232 | 3300026089 | Bacteria | 13117 |
| 307 | Ga0207648_10066179 | 3300026089 | Bacteria | 3151 |
| 308 | Ga0207648_11012616 | 3300026089 | Bacteria | 778 |
| 309 | Ga0207675_100087831 | 3300026118 | Bacteria | 2921 |
| 310 | Ga0207675_100862903 | 3300026118 | Bacteria | 920 |
| 311 | Ga0207675_100941842 | 3300026118 | Bacteria | 881 |
| 312 | Ga0207683_10029338 | 3300026121 | Bacteria | 4762 |
| 313 | Ga0207683_10051534 | 3300026121 | Bacteria | 3606 |
| 314 | Ga0207698_10000014 | 3300026142 | Bacteria | 240703 |
| 315 | Ga0207698_10021851 | 3300026142 | Bacteria | 4433 |
| 316 | Ga0207698_10054216 | 3300026142 | Bacteria | 3084 |
| 317 | Ga0207428_10039587 | 3300027907 | Bacteria | 3828 |
| 318 | Ga0268266_10005543 | 3300028379 | Bacteria | 11749 |
| 319 | Ga0268266_10985844 | 3300028379 | Bacteria | 815 |
| 320 | Ga0268265_10005115 | 3300028380 | Bacteria | 8983 |
| 321 | Ga0268265_10944848 | 3300028380 | Bacteria | 849 |
| 322 | Ga0268264_10023259 | 3300028381 | Bacteria | 5056 |
| 323 | Ga0265326_10020928 | 3300028558 | Bacteria | 1875 |
| 324 | Ga0265319_1000030 | 3300028563 | Bacteria | 129742 |
| 325 | Ga0265336_10120476 | 3300028666 | Bacteria | 781 |
| 326 | Ga0265338_10000156 | 3300028800 | Bacteria | 125065 |
| 327 | Ga0265325_10005113 | 3300031241 | Bacteria | 8165 |
| 328 | Ga0307513_10200086 | 3300031456 | Bacteria | 1840 |
| 329 | Ga0307405_10095388 | 3300031731 | Bacteria | 1981 |
| 330 | Ga0307405_10814437 | 3300031731 | Unclassified | 783 |
| 331 | Ga0307413_10494430 | 3300031824 | Bacteria | 981 |
| 332 | Ga0307410_10517636 | 3300031852 | Unclassified | 984 |
| 333 | Ga0307407_10326879 | 3300031903 | Bacteria | 1078 |
| 334 | Ga0307409_100117811 | 3300031995 | Bacteria | 2242 |
| 335 | Ga0307409_100245144 | 3300031995 | Bacteria | 1634 |
| 336 | Ga0307409_100465396 | 3300031995 | Bacteria | 1223 |
| 337 | Ga0307416_100619015 | 3300032002 | Bacteria | 1164 |
| 338 | Ga0307416_101232801 | 3300032002 | Bacteria | 854 |
| 339 | Ga0307415_100752719 | 3300032126 | Unclassified | 885 |
| 340 | Ga0373960_0005767 | 3300035121 | Bacteria | 2880 |
| 341 | Ga0373961_0103147 | 3300035241 | Bacteria | 926 |
| 342 | Ga0373962_0022030 | 3300035242 | Bacteria | 1686 |
| 343 | Ga0373947_0477718 | 3300035725 | Bacteria | 846 |
| 344 | Ga0373937_0354465 | 3300036401 | Bacteria | 1390 |
| 345 | Ga0395899_0444047 | 3300037312 | Bacteria | 851 |
| 346 | Ga0395900_0584307 | 3300037418 | Bacteria | 1059 |
| 347 | Ga0395898_0017781 | 3300037466 | Bacteria | 7254 |
| 348 | Ga0395898_0024801 | 3300037466 | Bacteria | 6046 |
| 349 | Ga0395898_0352683 | 3300037466 | Bacteria | 1403 |
| 350 | Ga0395898_0974445 | 3300037466 | Bacteria | 784 |
| 351 | Ga0395905_0013334 | 3300037471 | Bacteria | 7878 |
| 352 | Ga0395905_0441187 | 3300037471 | Bacteria | 1199 |
| 353 | Ga0395905_0712536 | 3300037471 | Bacteria | 906 |
| 354 | Ga0395901_0011288 | 3300038443 | Bacteria | 9050 |
| 355 | Ga0395901_0012327 | 3300038443 | Bacteria | 8674 |
| 356 | Ga0395901_0045141 | 3300038443 | Bacteria | 4572 |
| 357 | Ga0395901_0100695 | 3300038443 | Bacteria | 3031 |
| 358 | Ga0395901_0252586 | 3300038443 | Bacteria | 1837 |
| 359 | Ga0395901_0399211 | 3300038443 | Bacteria | 1413 |
| 360 | Ga0395901_0699217 | 3300038443 | Bacteria | 1012 |
| 361 | Ga0451849_1549853 | 3300041505 | Bacteria | 1209 |
| 362 | Ga0439443_032238 | 3300042003 | Bacteria | 868 |
| 363 | Ga0439448_0096937 | 3300042005 | Bacteria | 1000 |
| 364 | Ga0439464_0012359 | 3300042439 | Bacteria | 2274 |
| 365 | Ga0466963_0390591 | 3300044694 | Bacteria | 981 |
| 366 | Ga0466963_0414124 | 3300044694 | Bacteria | 950 |
| 367 | Ga0466957_0001797 | 3300044842 | Bacteria | 11298 |
| 368 | Ga0466957_0047130 | 3300044842 | Bacteria | 2618 |
| 369 | Ga0466957_0312582 | 3300044842 | Bacteria | 1058 |
| 370 | Ga0466958_0043454 | 3300045836 | Bacteria | 2707 |
| 371 | Ga0466967_0000003 | 3300045976 | Bacteria | 169144 |
| 372 | Ga0466967_0078881 | 3300045976 | Bacteria | 2967 |
| 373 | Ga0466967_0900267 | 3300045976 | Bacteria | 880 |
| 374 | Ga0495629_0000543 | 3300046459 | Bacteria | 31107 |
| 375 | Ga0495629_0004371 | 3300046459 | Bacteria | 10589 |
| 376 | Ga0495629_0012223 | 3300046459 | Bacteria | 6217 |
| 377 | Ga0495638_0020983 | 3300046460 | Bacteria | 4312 |
| 378 | Ga0495641_0085891 | 3300046461 | Bacteria | 1408 |
| 379 | Ga0495582_0092785 | 3300046473 | Bacteria | 1685 |
| 380 | Ga0495662_0013224 | 3300046476 | Bacteria | 4017 |
| 381 | Ga0495662_0217386 | 3300046476 | Bacteria | 942 |
| 382 | Ga0495662_0437372 | 3300046476 | Bacteria | 642 |
| 383 | Ga0495585_0154277 | 3300046492 | Bacteria | 1196 |
| 384 | Ga0495596_0039775 | 3300046500 | Bacteria | 1857 |
| 385 | Ga0495596_0048803 | 3300046500 | Bacteria | 1660 |
| 386 | Ga0495606_0000283 | 3300046507 | Bacteria | 88309 |
| 387 | Ga0495608_0000010 | 3300046511 | Bacteria | 258660 |
| 388 | Ga0495618_0273469 | 3300046514 | Bacteria | 1055 |
| 389 | Ga0495628_0000864 | 3300046516 | Bacteria | 28036 |
| 390 | Ga0495630_0000148 | 3300046517 | Bacteria | 54619 |
| 391 | Ga0495630_0000395 | 3300046517 | Bacteria | 34351 |
| 392 | Ga0495631_0074288 | 3300046518 | Bacteria | 1468 |
| 393 | Ga0495637_0075343 | 3300046520 | Bacteria | 1354 |
| 394 | Ga0495644_0170311 | 3300046523 | Bacteria | 836 |
| 395 | Ga0495644_0233003 | 3300046523 | Bacteria | 713 |
| 396 | Ga0495663_0028842 | 3300046525 | Bacteria | 1636 |
| 397 | Ga0495652_0000009 | 3300046529 | Bacteria | 311000 |
| 398 | Ga0495652_0319637 | 3300046529 | Bacteria | 1122 |
| 399 | Ga0495587_0262530 | 3300046536 | Bacteria | 970 |
| 400 | Ga0495645_0018112 | 3300046543 | Bacteria | 5055 |
| 401 | Ga0495633_0118628 | 3300046558 | Bacteria | 1226 |
| 402 | Ga0495634_0000993 | 3300046642 | Bacteria | 26739 |
| 403 | Ga0495634_0133082 | 3300046642 | Bacteria | 1584 |
| 404 | Ga0495625_0000109 | 3300046660 | Bacteria | 125064 |
| 405 | Ga0495588_0000175 | 3300046674 | Bacteria | 80911 |
| 406 | Ga0495657_0000005 | 3300046675 | Bacteria | 254860 |
| 407 | Ga0495599_0290938 | 3300046678 | Bacteria | 988 |
| 408 | Ga0495647_0000114 | 3300046681 | Bacteria | 20349 |
| 409 | Ga0495658_0001193 | 3300046683 | Bacteria | 13694 |
| 410 | Ga0495613_0000087 | 3300046689 | Bacteria | 88644 |
| 411 | Ga0495624_0000429 | 3300046690 | Bacteria | 33305 |
| 412 | Ga0495589_0073363 | 3300046794 | Bacteria | 1670 |
| 413 | Ga0495600_0072600 | 3300046809 | Bacteria | 2247 |
| 414 | Ga0495604_0000322 | 3300047317 | Bacteria | 42966 |
| 415 | Ga0495676_0000522 | 3300047321 | Bacteria | 31518 |
| 416 | Ga0495676_0046499 | 3300047321 | Bacteria | 3521 |
| 417 | Ga0495680_0009545 | 3300047322 | Bacteria | 8718 |
| 418 | Ga0495680_0104929 | 3300047322 | Bacteria | 2102 |
| 419 | Ga0495675_0000398 | 3300047444 | Bacteria | 30075 |
| 420 | Ga0495684_0101777 | 3300047471 | Bacteria | 2172 |
| 421 | Ga0495593_0134286 | 3300047673 | Bacteria | 1255 |
| 422 | Ga0495602_0000038 | 3300048088 | Bacteria | 130758 |
| 423 | Ga0495602_0003702 | 3300048088 | Bacteria | 15861 |
| 424 | Ga0495602_0098658 | 3300048088 | Bacteria | 2403 |
| 425 | Ga0496100_0000028 | 3300048903 | Bacteria | 113912 |
| 426 | Ga0496100_0005219 | 3300048903 | Bacteria | 6975 |
| 427 | Ga0496101_0000005 | 3300048904 | Bacteria | 331455 |
| 428 | Ga0496101_0046252 | 3300048904 | Bacteria | 3120 |
| 429 | Ga0496102_0000021 | 3300048905 | Bacteria | 246920 |
| 430 | Ga0496102_0006894 | 3300048905 | Bacteria | 9692 |
| 431 | Ga0496102_0404993 | 3300048905 | Bacteria | 1282 |
| 432 | Ga0496102_0442318 | 3300048905 | Bacteria | 1220 |
| 433 | Ga0496102_0457202 | 3300048905 | Unclassified | 1197 |
| 434 | Ga0496103_0000001 | 3300048906 | Bacteria | 643471 |
| 435 | Ga0496103_0006645 | 3300048906 | Bacteria | 6900 |
| 436 | Ga0496103_0194384 | 3300048906 | Bacteria | 1304 |
| 437 | Ga0496104_0000029 | 3300048907 | Bacteria | 202968 |
| 438 | Ga0496104_0007889 | 3300048907 | Bacteria | 9440 |
| 439 | Ga0496105_0000002 | 3300048908 | Bacteria | 753215 |
| 440 | Ga0496105_0044587 | 3300048908 | Bacteria | 3658 |
| 441 | Ga0496105_0055620 | 3300048908 | Bacteria | 3267 |
