F468543

General Info

Members Datasets Scaffolds Average Seq Length
606 359 1212 510

Family's Representative Sequence

Representative Sequence 3300003187|JGI25151J46595_10006742|JGI25151J46595_100067425
Length 608
Sequence MIGQSLHDLWYGFGVAFQGSNLLWSFFGVLVGNLIGVLPGMGALQAISILLPLTYVMHPVPAILMLAGIFYGSQYGGAIGAILMNMPSHPPHAVTCLDGYPMTKQGKGGVALGVTMIASFFAASVGIIVMIFASPLLVQIAFKFGPTEIFSIMLLGLLAGSTMSRGSPLKGVAMTLFGLLCGVVGTDVNSGSFRFAFGLPELSDGLELVAISMGLFGVADFLLNVNRMKAIGDTGTLKLSDMRPSREELKRAFPAMIRGTLVGTVFGAMPGTGPTITTFIAYALERKVSKTPNRFGTGMIEGVAGPEASAHSKTQVDFIPTMSLGIPGDAVMALILGALLIQGIQPGPQLITEHPDIFWGLIASFWIGNVILVILNVPMIGVWVKLLKVPYKYLFPAAMFFIATGVYSTQNSLFQIWEVLVFGIVGAVLMTLEFSVAPILLGFVLGPMVEENFRRALLLSRGDMSVFVTRPISATFIGLCTLLLLGVSYSAWRGRGSRKAVLELPKTPXGAPPAESLTIGGKXPAPTASARRRKARIAGLFFVLCRYRRMLEAQTGVVPVSGSRTPKGFPGSGMNSVSPGTWPMRCAAQSAPASRMRSRRLETKFQVM

Samples

Sample ID Description Type Environment
1 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
4 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
5 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
6 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
11 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
12 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
13 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
14 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
15 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
16 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
17 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
18 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
19 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
20 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
23 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
24 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
69 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
70 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
71 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
72 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
76 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
77 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
78 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
81 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
82 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
83 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
87 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
90 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
92 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
95 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
131 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
132 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
133 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
134 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
135 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
136 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
137 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
138 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
139 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
140 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
141 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
142 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
143 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
144 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
145 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
146 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
147 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
148 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
149 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
150 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
151 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
152 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
153 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
154 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
155 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
156 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
157 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
158 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
159 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
161 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
162 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
163 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
164 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
165 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
166 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
167 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
168 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
169 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
170 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
171 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
172 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
173 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
174 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
175 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
176 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
177 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
178 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
179 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
180 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
181 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
182 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
183 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
184 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
185 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
186 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
187 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
188 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
189 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
190 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
191 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
192 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
193 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
194 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
195 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
196 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
197 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
198 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
199 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
200 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
201 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
202 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
203 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
204 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
205 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
206 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
207 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
208 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
209 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
210 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
211 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
212 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
213 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
214 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
215 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
216 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
217 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
218 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
219 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
220 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
221 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
222 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
223 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
224 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
225 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
226 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
227 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
228 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
229 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
230 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
231 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
232 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
233 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
234 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
235 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
236 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
237 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
238 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
239 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
240 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
241 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
242 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
243 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
244 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
245 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
246 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
247 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
248 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
249 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
250 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
251 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
252 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
253 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
260 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
261 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
262 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
263 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
264 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
265 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
267 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
268 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
269 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
270 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
271 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
272 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
273 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
274 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
275 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
276 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
277 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
278 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
279 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
280 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
281 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
282 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
283 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
284 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
285 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
286 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
287 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
288 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
289 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
290 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
291 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
292 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
293 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
294 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
295 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
296 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
297 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
298 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
299 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
300 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
301 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
302 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
303 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
304 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
305 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
306 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
307 2643221569 Achromobacter sp. Root565 Isolate Unclassified
308 2643221594 Achromobacter sp. Root170 Isolate Unclassified
309 2643221621 Achromobacter sp. Root83 Isolate Unclassified
310 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
311 2643221658 Variovorax sp. Root411 Isolate Unclassified
312 2643221672 Variovorax sp. Root434 Isolate Unclassified
313 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
314