| 442 | Ga0496106_0000070 | 3300048909 | Bacteria | 82770 |
| 443 | Ga0496106_0001451 | 3300048909 | Bacteria | 17805 |
| 444 | Ga0496106_0083694 | 3300048909 | Bacteria | 2454 |
| 445 | Ga0496107_0000004 | 3300048910 | Bacteria | 297680 |
| 446 | Ga0496107_0003754 | 3300048910 | Bacteria | 10204 |
| 447 | Ga0496107_0102247 | 3300048910 | Bacteria | 2101 |
| 448 | Ga0496108_0000042 | 3300048911 | Bacteria | 146397 |
| 449 | Ga0496108_0050264 | 3300048911 | Bacteria | 3489 |
| 450 | Ga0496108_0146414 | 3300048911 | Bacteria | 2036 |
| 451 | Ga0496108_0146776 | 3300048911 | Bacteria | 2034 |
| 452 | Ga0496109_0000034 | 3300048912 | Bacteria | 160397 |
| 453 | Ga0496109_0000062 | 3300048912 | Bacteria | 112843 |
| 454 | Ga0496109_0016797 | 3300048912 | Bacteria | 6404 |
| 455 | Ga0496109_0047839 | 3300048912 | Bacteria | 3890 |
| 456 | Ga0496109_0193960 | 3300048912 | Bacteria | 1909 |
| 457 | Ga0496109_0199889 | 3300048912 | Bacteria | 1879 |
| 458 | Ga0496109_0213119 | 3300048912 | Bacteria | 1816 |
| 459 | Ga0496110_0000325 | 3300048913 | Bacteria | 31707 |
| 460 | Ga0496110_0049274 | 3300048913 | Bacteria | 3694 |
| 461 | Ga0496110_0060865 | 3300048913 | Bacteria | 3331 |
| 462 | Ga0496110_0330688 | 3300048913 | Bacteria | 1388 |
| 463 | Ga0496111_0000171 | 3300048914 | Bacteria | 29367 |
| 464 | Ga0496111_0022155 | 3300048914 | Bacteria | 4444 |
| 465 | Ga0496111_0084895 | 3300048914 | Bacteria | 2315 |
| 466 | Ga0496112_0007934 | 3300048915 | Bacteria | 9463 |
| 467 | Ga0496112_0098738 | 3300048915 | Bacteria | 2889 |
| 468 | Ga0496112_0725603 | 3300048915 | Bacteria | 921 |
| 469 | Ga0496113_0000002 | 3300048916 | Bacteria | 220193 |
| 470 | Ga0496113_0138665 | 3300048916 | Bacteria | 1912 |
| 471 | Ga0496113_0231495 | 3300048916 | Bacteria | 1473 |
| 472 | Ga0496114_0000097 | 3300048917 | Bacteria | 63410 |
| 473 | Ga0496114_0002329 | 3300048917 | Bacteria | 14462 |
| 474 | Ga0496114_0173892 | 3300048917 | Bacteria | 1878 |
| 475 | Ga0496115_0000005 | 3300048918 | Bacteria | 290756 |
| 476 | Ga0496115_0000151 | 3300048918 | Bacteria | 64493 |
| 477 | Ga0496115_0000552 | 3300048918 | Bacteria | 29009 |
| 478 | Ga0496117_0008580 | 3300048920 | Bacteria | 9688 |
| 479 | Ga0496117_0138567 | 3300048920 | Bacteria | 1461 |
| 480 | Ga0496117_0192031 | 3300048920 | Bacteria | 1162 |
| 481 | Ga0496118_0011630 | 3300048921 | Bacteria | 8558 |
| 482 | Ga0496118_0226027 | 3300048921 | Bacteria | 1084 |
| 483 | Ga0496119_0003596 | 3300048922 | Bacteria | 15948 |
| 484 | Ga0496119_0008336 | 3300048922 | Bacteria | 9135 |
| 485 | Ga0496119_0011836 | 3300048922 | Bacteria | 7165 |
| 486 | Ga0496120_0013670 | 3300048923 | Bacteria | 5453 |
| 487 | Ga0496120_0024517 | 3300048923 | Bacteria | 3760 |
| 488 | Ga0496121_0042207 | 3300048924 | Bacteria | 3972 |
| 489 | Ga0496121_0244711 | 3300048924 | Bacteria | 1247 |
| 490 | Ga0496121_0300513 | 3300048924 | Bacteria | 1089 |
| 491 | Ga0496121_0429376 | 3300048924 | Bacteria | 857 |
| 492 | Ga0496125_0036690 | 3300048928 | Bacteria | 4274 |
| 493 | Ga0496125_0149885 | 3300048928 | Bacteria | 1604 |
| 494 | Ga0496126_0061679 | 3300048929 | Bacteria | 3367 |
| 495 | Ga0496126_0096085 | 3300048929 | Bacteria | 2598 |
| 496 | Ga0501031_0233054 | 3300049568 | Bacteria | 1198 |
| 497 | Ga0501033_0386891 | 3300049570 | Bacteria | 977 |
| 498 | Ga0501036_0137584 | 3300049572 | Bacteria | 2061 |
| 499 | Ga0501036_0583032 | 3300049572 | Bacteria | 928 |
| 500 | Ga0501039_0074862 | 3300049575 | Bacteria | 2632 |
| 501 | Ga0501040_0032892 | 3300049576 | Bacteria | 3510 |
| 502 | Ga0501040_0254900 | 3300049576 | Bacteria | 1252 |
| 503 | Ga0501040_0668859 | 3300049576 | Unclassified | 751 |
| 504 | Ga0501041_0041348 | 3300049577 | Bacteria | 2800 |
| 505 | Ga0501042_0033767 | 3300049578 | Bacteria | 3628 |
| 506 | Ga0501042_0062229 | 3300049578 | Bacteria | 2667 |
| 507 | Ga0501042_0084775 | 3300049578 | Bacteria | 2272 |
| 508 | Ga0501042_0246819 | 3300049578 | Bacteria | 1288 |
| 509 | Ga0501042_0557219 | 3300049578 | Bacteria | 833 |
| 510 | Ga0501047_0061590 | 3300049581 | Bacteria | 3620 |
| 511 | Ga0501047_0076497 | 3300049581 | Bacteria | 3221 |
| 512 | Ga0501047_0199045 | 3300049581 | Bacteria | 1864 |
| 513 | Ga0501048_0050531 | 3300049582 | Bacteria | 2961 |
| 514 | Ga0501048_0201395 | 3300049582 | Bacteria | 1411 |
| 515 | Ga0501048_0523487 | 3300049582 | Bacteria | 850 |
| 516 | Ga0501067_0150215 | 3300049583 | Bacteria | 1298 |
| 517 | Ga0501070_0158483 | 3300049586 | Bacteria | 1866 |
| 518 | Ga0501070_0208757 | 3300049586 | Bacteria | 1603 |
| 519 | Ga0501070_0801896 | 3300049586 | Unclassified | 739 |
| 520 | Ga0501071_0100086 | 3300049587 | Bacteria | 2136 |
| 521 | Ga0501071_0128689 | 3300049587 | Bacteria | 1880 |
| 522 | Ga0501071_0240516 | 3300049587 | Bacteria | 1365 |
| 523 | Ga0501072_0010149 | 3300049588 | Bacteria | 7171 |
| 524 | Ga0501074_0097828 | 3300049590 | Bacteria | 2100 |
| 525 | Ga0501074_0359990 | 3300049590 | Bacteria | 1032 |
| 526 | Ga0501074_0361301 | 3300049590 | Bacteria | 1030 |
| 527 | Ga0501075_0151092 | 3300049591 | Bacteria | 1770 |
| 528 | Ga0501075_0157968 | 3300049591 | Bacteria | 1729 |
| 529 | Ga0501076_0043911 | 3300049592 | Bacteria | 3524 |
| 530 | Ga0501076_0052178 | 3300049592 | Bacteria | 3239 |
| 531 | Ga0501079_0049546 | 3300049741 | Bacteria | 3242 |
| 532 | Ga0501079_0399968 | 3300049741 | Bacteria | 1077 |
| 533 | Ga0501079_0596192 | 3300049741 | Bacteria | 869 |
| 534 | Ga0501080_0458977 | 3300049742 | Bacteria | 1141 |
| 535 | Ga0501081_0072804 | 3300049743 | Bacteria | 2396 |
| 536 | Ga0501081_0087548 | 3300049743 | Bacteria | 2188 |
| 537 | Ga0501081_0394052 | 3300049743 | Bacteria | 1025 |
| 538 | Ga0501083_0013469 | 3300049744 | Bacteria | 5715 |
| 539 | Ga0501083_0025951 | 3300049744 | Bacteria | 4054 |
| 540 | Ga0501035_0126212 | 3300049822 | Bacteria | 2234 |
| 541 | Ga0501035_0537841 | 3300049822 | Bacteria | 958 |
| 542 | Ga0501035_0568219 | 3300049822 | Bacteria | 927 |
| 543 | Ga0501044_0021243 | 3300049823 | Bacteria | 6929 |
| 544 | Ga0501044_0368048 | 3300049823 | Bacteria | 1354 |
| 545 | Ga0501045_0046940 | 3300049824 | Bacteria | 3145 |
| 546 | Ga0501045_0096873 | 3300049824 | Bacteria | 2183 |
| 547 | Ga0501045_0158213 | 3300049824 | Bacteria | 1686 |
| 548 | nmdc:mga00v17_126142_c1 | 3300050491 | Bacteria | 1633 |
| 549 | nmdc:mga00v17_132396_c1 | 3300050491 | Bacteria | 1594 |
| 550 | nmdc:mga00v17_301783_c1 | 3300050491 | Bacteria | 1040 |
| 551 | nmdc:mga00v17_322826_c1 | 3300050491 | Bacteria | 1003 |
| 552 | nmdc:mga00v17_80265_c1 | 3300050491 | Bacteria | 2036 |
| 553 | nmdc:mga00v17_91224_c1 | 3300050491 | Bacteria | 1053 |
| 554 | nmdc:mga0yw44_1227_c1 | 3300050492 | Bacteria | 10057 |
| 555 | nmdc:mga0yw44_8217_c1 | 3300050492 | Bacteria | 5186 |
| 556 | nmdc:mga06z11_175335_c1 | 3300050494 | Unclassified | 1233 |
| 557 | nmdc:mga06z11_229377_c1 | 3300050494 | Bacteria | 1087 |
| 558 | nmdc:mga05p37_160309_c1 | 3300050507 | Bacteria | 2748 |
| 559 | nmdc:mga05p37_242619_c1 | 3300050507 | Bacteria | 2165 |
| 560 | nmdc:mga05p37_343611_c1 | 3300050507 | Bacteria | 1759 |
| 561 | nmdc:mga05p37_576969_c1 | 3300050507 | Bacteria | 1274 |
| 562 | nmdc:mga05p37_780875_c1 | 3300050507 | Bacteria | 1048 |
| 563 | nmdc:mga05p37_922316_c1 | 3300050507 | Bacteria | 939 |
| 564 | nmdc:mga09592_20196_c1 | 3300050508 | Bacteria | 5474 |
| 565 | nmdc:mga09592_366988_c1 | 3300050508 | Bacteria | 1245 |
| 566 | nmdc:mga0qj67_186845_c1 | 3300050509 | Bacteria | 1683 |
| 567 | nmdc:mga0qj67_251293_c1 | 3300050509 | Bacteria | 1435 |
| 568 | nmdc:mga06r32_115058_c1 | 3300050510 | Bacteria | 2648 |
| 569 | nmdc:mga06r32_133354_c1 | 3300050510 | Bacteria | 2458 |
| 570 | nmdc:mga06r32_137843_c1 | 3300050510 | Bacteria | 2415 |
| 571 | nmdc:mga06r32_491359_c1 | 3300050510 | Bacteria | 1205 |
| 572 | nmdc:mga08y16_212067_c1 | 3300050511 | Bacteria | 2006 |
| 573 | nmdc:mga08y16_336891_c1 | 3300050511 | Bacteria | 1551 |
| 574 | nmdc:mga08y16_66629_c1 | 3300050511 | Bacteria | 3758 |
| 575 | nmdc:mga08y16_69250_c1 | 3300050511 | Bacteria | 3678 |
| 576 | nmdc:mga0n895_241244_c1 | 3300050512 | Bacteria | 1834 |
| 577 | nmdc:mga0a205_101539_c1 | 3300050515 | Bacteria | 2775 |
| 578 | nmdc:mga0a205_226631_c1 | 3300050515 | Bacteria | 1753 |
| 579 | Ga0495601_0000065 | 3300053077 | Bacteria | 58386 |
| 580 | Ga0495601_0019078 | 3300053077 | Bacteria | 4179 |
| 581 | Ga0495601_0150356 | 3300053077 | Bacteria | 1520 |
| 582 | Ga0495612_0004181 | 3300053078 | Bacteria | 5986 |
| 583 | Ga0495655_0000013 | 3300053083 | Bacteria | 63264 |
| 584 | Ga0495655_0001612 | 3300053083 | Bacteria | 3478 |
| 585 | Ga0495595_0000005 | 3300053084 | Bacteria | 258660 |
| 586 | Ga0495595_0029416 | 3300053084 | Bacteria | 2459 |
| 587 | Ga0495595_0140061 | 3300053084 | Bacteria | 1186 |
| 588 | Ga0495619_0000069 | 3300053085 | Bacteria | 82755 |
| 589 | Ga0495619_0000489 | 3300053085 | Bacteria | 26595 |
| 590 | Ga0495619_0001068 | 3300053085 | Bacteria | 17953 |
| 591 | Ga0495619_0003847 | 3300053085 | Bacteria | 9666 |
| 592 | Ga0500566_0001523 | 3300053094 | Bacteria | 13612 |
| 593 | Ga0500628_000045 | 3300053129 | Bacteria | 45042 |
| 594 | Ga0500658_0016931 | 3300053134 | Bacteria | 2719 |
| 595 | Ga0500568_0111496 | 3300053139 | Bacteria | 1022 |
| 596 | Ga0501084_0087286 | 3300054114 | Bacteria | 2619 |
| 597 | Ga0501084_0107519 | 3300054114 | Bacteria | 2343 |
| 598 | Ga0501084_0290107 | 3300054114 | Bacteria | 1382 |
| 599 | Ga0590071_010548 | 3300059421 | Bacteria | 2164 |
| 600 | Ga0501082_0043605 | 3300060353 | Bacteria | 3868 |
| 601 | Ga0501082_0089866 | 3300060353 | Bacteria | 2652 |
| 602 | Ga0501082_0201129 | 3300060353 | Bacteria | 1733 |
| 603 | Ga0501082_0896419 | 3300060353 | Bacteria | 776 |
| 604 | Ga0530510_0009741 | 3300061734 | Bacteria | 6742 |
| 605 | Ga0530510_0069251 | 3300061734 | Bacteria | 2560 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046476 | Ga0495662_0217386 | Ga0495662_0217386_423_926 | 159 |
| 2 | 3300046476 | Ga0495662_0437372 | Ga0495662_0437372_118_621 | 159 |
| 3 | 3300005937 | Ga0081455_10011025 | Ga0081455_100110259 | 190 |
| 4 | 3300048905 | Ga0496102_0442318 | Ga0496102_0442318_406_1020 | 190 |
| 5 | 3300006847 | Ga0075431_100128099 | Ga0075431_1001280992 | 191 |
| 6 | 3300006871 | Ga0075434_100034388 | Ga0075434_1000343886 | 191 |
| 7 | 3300009147 | Ga0114129_10087401 | Ga0114129_100874012 | 191 |
| 8 | 3300048912 | Ga0496109_0193960 | Ga0496109_0193960_996_1613 | 191 |
| 9 | 3300050507 | nmdc:mga05p37_780875_c1 | nmdc:mga05p37_780875_c1_400_1032 | 191 |
| 10 | 3300050510 | nmdc:mga06r32_133354_c1 | nmdc:mga06r32_133354_c1_1772_2404 | 191 |
| 11 | 3300050511 | nmdc:mga08y16_69250_c1 | nmdc:mga08y16_69250_c1_1355_1987 | 191 |
| 12 | 3300005937 | Ga0081455_10163236 | Ga0081455_101632363 | 192 |
| 13 | 3300006051 | Ga0075364_10304670 | Ga0075364_103046702 | 192 |
| 14 | 3300042003 | Ga0439443_032238 | Ga0439443_032238_126_800 | 192 |
| 15 | 3300050494 | nmdc:mga06z11_229377_c1 | nmdc:mga06z11_229377_c1_458_1075 | 192 |
| 16 | 3300005459 | Ga0068867_100003683 | Ga0068867_1000036838 | 193 |
| 17 | 3300005937 | Ga0081455_10094536 | Ga0081455_100945363 | 193 |
| 18 | 3300005981 | Ga0081538_10077500 | Ga0081538_100775002 | 193 |
| 19 | 3300005983 | Ga0081540_1000553 | Ga0081540_100055344 | 193 |
| 20 | 3300005985 | Ga0081539_10053821 | Ga0081539_100538211 | 193 |
| 21 | 3300006051 | Ga0075364_10147590 | Ga0075364_101475903 | 193 |
| 22 | 3300009098 | Ga0105245_10174160 | Ga0105245_101741604 | 193 |
| 23 | 3300025927 | Ga0207687_10110444 | Ga0207687_101104444 | 193 |
| 24 | 3300026089 | Ga0207648_10005232 | Ga0207648_1000523212 | 193 |
| 25 | 3300037418 | Ga0395900_0584307 | Ga0395900_0584307_280_948 | 193 |
| 26 | 3300038443 | Ga0395901_0045141 | Ga0395901_0045141_832_1506 | 193 |
| 27 | 3300049576 | Ga0501040_0254900 | Ga0501040_0254900_557_1216 | 193 |
| 28 | 3300050491 | nmdc:mga00v17_132396_c1 | nmdc:mga00v17_132396_c1_726_1379 | 193 |
| 29 | 3300009551 | Ga0105238_10231599 | Ga0105238_102315993 | 194 |
| 30 | 3300025920 | Ga0207649_10158646 | Ga0207649_101586462 | 194 |
| 31 | 3300025924 | Ga0207694_10452250 | Ga0207694_104522502 | 194 |
| 32 | 3300035725 | Ga0373947_0477718 | Ga0373947_0477718_112_729 | 194 |
| 33 | 3300038443 | Ga0395901_0699217 | Ga0395901_0699217_175_792 | 194 |
| 34 | 3300046517 | Ga0495630_0000395 | Ga0495630_0000395_31858_32478 | 194 |
| 35 | 3300046529 | Ga0495652_0319637 | Ga0495652_0319637_154_774 | 194 |
| 36 | 3300046642 | Ga0495634_0000993 | Ga0495634_0000993_16789_17400 | 194 |
| 37 | 3300046642 | Ga0495634_0133082 | Ga0495634_0133082_621_1238 | 194 |
| 38 | 3300046678 | Ga0495599_0290938 | Ga0495599_0290938_62_682 | 194 |
| 39 | 3300047322 | Ga0495680_0104929 | Ga0495680_0104929_1020_1640 | 194 |
| 40 | 3300047471 | Ga0495684_0101777 | Ga0495684_0101777_1315_1932 | 194 |
| 41 | 3300053077 | Ga0495601_0019078 | Ga0495601_0019078_908_1528 | 194 |
| 42 | 3300053085 | Ga0495619_0001068 | Ga0495619_0001068_14612_15229 | 194 |
| 43 | 3300053085 | Ga0495619_0003847 | Ga0495619_0003847_7256_7876 | 194 |
| 44 | 3300060353 | Ga0501082_0896419 | Ga0501082_0896419_44_685 | 194 |
| 45 | 3300002074 | JGI24748J21848_1000332 | JGI24748J21848_10003325 | 195 |
| 46 | 3300002239 | JGI24034J26672_10000068 | JGI24034J26672_1000006826 | 195 |
| 47 | 3300002244 | JGI24742J22300_10000389 | JGI24742J22300_100003894 | 195 |
| 48 | 3300006038 | Ga0075365_10233250 | Ga0075365_102332502 | 195 |
| 49 | 3300006051 | Ga0075364_10365607 | Ga0075364_103656072 | 195 |
| 50 | 3300006358 | Ga0068871_100525748 | Ga0068871_1005257482 | 195 |
| 51 | 3300009148 | Ga0105243_10171682 | Ga0105243_101716823 | 195 |
| 52 | 3300050491 | nmdc:mga00v17_322826_c1 | nmdc:mga00v17_322826_c1_98_778 | 195 |
| 53 | 3300050491 | nmdc:mga00v17_80265_c1 | nmdc:mga00v17_80265_c1_515_1195 | 195 |
| 54 | 3300037466 | Ga0395898_0352683 | Ga0395898_0352683_18_644 | 196 |
| 55 | 3300048909 | Ga0496106_0083694 | Ga0496106_0083694_1419_2144 | 196 |
| 56 | 3300005331 | Ga0070670_101031762 | Ga0070670_1010317621 | 198 |
| 57 | 3300005338 | Ga0068868_100862139 | Ga0068868_1008621392 | 198 |
| 58 | 3300005564 | Ga0070664_100633711 | Ga0070664_1006337111 | 198 |
| 59 | 3300013297 | Ga0157378_10297293 | Ga0157378_102972933 | 198 |
| 60 | 3300014325 | Ga0163163_10461850 | Ga0163163_104618503 | 198 |
| 61 | 3300014969 | Ga0157376_10028182 | Ga0157376_100281826 | 198 |
| 62 | 3300025925 | Ga0207650_10667621 | Ga0207650_106676212 | 198 |
| 63 | 3300025945 | Ga0207679_10064235 | Ga0207679_100642353 | 198 |
| 64 | 3300037471 | Ga0395905_0441187 | Ga0395905_0441187_356_967 | 198 |
| 65 | 3300037471 | Ga0395905_0712536 | Ga0395905_0712536_189_800 | 198 |
| 66 | 3300038443 | Ga0395901_0252586 | Ga0395901_0252586_941_1552 | 198 |
| 67 | 3300048908 | Ga0496105_0055620 | Ga0496105_0055620_1466_2092 | 198 |
| 68 | 3300048912 | Ga0496109_0199889 | Ga0496109_0199889_1186_1797 | 198 |
| 69 | 3300048912 | Ga0496109_0213119 | Ga0496109_0213119_965_1576 | 198 |
| 70 | 3300048913 | Ga0496110_0049274 | Ga0496110_0049274_1307_1918 | 198 |
| 71 | 3300048915 | Ga0496112_0725603 | Ga0496112_0725603_202_813 | 198 |
| 72 | 3300048916 | Ga0496113_0231495 | Ga0496113_0231495_175_786 | 198 |
| 73 | 3300048922 | Ga0496119_0011836 | Ga0496119_0011836_1325_1951 | 198 |
| 74 | 3300048924 | Ga0496121_0042207 | Ga0496121_0042207_2218_2844 | 198 |
| 75 | 3300048928 | Ga0496125_0149885 | Ga0496125_0149885_718_1344 | 198 |
| 76 | 3300049572 | Ga0501036_0583032 | Ga0501036_0583032_200_880 | 198 |
| 77 | 3300049586 | Ga0501070_0801896 | Ga0501070_0801896_17_643 | 198 |
| 78 | 3300049590 | Ga0501074_0361301 | Ga0501074_0361301_249_935 | 198 |
| 79 | 3300049822 | Ga0501035_0537841 | Ga0501035_0537841_102_728 | 198 |
| 80 | 3300050510 | nmdc:mga06r32_115058_c1 | nmdc:mga06r32_115058_c1_1901_2509 | 198 |
| 81 | 3300005549 | Ga0070704_100451731 | Ga0070704_1004517311 | 199 |
| 82 | 3300048912 | Ga0496109_0047839 | Ga0496109_0047839_2671_3396 | 199 |
| 83 | 3300005441 | Ga0070700_100657995 | Ga0070700_1006579951 | 201 |
| 84 | 3300005614 | Ga0068856_100007453 | Ga0068856_1000074535 | 201 |
| 85 | 3300005719 | Ga0068861_100328039 | Ga0068861_1003280391 | 201 |
| 86 | 3300005937 | Ga0081455_10010355 | Ga0081455_100103557 | 201 |
| 87 | 3300006048 | Ga0075363_100165933 | Ga0075363_1001659332 | 201 |
| 88 | 3300026078 | Ga0207702_10006219 | Ga0207702_1000621912 | 201 |
| 89 | 3300046683 | Ga0495658_0001193 | Ga0495658_0001193_1307_1918 | 201 |
| 90 | 3300048911 | Ga0496108_0000042 | Ga0496108_0000042_126314_126925 | 201 |
| 91 | 3300048912 | Ga0496109_0000034 | Ga0496109_0000034_158953_159564 | 201 |
| 92 | 3300049591 | Ga0501075_0157968 | Ga0501075_0157968_89_823 | 201 |
| 93 | 3300049822 | Ga0501035_0568219 | Ga0501035_0568219_134_868 | 201 |
| 94 | 3300054114 | Ga0501084_0290107 | Ga0501084_0290107_113_847 | 201 |
| 95 | 3300003373 | JGI25407J50210_10001250 | JGI25407J50210_100012503 | 202 |
| 96 | 3300003373 | JGI25407J50210_10002048 | JGI25407J50210_100020486 | 202 |
| 97 | 3300003373 | JGI25407J50210_10002196 | JGI25407J50210_100021961 | 202 |
| 98 | 3300003373 | JGI25407J50210_10007914 | JGI25407J50210_100079143 | 202 |
| 99 | 3300005329 | Ga0070683_100620967 | Ga0070683_1006209672 | 202 |
| 100 | 3300005331 | Ga0070670_100085569 | Ga0070670_1000855694 | 202 |
| 101 | 3300005336 | Ga0070680_100002655 | Ga0070680_1000026559 | 202 |
| 102 | 3300005344 | Ga0070661_100082633 | Ga0070661_1000826335 | 202 |
| 103 | 3300005345 | Ga0070692_10087921 | Ga0070692_100879212 | 202 |
| 104 | 3300005345 | Ga0070692_10506087 | Ga0070692_105060871 | 202 |
| 105 | 3300005347 | Ga0070668_100198128 | Ga0070668_1001981282 | 202 |
| 106 | 3300005356 | Ga0070674_100003700 | Ga0070674_1000037004 | 202 |
| 107 | 3300005365 | Ga0070688_100002914 | Ga0070688_1000029146 | 202 |
| 108 | 3300005366 | Ga0070659_100004067 | Ga0070659_1000040675 | 202 |
| 109 | 3300005367 | Ga0070667_100001611 | Ga0070667_10000161128 | 202 |
| 110 | 3300005441 | Ga0070700_100279103 | Ga0070700_1002791033 | 202 |
| 111 | 3300005441 | Ga0070700_100422397 | Ga0070700_1004223971 | 202 |
| 112 | 3300005455 | Ga0070663_100354826 | Ga0070663_1003548261 | 202 |
| 113 | 3300005458 | Ga0070681_10002266 | Ga0070681_1000226613 | 202 |
| 114 | 3300005458 | Ga0070681_10240863 | Ga0070681_102408633 | 202 |
| 115 | 3300005459 | Ga0068867_100389792 | Ga0068867_1003897922 | 202 |
| 116 | 3300005466 | Ga0070685_10001772 | Ga0070685_100017725 | 202 |
| 117 | 3300005530 | Ga0070679_100036793 | Ga0070679_1000367935 | 202 |
| 118 | 3300005535 | Ga0070684_100024708 | Ga0070684_1000247084 | 202 |
| 119 | 3300005535 | Ga0070684_100115588 | Ga0070684_1001155884 | 202 |
| 120 | 3300005539 | Ga0068853_100005341 | Ga0068853_1000053413 | 202 |
| 121 | 3300005548 | Ga0070665_100851965 | Ga0070665_1008519652 | 202 |
| 122 | 3300005564 | Ga0070664_100083028 | Ga0070664_1000830282 | 202 |
| 123 | 3300005578 | Ga0068854_100151099 | Ga0068854_1001510993 | 202 |
| 124 | 3300005578 | Ga0068854_100846022 | Ga0068854_1008460222 | 202 |
| 125 | 3300005614 | Ga0068856_100031746 | Ga0068856_1000317464 | 202 |
| 126 | 3300005614 | Ga0068856_100174723 | Ga0068856_1001747232 | 202 |
| 127 | 3300005615 | Ga0070702_100599186 | Ga0070702_1005991861 | 202 |
| 128 | 3300005616 | Ga0068852_100001042 | Ga0068852_10000104217 | 202 |
| 129 | 3300005616 | Ga0068852_100050655 | Ga0068852_1000506554 | 202 |
| 130 | 3300005719 | Ga0068861_100155163 | Ga0068861_1001551633 | 202 |
| 131 | 3300005843 | Ga0068860_100166222 | Ga0068860_1001662223 | 202 |
| 132 | 3300005844 | Ga0068862_100001247 | Ga0068862_10000124728 | 202 |
| 133 | 3300005844 | Ga0068862_101052156 | Ga0068862_1010521561 | 202 |
| 134 | 3300005937 | Ga0081455_10011092 | Ga0081455_1001109219 | 202 |
| 135 | 3300005937 | Ga0081455_10257704 | Ga0081455_102577042 | 202 |
| 136 | 3300005937 | Ga0081455_10268855 | Ga0081455_102688552 | 202 |
| 137 | 3300005937 | Ga0081455_10295633 | Ga0081455_102956332 | 202 |
| 138 | 3300005981 | Ga0081538_10001771 | Ga0081538_1000177120 | 202 |
| 139 | 3300005981 | Ga0081538_10003058 | Ga0081538_100030589 | 202 |
| 140 | 3300005981 | Ga0081538_10003213 | Ga0081538_1000321312 | 202 |
| 141 | 3300005981 | Ga0081538_10004998 | Ga0081538_100049986 | 202 |
| 142 | 3300005981 | Ga0081538_10005868 | Ga0081538_1000586813 | 202 |
| 143 | 3300005981 | Ga0081538_10008306 | Ga0081538_1000830617 | 202 |
| 144 | 3300005981 | Ga0081538_10031989 | Ga0081538_100319896 | 202 |
| 145 | 3300005981 | Ga0081538_10044033 | Ga0081538_100440335 | 202 |
| 146 | 3300005981 | Ga0081538_10059993 | Ga0081538_100599933 | 202 |
| 147 | 3300005981 | Ga0081538_10084777 | Ga0081538_100847772 | 202 |
| 148 | 3300005981 | Ga0081538_10085553 | Ga0081538_100855531 | 202 |
| 149 | 3300005981 | Ga0081538_10133600 | Ga0081538_101336002 | 202 |
| 150 | 3300005981 | Ga0081538_10148825 | Ga0081538_101488252 | 202 |
| 151 | 3300006038 | Ga0075365_10000565 | Ga0075365_100005655 | 202 |
| 152 | 3300006051 | Ga0075364_10020535 | Ga0075364_100205353 | 202 |
| 153 | 3300006178 | Ga0075367_10174856 | Ga0075367_101748562 | 202 |
| 154 | 3300006844 | Ga0075428_100059133 | Ga0075428_1000591336 | 202 |
| 155 | 3300006844 | Ga0075428_100456441 | Ga0075428_1004564411 | 202 |
| 156 | 3300006846 | Ga0075430_100016384 | Ga0075430_1000163846 | 202 |
| 157 | 3300006847 | Ga0075431_100271416 | Ga0075431_1002714163 | 202 |
| 158 | 3300006880 | Ga0075429_100121873 | Ga0075429_1001218731 | 202 |
| 159 | 3300006881 | Ga0068865_100000056 | Ga0068865_10000005617 | 202 |
| 160 | 3300009093 | Ga0105240_10067591 | Ga0105240_100675916 | 202 |
| 161 | 3300009094 | Ga0111539_10239303 | Ga0111539_102393034 | 202 |
| 162 | 3300009094 | Ga0111539_10243969 | Ga0111539_102439693 | 202 |
| 163 | 3300009094 | Ga0111539_10466319 | Ga0111539_104663192 | 202 |
| 164 | 3300009098 | Ga0105245_10000528 | Ga0105245_1000052845 | 202 |
| 165 | 3300009098 | Ga0105245_10725480 | Ga0105245_107254802 | 202 |
| 166 | 3300009147 | Ga0114129_10094967 | Ga0114129_100949675 | 202 |
| 167 | 3300009147 | Ga0114129_10127157 | Ga0114129_101271574 | 202 |
| 168 | 3300009147 | Ga0114129_10165092 | Ga0114129_101650922 | 202 |
| 169 | 3300009147 | Ga0114129_11133455 | Ga0114129_111334552 | 202 |
| 170 | 3300009148 | Ga0105243_10200695 | Ga0105243_102006953 | 202 |
| 171 | 3300009148 | Ga0105243_10367335 | Ga0105243_103673352 | 202 |
| 172 | 3300009177 | Ga0105248_10001735 | Ga0105248_1000173525 | 202 |
| 173 | 3300009553 | Ga0105249_10003640 | Ga0105249_100036405 | 202 |
| 174 | 3300010375 | Ga0105239_10965151 | Ga0105239_109651511 | 202 |
| 175 | 3300011119 | Ga0105246_10175137 | Ga0105246_101751373 | 202 |
| 176 | 3300013104 | Ga0157370_10005533 | Ga0157370_1000553312 | 202 |
| 177 | 3300013105 | Ga0157369_10000068 | Ga0157369_10000068153 | 202 |
| 178 | 3300013105 | Ga0157369_10066099 | Ga0157369_100660992 | 202 |
| 179 | 3300013307 | Ga0157372_10007045 | Ga0157372_1000704512 | 202 |
| 180 | 3300014968 | Ga0157379_10087707 | Ga0157379_100877073 | 202 |
| 181 | 3300014969 | Ga0157376_10164943 | Ga0157376_101649433 | 202 |
| 182 | 3300017792 | Ga0163161_10054996 | Ga0163161_100549962 | 202 |
| 183 | 3300020069 | Ga0197907_10671781 | Ga0197907_106717812 | 202 |
| 184 | 3300020070 | Ga0206356_11300597 | Ga0206356_113005972 | 202 |
| 185 | 3300020082 | Ga0206353_11509509 | Ga0206353_115095097 | 202 |
| 186 | 3300025911 | Ga0207654_10054051 | Ga0207654_100540513 | 202 |
| 187 | 3300025912 | Ga0207707_10005637 | Ga0207707_1000563721 | 202 |
| 188 | 3300025913 | Ga0207695_10251205 | Ga0207695_102512051 | 202 |
| 189 | 3300025913 | Ga0207695_10479024 | Ga0207695_104790242 | 202 |
| 190 | 3300025917 | Ga0207660_10023884 | Ga0207660_100238845 | 202 |
| 191 | 3300025920 | Ga0207649_10057089 | Ga0207649_100570894 | 202 |
| 192 | 3300025921 | Ga0207652_10009613 | Ga0207652_100096135 | 202 |
| 193 | 3300025921 | Ga0207652_10168460 | Ga0207652_101684602 | 202 |
| 194 | 3300025925 | Ga0207650_10043384 | Ga0207650_100433846 | 202 |
| 195 | 3300025927 | Ga0207687_10000025 | Ga0207687_1000002511 | 202 |
| 196 | 3300025927 | Ga0207687_10206679 | Ga0207687_102066793 | 202 |
| 197 | 3300025932 | Ga0207690_10001935 | Ga0207690_100019356 | 202 |
| 198 | 3300025935 | Ga0207709_10319971 | Ga0207709_103199711 | 202 |
| 199 | 3300025937 | Ga0207669_10005898 | Ga0207669_100058988 | 202 |
| 200 | 3300025937 | Ga0207669_10329950 | Ga0207669_103299502 | 202 |
| 201 | 3300025938 | Ga0207704_10011990 | Ga0207704_100119904 | 202 |
| 202 | 3300025941 | Ga0207711_10000011 | Ga0207711_1000001124 | 202 |
| 203 | 3300025944 | Ga0207661_10002381 | Ga0207661_1000238112 | 202 |
| 204 | 3300025944 | Ga0207661_10002385 | Ga0207661_100023855 | 202 |
| 205 | 3300025945 | Ga0207679_10069455 | Ga0207679_100694556 | 202 |
| 206 | 3300025945 | Ga0207679_10312940 | Ga0207679_103129402 | 202 |
| 207 | 3300025961 | Ga0207712_10003459 | Ga0207712_1000345917 | 202 |
| 208 | 3300025972 | Ga0207668_10002563 | Ga0207668_100025632 | 202 |
| 209 | 3300025972 | Ga0207668_10173476 | Ga0207668_101734762 | 202 |
| 210 | 3300025986 | Ga0207658_10000840 | Ga0207658_1000084010 | 202 |
| 211 | 3300026041 | Ga0207639_10026393 | Ga0207639_100263932 | 202 |
| 212 | 3300026067 | Ga0207678_10155956 | Ga0207678_101559562 | 202 |
| 213 | 3300026075 | Ga0207708_10243745 | Ga0207708_102437452 | 202 |
| 214 | 3300026078 | Ga0207702_10015335 | Ga0207702_100153354 | 202 |
| 215 | 3300026078 | Ga0207702_10135029 | Ga0207702_101350292 | 202 |
| 216 | 3300026089 | Ga0207648_10066179 | Ga0207648_100661793 | 202 |
| 217 | 3300026089 | Ga0207648_11012616 | Ga0207648_110126162 | 202 |
| 218 | 3300026118 | Ga0207675_100087831 | Ga0207675_1000878313 | 202 |
| 219 | 3300026118 | Ga0207675_100862903 | Ga0207675_1008629032 | 202 |
| 220 | 3300026118 | Ga0207675_100941842 | Ga0207675_1009418422 | 202 |
| 221 | 3300026142 | Ga0207698_10000014 | Ga0207698_1000001442 | 202 |
| 222 | 3300026142 | Ga0207698_10054216 | Ga0207698_100542164 | 202 |
| 223 | 3300027907 | Ga0207428_10039587 | Ga0207428_100395872 | 202 |
| 224 | 3300028380 | Ga0268265_10005115 | Ga0268265_100051157 | 202 |
| 225 | 3300028380 | Ga0268265_10944848 | Ga0268265_109448482 | 202 |
| 226 | 3300028381 | Ga0268264_10023259 | Ga0268264_100232593 | 202 |
| 227 | 3300031731 | Ga0307405_10095388 | Ga0307405_100953883 | 202 |
| 228 | 3300031731 | Ga0307405_10814437 | Ga0307405_108144372 | 202 |
| 229 | 3300031824 | Ga0307413_10494430 | Ga0307413_104944302 | 202 |
| 230 | 3300031903 | Ga0307407_10326879 | Ga0307407_103268792 | 202 |
| 231 | 3300031995 | Ga0307409_100117811 | Ga0307409_1001178113 | 202 |
| 232 | 3300031995 | Ga0307409_100245144 | Ga0307409_1002451443 | 202 |
| 233 | 3300031995 | Ga0307409_100465396 | Ga0307409_1004653962 | 202 |
| 234 | 3300032002 | Ga0307416_100619015 | Ga0307416_1006190152 | 202 |
| 235 | 3300032126 | Ga0307415_100752719 | Ga0307415_1007527192 | 202 |
| 236 | 3300035121 | Ga0373960_0005767 | Ga0373960_0005767_670_1293 | 202 |
| 237 | 3300035242 | Ga0373962_0022030 | Ga0373962_0022030_77_700 | 202 |
| 238 | 3300038443 | Ga0395901_0100695 | Ga0395901_0100695_1376_1999 | 202 |
| 239 | 3300038443 | Ga0395901_0399211 | Ga0395901_0399211_100_744 | 202 |
| 240 | 3300042005 | Ga0439448_0096937 | Ga0439448_0096937_19_642 | 202 |
| 241 | 3300042439 | Ga0439464_0012359 | Ga0439464_0012359_1284_1907 | 202 |
| 242 | 3300044694 | Ga0466963_0390591 | Ga0466963_0390591_194_808 | 202 |
| 243 | 3300045976 | Ga0466967_0900267 | Ga0466967_0900267_14_649 | 202 |
| 244 | 3300046492 | Ga0495585_0154277 | Ga0495585_0154277_366_989 | 202 |
| 245 | 3300046500 | Ga0495596_0039775 | Ga0495596_0039775_82_705 | 202 |
| 246 | 3300046500 | Ga0495596_0048803 | Ga0495596_0048803_211_825 | 202 |
| 247 | 3300046518 | Ga0495631_0074288 | Ga0495631_0074288_20_643 | 202 |
| 248 | 3300046520 | Ga0495637_0075343 | Ga0495637_0075343_168_791 | 202 |
| 249 | 3300046523 | Ga0495644_0170311 | Ga0495644_0170311_56_679 | 202 |
| 250 | 3300046523 | Ga0495644_0233003 | Ga0495644_0233003_58_681 | 202 |
| 251 | 3300046558 | Ga0495633_0118628 | Ga0495633_0118628_361_984 | 202 |
| 252 | 3300046794 | Ga0495589_0073363 | Ga0495589_0073363_767_1390 | 202 |
| 253 | 3300048913 | Ga0496110_0330688 | Ga0496110_0330688_510_1124 | 202 |
| 254 | 3300049568 | Ga0501031_0233054 | Ga0501031_0233054_455_1078 | 202 |
| 255 | 3300049570 | Ga0501033_0386891 | Ga0501033_0386891_336_959 | 202 |
| 256 | 3300049572 | Ga0501036_0137584 | Ga0501036_0137584_369_992 | 202 |
| 257 | 3300049575 | Ga0501039_0074862 | Ga0501039_0074862_1667_2290 | 202 |
| 258 | 3300049576 | Ga0501040_0032892 | Ga0501040_0032892_1289_1912 | 202 |
| 259 | 3300049577 | Ga0501041_0041348 | Ga0501041_0041348_732_1355 | 202 |
| 260 | 3300049578 | Ga0501042_0033767 | Ga0501042_0033767_2429_3052 | 202 |
| 261 | 3300049578 | Ga0501042_0062229 | Ga0501042_0062229_1237_1860 | 202 |
| 262 | 3300049581 | Ga0501047_0061590 | Ga0501047_0061590_1965_2606 | 202 |
| 263 | 3300049582 | Ga0501048_0050531 | Ga0501048_0050531_527_1150 | 202 |
| 264 | 3300049582 | Ga0501048_0523487 | Ga0501048_0523487_33_656 | 202 |
| 265 | 3300049583 | Ga0501067_0150215 | Ga0501067_0150215_213_836 | 202 |
| 266 | 3300049587 | Ga0501071_0100086 | Ga0501071_0100086_670_1311 | 202 |
| 267 | 3300049587 | Ga0501071_0240516 | Ga0501071_0240516_345_968 | 202 |
| 268 | 3300049590 | Ga0501074_0097828 | Ga0501074_0097828_449_1090 | 202 |
| 269 | 3300049590 | Ga0501074_0359990 | Ga0501074_0359990_88_711 | 202 |
| 270 | 3300049591 | Ga0501075_0151092 | Ga0501075_0151092_585_1208 | 202 |
| 271 | 3300049741 | Ga0501079_0049546 | Ga0501079_0049546_2441_3064 | 202 |
| 272 | 3300049741 | Ga0501079_0399968 | Ga0501079_0399968_111_734 | 202 |
| 273 | 3300049741 | Ga0501079_0596192 | Ga0501079_0596192_26_667 | 202 |
| 274 | 3300049742 | Ga0501080_0458977 | Ga0501080_0458977_26_667 | 202 |
| 275 | 3300049743 | Ga0501081_0072804 | Ga0501081_0072804_448_1071 | 202 |
| 276 | 3300049743 | Ga0501081_0087548 | Ga0501081_0087548_70_693 | 202 |
| 277 | 3300049744 | Ga0501083_0025951 | Ga0501083_0025951_3258_3899 | 202 |
| 278 | 3300049823 | Ga0501044_0021243 | Ga0501044_0021243_970_1611 | 202 |
| 279 | 3300049824 | Ga0501045_0046940 | Ga0501045_0046940_1921_2544 | 202 |
| 280 | 3300049824 | Ga0501045_0158213 | Ga0501045_0158213_231_854 | 202 |
| 281 | 3300050491 | nmdc:mga00v17_301783_c1 | nmdc:mga00v17_301783_c1_16_657 | 202 |
| 282 | 3300050491 | nmdc:mga00v17_91224_c1 | nmdc:mga00v17_91224_c1_246_881 | 202 |
| 283 | 3300050492 | nmdc:mga0yw44_1227_c1 | nmdc:mga0yw44_1227_c1_6833_7468 | 202 |
| 284 | 3300050494 | nmdc:mga06z11_175335_c1 | nmdc:mga06z11_175335_c1_160_783 | 202 |
| 285 | 3300050507 | nmdc:mga05p37_160309_c1 | nmdc:mga05p37_160309_c1_1600_2223 | 202 |
| 286 | 3300050507 | nmdc:mga05p37_576969_c1 | nmdc:mga05p37_576969_c1_584_1207 | 202 |
| 287 | 3300050507 | nmdc:mga05p37_922316_c1 | nmdc:mga05p37_922316_c1_116_739 | 202 |
| 288 | 3300050508 | nmdc:mga09592_20196_c1 | nmdc:mga09592_20196_c1_62_718 | 202 |
| 289 | 3300050508 | nmdc:mga09592_366988_c1 | nmdc:mga09592_366988_c1_461_1084 | 202 |
| 290 | 3300050509 | nmdc:mga0qj67_251293_c1 | nmdc:mga0qj67_251293_c1_598_1254 | 202 |
| 291 | 3300050510 | nmdc:mga06r32_137843_c1 | nmdc:mga06r32_137843_c1_681_1337 | 202 |
| 292 | 3300050510 | nmdc:mga06r32_491359_c1 | nmdc:mga06r32_491359_c1_280_903 | 202 |
| 293 | 3300050511 | nmdc:mga08y16_212067_c1 | nmdc:mga08y16_212067_c1_266_889 | 202 |
| 294 | 3300050511 | nmdc:mga08y16_336891_c1 | nmdc:mga08y16_336891_c1_820_1443 | 202 |
| 295 | 3300050511 | nmdc:mga08y16_66629_c1 | nmdc:mga08y16_66629_c1_2277_2900 | 202 |
| 296 | 3300050512 | nmdc:mga0n895_241244_c1 | nmdc:mga0n895_241244_c1_909_1532 | 202 |
| 297 | 3300050515 | nmdc:mga0a205_101539_c1 | nmdc:mga0a205_101539_c1_1865_2488 | 202 |
| 298 | 3300050515 | nmdc:mga0a205_226631_c1 | nmdc:mga0a205_226631_c1_858_1481 | 202 |
| 299 | 3300054114 | Ga0501084_0107519 | Ga0501084_0107519_229_852 | 202 |
| 300 | 3300059421 | Ga0590071_010548 | Ga0590071_010548_1033_1656 | 202 |
| 301 | 3300060353 | Ga0501082_0089866 | Ga0501082_0089866_235_858 | 202 |
| 302 | 3300060353 | Ga0501082_0201129 | Ga0501082_0201129_197_820 | 202 |
| 303 | 3300061734 | Ga0530510_0009741 | Ga0530510_0009741_3662_4285 | 202 |
| 304 | 3300001979 | JGI24740J21852_10003124 | JGI24740J21852_1000312412 | 203 |
| 305 | 3300005329 | Ga0070683_100138936 | Ga0070683_1001389363 | 203 |
| 306 | 3300005329 | Ga0070683_100774059 | Ga0070683_1007740592 | 203 |
| 307 | 3300005330 | Ga0070690_100269847 | Ga0070690_1002698473 | 203 |
| 308 | 3300005330 | Ga0070690_100453756 | Ga0070690_1004537561 | 203 |
| 309 | 3300005335 | Ga0070666_10019547 | Ga0070666_100195476 | 203 |
| 310 | 3300005335 | Ga0070666_10696449 | Ga0070666_106964491 | 203 |
| 311 | 3300005337 | Ga0070682_100015047 | Ga0070682_1000150473 | 203 |
| 312 | 3300005337 | Ga0070682_100106785 | Ga0070682_1001067853 | 203 |
| 313 | 3300005337 | Ga0070682_100125847 | Ga0070682_1001258472 | 203 |
| 314 | 3300005338 | Ga0068868_100009889 | Ga0068868_1000098895 | 203 |
| 315 | 3300005338 | Ga0068868_100269192 | Ga0068868_1002691923 | 203 |
| 316 | 3300005340 | Ga0070689_100128041 | Ga0070689_1001280413 | 203 |
| 317 | 3300005341 | Ga0070691_10000257 | Ga0070691_1000025710 | 203 |
| 318 | 3300005344 | Ga0070661_100000236 | Ga0070661_10000023639 | 203 |
| 319 | 3300005354 | Ga0070675_100000930 | Ga0070675_10000093011 | 203 |
| 320 | 3300005366 | Ga0070659_100013450 | Ga0070659_1000134504 | 203 |
| 321 | 3300005367 | Ga0070667_100287165 | Ga0070667_1002871652 | 203 |
| 322 | 3300005435 | Ga0070714_100583970 | Ga0070714_1005839701 | 203 |
| 323 | 3300005436 | Ga0070713_100000171 | Ga0070713_10000017157 | 203 |
| 324 | 3300005439 | Ga0070711_100053395 | Ga0070711_1000533954 | 203 |
| 325 | 3300005444 | Ga0070694_100097215 | Ga0070694_1000972151 | 203 |
| 326 | 3300005455 | Ga0070663_100083061 | Ga0070663_1000830613 | 203 |
| 327 | 3300005455 | Ga0070663_100266823 | Ga0070663_1002668232 | 203 |
| 328 | 3300005456 | Ga0070678_100021818 | Ga0070678_1000218185 | 203 |
| 329 | 3300005456 | Ga0070678_100089186 | Ga0070678_1000891863 | 203 |
| 330 | 3300005459 | Ga0068867_100227734 | Ga0068867_1002277342 | 203 |
| 331 | 3300005466 | Ga0070685_10066247 | Ga0070685_100662472 | 203 |
| 332 | 3300005466 | Ga0070685_10183462 | Ga0070685_101834622 | 203 |
| 333 | 3300005466 | Ga0070685_10218804 | Ga0070685_102188042 | 203 |
| 334 | 3300005530 | Ga0070679_100000832 | Ga0070679_10000083235 | 203 |
| 335 | 3300005535 | Ga0070684_100697080 | Ga0070684_1006970801 | 203 |
| 336 | 3300005543 | Ga0070672_100000104 | Ga0070672_10000010437 | 203 |
| 337 | 3300005544 | Ga0070686_100036335 | Ga0070686_1000363352 | 203 |
| 338 | 3300005544 | Ga0070686_100172281 | Ga0070686_1001722812 | 203 |
| 339 | 3300005545 | Ga0070695_100128981 | Ga0070695_1001289812 | 203 |
| 340 | 3300005548 | Ga0070665_100777443 | Ga0070665_1007774431 | 203 |
| 341 | 3300005548 | Ga0070665_101137954 | Ga0070665_1011379542 | 203 |
| 342 | 3300005549 | Ga0070704_100414054 | Ga0070704_1004140542 | 203 |
| 343 | 3300005564 | Ga0070664_100027426 | Ga0070664_1000274265 | 203 |
| 344 | 3300005578 | Ga0068854_100014383 | Ga0068854_1000143839 | 203 |
| 345 | 3300005578 | Ga0068854_100414314 | Ga0068854_1004143142 | 203 |
| 346 | 3300005614 | Ga0068856_100816683 | Ga0068856_1008166831 | 203 |
| 347 | 3300005615 | Ga0070702_100204009 | Ga0070702_1002040093 | 203 |
| 348 | 3300005615 | Ga0070702_100580723 | Ga0070702_1005807231 | 203 |
| 349 | 3300005616 | Ga0068852_100048086 | Ga0068852_1000480865 | 203 |
| 350 | 3300005617 | Ga0068859_100398541 | Ga0068859_1003985412 | 203 |
| 351 | 3300005718 | Ga0068866_10140603 | Ga0068866_101406032 | 203 |
| 352 | 3300005719 | Ga0068861_100518363 | Ga0068861_1005183632 | 203 |
| 353 | 3300005834 | Ga0068851_10004857 | Ga0068851_100048576 | 203 |
| 354 | 3300005834 | Ga0068851_10047591 | Ga0068851_100475914 | 203 |
| 355 | 3300005840 | Ga0068870_10481152 | Ga0068870_104811521 | 203 |
| 356 | 3300005843 | Ga0068860_100492719 | Ga0068860_1004927193 | 203 |
| 357 | 3300005937 | Ga0081455_10030723 | Ga0081455_100307235 | 203 |
| 358 | 3300005937 | Ga0081455_10063369 | Ga0081455_100633693 | 203 |
| 359 | 3300005981 | Ga0081538_10000396 | Ga0081538_100003968 | 203 |
| 360 | 3300005981 | Ga0081538_10028056 | Ga0081538_100280566 | 203 |
| 361 | 3300005983 | Ga0081540_1082547 | Ga0081540_10825472 | 203 |
| 362 | 3300005985 | Ga0081539_10002195 | Ga0081539_1000219513 | 203 |
| 363 | 3300006038 | Ga0075365_10009057 | Ga0075365_100090574 | 203 |
| 364 | 3300006051 | Ga0075364_10055344 | Ga0075364_100553445 | 203 |
| 365 | 3300006163 | Ga0070715_10205567 | Ga0070715_102055672 | 203 |
| 366 | 3300006173 | Ga0070716_100135126 | Ga0070716_1001351262 | 203 |
| 367 | 3300006175 | Ga0070712_100003252 | Ga0070712_10000325219 | 203 |
| 368 | 3300006175 | Ga0070712_100014893 | Ga0070712_1000148935 | 203 |
| 369 | 3300006844 | Ga0075428_100022531 | Ga0075428_1000225316 | 203 |
| 370 | 3300006847 | Ga0075431_100008449 | Ga0075431_10000844920 | 203 |
| 371 | 3300006931 | Ga0097620_100398531 | Ga0097620_1003985312 | 203 |
| 372 | 3300009094 | Ga0111539_10094044 | Ga0111539_100940444 | 203 |
| 373 | 3300009094 | Ga0111539_10157492 | Ga0111539_101574922 | 203 |
| 374 | 3300009098 | Ga0105245_10014245 | Ga0105245_100142456 | 203 |
| 375 | 3300009098 | Ga0105245_10275687 | Ga0105245_102756873 | 203 |
| 376 | 3300009098 | Ga0105245_10427748 | Ga0105245_104277482 | 203 |
| 377 | 3300009101 | Ga0105247_10000064 | Ga0105247_10000064130 | 203 |
| 378 | 3300009101 | Ga0105247_10056313 | Ga0105247_100563133 | 203 |
| 379 | 3300009147 | Ga0114129_10050964 | Ga0114129_100509645 | 203 |
| 380 | 3300009147 | Ga0114129_10529424 | Ga0114129_105294243 | 203 |
| 381 | 3300009148 | Ga0105243_10080350 | Ga0105243_100803503 | 203 |
| 382 | 3300009148 | Ga0105243_10144764 | Ga0105243_101447642 | 203 |
| 383 | 3300009176 | Ga0105242_10000123 | Ga0105242_100001234 | 203 |
| 384 | 3300009176 | Ga0105242_10003277 | Ga0105242_1000327722 | 203 |
| 385 | 3300009176 | Ga0105242_10044398 | Ga0105242_100443983 | 203 |
| 386 | 3300009177 | Ga0105248_10074556 | Ga0105248_100745564 | 203 |
| 387 | 3300009553 | Ga0105249_10374126 | Ga0105249_103741262 | 203 |
| 388 | 3300011119 | Ga0105246_10974260 | Ga0105246_109742602 | 203 |
| 389 | 3300013102 | Ga0157371_10358486 | Ga0157371_103584862 | 203 |
| 390 | 3300013104 | Ga0157370_10059005 | Ga0157370_100590056 | 203 |
| 391 | 3300013104 | Ga0157370_10132352 | Ga0157370_101323522 | 203 |
| 392 | 3300013297 | Ga0157378_10030690 | Ga0157378_100306906 | 203 |
| 393 | 3300013297 | Ga0157378_10258957 | Ga0157378_102589572 | 203 |
| 394 | 3300013306 | Ga0163162_10322361 | Ga0163162_103223613 | 203 |
| 395 | 3300013307 | Ga0157372_10000809 | Ga0157372_100008094 | 203 |
| 396 | 3300013308 | Ga0157375_10008331 | Ga0157375_100083315 | 203 |
| 397 | 3300013308 | Ga0157375_10237203 | Ga0157375_102372032 | 203 |
| 398 | 3300014325 | Ga0163163_10197122 | Ga0163163_101971222 | 203 |
| 399 | 3300014325 | Ga0163163_10536951 | Ga0163163_105369512 | 203 |
| 400 | 3300014326 | Ga0157380_10000808 | Ga0157380_1000080812 | 203 |
| 401 | 3300014326 | Ga0157380_10550426 | Ga0157380_105504262 | 203 |
| 402 | 3300014968 | Ga0157379_10138083 | Ga0157379_101380831 | 203 |
| 403 | 3300014969 | Ga0157376_10483943 | Ga0157376_104839432 | 203 |
| 404 | 3300017792 | Ga0163161_10054161 | Ga0163161_100541614 | 203 |
| 405 | 3300020081 | Ga0206354_11524261 | Ga0206354_115242611 | 203 |
| 406 | 3300025321 | Ga0207656_10004334 | Ga0207656_100043345 | 203 |
| 407 | 3300025898 | Ga0207692_10132901 | Ga0207692_101329013 | 203 |
| 408 | 3300025899 | Ga0207642_10019085 | Ga0207642_100190854 | 203 |
| 409 | 3300025900 | Ga0207710_10000220 | Ga0207710_1000022030 | 203 |
| 410 | 3300025900 | Ga0207710_10015681 | Ga0207710_100156812 | 203 |
| 411 | 3300025901 | Ga0207688_10026332 | Ga0207688_100263326 | 203 |
| 412 | 3300025903 | Ga0207680_10024081 | Ga0207680_100240814 | 203 |
| 413 | 3300025905 | Ga0207685_10089012 | Ga0207685_100890122 | 203 |
| 414 | 3300025912 | Ga0207707_10048171 | Ga0207707_100481715 | 203 |
| 415 | 3300025915 | Ga0207693_10001647 | Ga0207693_1000164717 | 203 |
| 416 | 3300025915 | Ga0207693_10002588 | Ga0207693_1000258812 | 203 |
| 417 | 3300025916 | Ga0207663_10037091 | Ga0207663_100370912 | 203 |
| 418 | 3300025920 | Ga0207649_10000388 | Ga0207649_1000038832 | 203 |
| 419 | 3300025921 | Ga0207652_10000666 | Ga0207652_1000066627 | 203 |
| 420 | 3300025926 | Ga0207659_10000138 | Ga0207659_1000013853 | 203 |
| 421 | 3300025927 | Ga0207687_10005977 | Ga0207687_100059776 | 203 |
| 422 | 3300025927 | Ga0207687_10259197 | Ga0207687_102591972 | 203 |
| 423 | 3300025927 | Ga0207687_10310645 | Ga0207687_103106452 | 203 |
| 424 | 3300025928 | Ga0207700_10000019 | Ga0207700_10000019195 | 203 |
| 425 | 3300025929 | Ga0207664_10104740 | Ga0207664_101047404 | 203 |
| 426 | 3300025932 | Ga0207690_10008867 | Ga0207690_100088675 | 203 |
| 427 | 3300025934 | Ga0207686_10000066 | Ga0207686_10000066102 | 203 |
| 428 | 3300025934 | Ga0207686_10001614 | Ga0207686_100016143 | 203 |
| 429 | 3300025935 | Ga0207709_10040649 | Ga0207709_100406493 | 203 |
| 430 | 3300025935 | Ga0207709_10387641 | Ga0207709_103876412 | 203 |
| 431 | 3300025936 | Ga0207670_10108744 | Ga0207670_101087443 | 203 |
| 432 | 3300025939 | Ga0207665_10019306 | Ga0207665_100193066 | 203 |
| 433 | 3300025940 | Ga0207691_10000430 | Ga0207691_1000043037 | 203 |
| 434 | 3300025944 | Ga0207661_10058350 | Ga0207661_100583503 | 203 |
| 435 | 3300025944 | Ga0207661_10107996 | Ga0207661_101079965 | 203 |
| 436 | 3300025944 | Ga0207661_10653359 | Ga0207661_106533592 | 203 |
| 437 | 3300025945 | Ga0207679_10135579 | Ga0207679_101355791 | 203 |
| 438 | 3300025961 | Ga0207712_10124409 | Ga0207712_101244093 | 203 |
| 439 | 3300025961 | Ga0207712_10129766 | Ga0207712_101297662 | 203 |
| 440 | 3300025961 | Ga0207712_10281223 | Ga0207712_102812232 | 203 |
| 441 | 3300025981 | Ga0207640_10000691 | Ga0207640_1000069110 | 203 |
| 442 | 3300025981 | Ga0207640_10956987 | Ga0207640_109569871 | 203 |
| 443 | 3300025986 | Ga0207658_10122209 | Ga0207658_101222093 | 203 |
| 444 | 3300026023 | Ga0207677_10056601 | Ga0207677_100566012 | 203 |
| 445 | 3300026041 | Ga0207639_10923962 | Ga0207639_109239622 | 203 |
| 446 | 3300026067 | Ga0207678_10002630 | Ga0207678_100026304 | 203 |
| 447 | 3300026075 | Ga0207708_10224638 | Ga0207708_102246382 | 203 |
| 448 | 3300026078 | Ga0207702_11328433 | Ga0207702_113284331 | 203 |
| 449 | 3300026121 | Ga0207683_10029338 | Ga0207683_100293383 | 203 |
| 450 | 3300026121 | Ga0207683_10051534 | Ga0207683_100515343 | 203 |
| 451 | 3300026142 | Ga0207698_10021851 | Ga0207698_100218514 | 203 |
| 452 | 3300028379 | Ga0268266_10005543 | Ga0268266_1000554320 | 203 |
| 453 | 3300028379 | Ga0268266_10985844 | Ga0268266_109858441 | 203 |
| 454 | 3300028558 | Ga0265326_10020928 | Ga0265326_100209282 | 203 |
| 455 | 3300028563 | Ga0265319_1000030 | Ga0265319_100003035 | 203 |
| 456 | 3300028666 | Ga0265336_10120476 | Ga0265336_101204761 | 203 |
| 457 | 3300028800 | Ga0265338_10000156 | Ga0265338_1000015635 | 203 |
| 458 | 3300031241 | Ga0265325_10005113 | Ga0265325_100051139 | 203 |
| 459 | 3300031456 | Ga0307513_10200086 | Ga0307513_102000863 | 203 |
| 460 | 3300031852 | Ga0307410_10517636 | Ga0307410_105176362 | 203 |
| 461 | 3300032002 | Ga0307416_101232801 | Ga0307416_1012328012 | 203 |
| 462 | 3300035241 | Ga0373961_0103147 | Ga0373961_0103147_133_771 | 203 |
| 463 | 3300036401 | Ga0373937_0354465 | Ga0373937_0354465_181_792 | 203 |
| 464 | 3300037312 | Ga0395899_0444047 | Ga0395899_0444047_167_829 | 203 |
| 465 | 3300037466 | Ga0395898_0017781 | Ga0395898_0017781_2466_3104 | 203 |
| 466 | 3300037466 | Ga0395898_0024801 | Ga0395898_0024801_4586_5224 | 203 |
| 467 | 3300037466 | Ga0395898_0974445 | Ga0395898_0974445_140_772 | 203 |
| 468 | 3300037471 | Ga0395905_0013334 | Ga0395905_0013334_2962_3600 | 203 |
| 469 | 3300038443 | Ga0395901_0011288 | Ga0395901_0011288_7524_8162 | 203 |
| 470 | 3300038443 | Ga0395901_0012327 | Ga0395901_0012327_2526_3164 | 203 |
| 471 | 3300041505 | Ga0451849_1549853 | Ga0451849_1549853_546_1157 | 203 |
| 472 | 3300044694 | Ga0466963_0414124 | Ga0466963_0414124_94_705 | 203 |
| 473 | 3300044842 | Ga0466957_0001797 | Ga0466957_0001797_4516_5133 | 203 |
| 474 | 3300044842 | Ga0466957_0047130 | Ga0466957_0047130_963_1574 | 203 |
| 475 | 3300044842 | Ga0466957_0312582 | Ga0466957_0312582_327_938 | 203 |
| 476 | 3300045836 | Ga0466958_0043454 | Ga0466958_0043454_1304_1921 | 203 |
| 477 | 3300045976 | Ga0466967_0000003 | Ga0466967_0000003_46142_46753 | 203 |
| 478 | 3300045976 | Ga0466967_0078881 | Ga0466967_0078881_1531_2145 | 203 |
| 479 | 3300046459 | Ga0495629_0000543 | Ga0495629_0000543_6316_6927 | 203 |
| 480 | 3300046459 | Ga0495629_0004371 | Ga0495629_0004371_1370_1981 | 203 |
| 481 | 3300046459 | Ga0495629_0012223 | Ga0495629_0012223_1399_2010 | 203 |
| 482 | 3300046460 | Ga0495638_0020983 | Ga0495638_0020983_1112_1723 | 203 |
| 483 | 3300046461 | Ga0495641_0085891 | Ga0495641_0085891_718_1329 | 203 |
| 484 | 3300046473 | Ga0495582_0092785 | Ga0495582_0092785_861_1499 | 203 |
| 485 | 3300046476 | Ga0495662_0013224 | Ga0495662_0013224_117_728 | 203 |
| 486 | 3300046507 | Ga0495606_0000283 | Ga0495606_0000283_65511_66122 | 203 |
| 487 | 3300046511 | Ga0495608_0000010 | Ga0495608_0000010_235831_236442 | 203 |
| 488 | 3300046514 | Ga0495618_0273469 | Ga0495618_0273469_241_855 | 203 |
| 489 | 3300046516 | Ga0495628_0000864 | Ga0495628_0000864_12330_12941 | 203 |
| 490 | 3300046517 | Ga0495630_0000148 | Ga0495630_0000148_52085_52696 | 203 |
| 491 | 3300046525 | Ga0495663_0028842 | Ga0495663_0028842_350_961 | 203 |
| 492 | 3300046529 | Ga0495652_0000009 | Ga0495652_0000009_234496_235107 | 203 |
| 493 | 3300046536 | Ga0495587_0262530 | Ga0495587_0262530_185_796 | 203 |
| 494 | 3300046543 | Ga0495645_0018112 | Ga0495645_0018112_2205_2819 | 203 |
| 495 | 3300046660 | Ga0495625_0000109 | Ga0495625_0000109_88614_89225 | 203 |
| 496 | 3300046674 | Ga0495588_0000175 | Ga0495588_0000175_34212_34826 | 203 |
| 497 | 3300046675 | Ga0495657_0000005 | Ga0495657_0000005_18419_19030 | 203 |
| 498 | 3300046681 | Ga0495647_0000114 | Ga0495647_0000114_18230_18841 | 203 |
| 499 | 3300046689 | Ga0495613_0000087 | Ga0495613_0000087_72082_72693 | 203 |
| 500 | 3300046690 | Ga0495624_0000429 | Ga0495624_0000429_24344_24955 | 203 |
| 501 | 3300046809 | Ga0495600_0072600 | Ga0495600_0072600_91_702 | 203 |
| 502 | 3300047317 | Ga0495604_0000322 | Ga0495604_0000322_27723_28334 | 203 |
| 503 | 3300047321 | Ga0495676_0000522 | Ga0495676_0000522_1661_2272 | 203 |
| 504 | 3300047321 | Ga0495676_0046499 | Ga0495676_0046499_1985_2623 | 203 |
| 505 | 3300047322 | Ga0495680_0009545 | Ga0495680_0009545_7715_8326 | 203 |
| 506 | 3300047444 | Ga0495675_0000398 | Ga0495675_0000398_14597_15208 | 203 |
| 507 | 3300047673 | Ga0495593_0134286 | Ga0495593_0134286_618_1229 | 203 |
| 508 | 3300048088 | Ga0495602_0000038 | Ga0495602_0000038_13989_14600 | 203 |
| 509 | 3300048088 | Ga0495602_0003702 | Ga0495602_0003702_153_764 | 203 |
| 510 | 3300048088 | Ga0495602_0098658 | Ga0495602_0098658_1473_2090 | 203 |
| 511 | 3300048903 | Ga0496100_0000028 | Ga0496100_0000028_103256_103867 | 203 |
| 512 | 3300048903 | Ga0496100_0005219 | Ga0496100_0005219_3455_4093 | 203 |
| 513 | 3300048904 | Ga0496101_0000005 | Ga0496101_0000005_253255_253866 | 203 |
| 514 | 3300048904 | Ga0496101_0046252 | Ga0496101_0046252_810_1448 | 203 |
| 515 | 3300048905 | Ga0496102_0000021 | Ga0496102_0000021_180999_181610 | 203 |
| 516 | 3300048905 | Ga0496102_0006894 | Ga0496102_0006894_2858_3496 | 203 |
| 517 | 3300048905 | Ga0496102_0404993 | Ga0496102_0404993_147_791 | 203 |
| 518 | 3300048905 | Ga0496102_0457202 | Ga0496102_0457202_94_738 | 203 |
| 519 | 3300048906 | Ga0496103_0000001 | Ga0496103_0000001_414297_414908 | 203 |
| 520 | 3300048906 | Ga0496103_0006645 | Ga0496103_0006645_2994_3632 | 203 |
| 521 | 3300048906 | Ga0496103_0194384 | Ga0496103_0194384_333_977 | 203 |
| 522 | 3300048907 | Ga0496104_0000029 | Ga0496104_0000029_193881_194492 | 203 |
| 523 | 3300048907 | Ga0496104_0007889 | Ga0496104_0007889_2218_2856 | 203 |
| 524 | 3300048908 | Ga0496105_0000002 | Ga0496105_0000002_193881_194492 | 203 |
| 525 | 3300048908 | Ga0496105_0044587 | Ga0496105_0044587_1358_1969 | 203 |
| 526 | 3300048909 | Ga0496106_0000070 | Ga0496106_0000070_72152_72763 | 203 |
| 527 | 3300048909 | Ga0496106_0001451 | Ga0496106_0001451_12348_12986 | 203 |
| 528 | 3300048910 | Ga0496107_0000004 | Ga0496107_0000004_253472_254083 | 203 |
| 529 | 3300048910 | Ga0496107_0003754 | Ga0496107_0003754_1422_2060 | 203 |
| 530 | 3300048910 | Ga0496107_0102247 | Ga0496107_0102247_1168_1893 | 203 |
| 531 | 3300048911 | Ga0496108_0050264 | Ga0496108_0050264_2151_2789 | 203 |
| 532 | 3300048911 | Ga0496108_0146414 | Ga0496108_0146414_586_1203 | 203 |
| 533 | 3300048911 | Ga0496108_0146776 | Ga0496108_0146776_391_1116 | 203 |
| 534 | 3300048912 | Ga0496109_0000062 | Ga0496109_0000062_20460_21077 | 203 |
| 535 | 3300048912 | Ga0496109_0016797 | Ga0496109_0016797_4920_5564 | 203 |
| 536 | 3300048913 | Ga0496110_0000325 | Ga0496110_0000325_26579_27190 | 203 |
| 537 | 3300048913 | Ga0496110_0060865 | Ga0496110_0060865_2557_3168 | 203 |
| 538 | 3300048914 | Ga0496111_0000171 | Ga0496111_0000171_2417_3028 | 203 |
| 539 | 3300048914 | Ga0496111_0022155 | Ga0496111_0022155_298_936 | 203 |
| 540 | 3300048914 | Ga0496111_0084895 | Ga0496111_0084895_938_1549 | 203 |
| 541 | 3300048915 | Ga0496112_0007934 | Ga0496112_0007934_846_1463 | 203 |
| 542 | 3300048915 | Ga0496112_0098738 | Ga0496112_0098738_753_1391 | 203 |
| 543 | 3300048916 | Ga0496113_0000002 | Ga0496113_0000002_12118_12735 | 203 |
| 544 | 3300048916 | Ga0496113_0138665 | Ga0496113_0138665_1180_1824 | 203 |
| 545 | 3300048917 | Ga0496114_0000097 | Ga0496114_0000097_23167_23778 | 203 |
| 546 | 3300048917 | Ga0496114_0002329 | Ga0496114_0002329_8990_9628 | 203 |
| 547 | 3300048917 | Ga0496114_0173892 | Ga0496114_0173892_501_1142 | 203 |
| 548 | 3300048918 | Ga0496115_0000005 | Ga0496115_0000005_135305_135916 | 203 |
| 549 | 3300048918 | Ga0496115_0000151 | Ga0496115_0000151_24269_24880 | 203 |
| 550 | 3300048918 | Ga0496115_0000552 | Ga0496115_0000552_17402_18040 | 203 |
| 551 | 3300048920 | Ga0496117_0008580 | Ga0496117_0008580_6734_7378 | 203 |
| 552 | 3300048920 | Ga0496117_0138567 | Ga0496117_0138567_336_983 | 203 |
| 553 | 3300048920 | Ga0496117_0192031 | Ga0496117_0192031_115_756 | 203 |
| 554 | 3300048921 | Ga0496118_0011630 | Ga0496118_0011630_3453_4097 | 203 |
| 555 | 3300048921 | Ga0496118_0226027 | Ga0496118_0226027_36_680 | 203 |
| 556 | 3300048922 | Ga0496119_0003596 | Ga0496119_0003596_326_973 | 203 |
| 557 | 3300048922 | Ga0496119_0008336 | Ga0496119_0008336_2039_2650 | 203 |
| 558 | 3300048923 | Ga0496120_0013670 | Ga0496120_0013670_2629_3276 | 203 |
| 559 | 3300048923 | Ga0496120_0024517 | Ga0496120_0024517_1419_2030 | 203 |
| 560 | 3300048924 | Ga0496121_0244711 | Ga0496121_0244711_196_843 | 203 |
| 561 | 3300048924 | Ga0496121_0300513 | Ga0496121_0300513_123_770 | 203 |
| 562 | 3300048924 | Ga0496121_0429376 | Ga0496121_0429376_196_843 | 203 |
| 563 | 3300048928 | Ga0496125_0036690 | Ga0496125_0036690_2244_2888 | 203 |
| 564 | 3300048929 | Ga0496126_0061679 | Ga0496126_0061679_644_1285 | 203 |
| 565 | 3300048929 | Ga0496126_0096085 | Ga0496126_0096085_1309_1950 | 203 |
| 566 | 3300049576 | Ga0501040_0668859 | Ga0501040_0668859_85_699 | 203 |
| 567 | 3300049578 | Ga0501042_0084775 | Ga0501042_0084775_1565_2176 | 203 |
| 568 | 3300049578 | Ga0501042_0246819 | Ga0501042_0246819_79_690 | 203 |
| 569 | 3300049578 | Ga0501042_0557219 | Ga0501042_0557219_71_808 | 203 |
| 570 | 3300049581 | Ga0501047_0076497 | Ga0501047_0076497_2540_3187 | 203 |
| 571 | 3300049581 | Ga0501047_0199045 | Ga0501047_0199045_768_1412 | 203 |
| 572 | 3300049582 | Ga0501048_0201395 | Ga0501048_0201395_385_1122 | 203 |
| 573 | 3300049586 | Ga0501070_0158483 | Ga0501070_0158483_1090_1731 | 203 |
| 574 | 3300049586 | Ga0501070_0208757 | Ga0501070_0208757_22_636 | 203 |
| 575 | 3300049587 | Ga0501071_0128689 | Ga0501071_0128689_702_1439 | 203 |
| 576 | 3300049588 | Ga0501072_0010149 | Ga0501072_0010149_3477_4214 | 203 |
| 577 | 3300049592 | Ga0501076_0043911 | Ga0501076_0043911_2073_2810 | 203 |
| 578 | 3300049592 | Ga0501076_0052178 | Ga0501076_0052178_1102_1713 | 203 |
| 579 | 3300049743 | Ga0501081_0394052 | Ga0501081_0394052_119_802 | 203 |
| 580 | 3300049744 | Ga0501083_0013469 | Ga0501083_0013469_3163_3810 | 203 |
| 581 | 3300049822 | Ga0501035_0126212 | Ga0501035_0126212_984_1721 | 203 |
| 582 | 3300049823 | Ga0501044_0368048 | Ga0501044_0368048_459_1106 | 203 |
| 583 | 3300049824 | Ga0501045_0096873 | Ga0501045_0096873_181_918 | 203 |
| 584 | 3300050491 | nmdc:mga00v17_126142_c1 | nmdc:mga00v17_126142_c1_567_1193 | 203 |
| 585 | 3300050492 | nmdc:mga0yw44_8217_c1 | nmdc:mga0yw44_8217_c1_423_1058 | 203 |
| 586 | 3300050507 | nmdc:mga05p37_242619_c1 | nmdc:mga05p37_242619_c1_532_1170 | 203 |
| 587 | 3300050507 | nmdc:mga05p37_343611_c1 | nmdc:mga05p37_343611_c1_1043_1702 | 203 |
| 588 | 3300050509 | nmdc:mga0qj67_186845_c1 | nmdc:mga0qj67_186845_c1_903_1559 | 203 |
| 589 | 3300053077 | Ga0495601_0000065 | Ga0495601_0000065_8128_8742 | 203 |
| 590 | 3300053077 | Ga0495601_0150356 | Ga0495601_0150356_853_1467 | 203 |
| 591 | 3300053078 | Ga0495612_0004181 | Ga0495612_0004181_1727_2338 | 203 |
| 592 | 3300053083 | Ga0495655_0000013 | Ga0495655_0000013_36955_37566 | 203 |
| 593 | 3300053083 | Ga0495655_0001612 | Ga0495655_0001612_2238_2849 | 203 |
| 594 | 3300053084 | Ga0495595_0000005 | Ga0495595_0000005_22219_22830 | 203 |
| 595 | 3300053084 | Ga0495595_0029416 | Ga0495595_0029416_901_1515 | 203 |
| 596 | 3300053084 | Ga0495595_0140061 | Ga0495595_0140061_228_839 | 203 |
| 597 | 3300053085 | Ga0495619_0000069 | Ga0495619_0000069_72341_72958 | 203 |
| 598 | 3300053085 | Ga0495619_0000489 | Ga0495619_0000489_11390_12001 | 203 |
| 599 | 3300053094 | Ga0500566_0001523 | Ga0500566_0001523_9983_10594 | 203 |
| 600 | 3300053129 | Ga0500628_000045 | Ga0500628_000045_4915_5526 | 203 |
| 601 | 3300053134 | Ga0500658_0016931 | Ga0500658_0016931_618_1265 | 203 |
| 602 | 3300053139 | Ga0500568_0111496 | Ga0500568_0111496_221_868 | 203 |
| 603 | 3300054114 | Ga0501084_0087286 | Ga0501084_0087286_1369_2106 | 203 |
| 604 | 3300060353 | Ga0501082_0043605 | Ga0501082_0043605_359_1096 | 203 |
| 605 | 3300061734 | Ga0530510_0069251 | Ga0530510_0069251_577_1314 | 203 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8c9a-assembly1.cif.gz_E | cryo-em captures early ribosome assembly in action | 0.8244 | 6 | 203 |
| 8c9b-assembly1.cif.gz_E | cryo-em captures early ribosome assembly in action | 0.8226 | 3 | 203 |
| 8c97-assembly1.cif.gz_E | cryo-em captures early ribosome assembly in action | 0.8197 | 3 | 203 |
| 8c9a-assembly1.cif.gz_E | cryo-em captures early ribosome assembly in action | 0.8195 | 6 | 203 |
| 8c9b-assembly1.cif.gz_E | cryo-em captures early ribosome assembly in action | 0.8129 | 3 | 203 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WH85_1_222_3.40.1370.10 | Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 | 0.7487 | 2 | 200 | 3.40.1370.10 |
| af_Q2FW07_2_206_3.40.1370.10 | Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 | 0.7358 | 2 | 200 | 3.40.1370.10 |
| af_P9WH85_1_222_3.40.1370.10 | Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 | 0.7328 | 2 | 200 | 3.40.1370.10 |
| af_Q54RB5_40_257_3.40.1370.10 | Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 | 0.7232 | 3 | 202 | 3.40.1370.10 |
| af_Q2FW07_2_206_3.40.1370.10 | Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 | 0.7202 | 2 | 200 | 3.40.1370.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538BFB4-F1-model_v4 | 50S ribosomal protein L4 | 0.9656 | 117 | 203 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A538BFB4-F1-model_v4 | 50S ribosomal protein L4 | 0.955 | 117 | 203 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A0H4TTC6-F1-model_v4 | Large ribosomal subunit protein uL4 (50S ribosomal protein L4) | 0.9328 | 97 | 203 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A0H4TTC6-F1-model_v4 | Large ribosomal subunit protein uL4 (50S ribosomal protein L4) | 0.9246 | 97 | 203 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A6V8P0A4-F1-model_v4 | Large ribosomal subunit protein uL4 (50S ribosomal protein L4) | 0.9203 | 95 | 203 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar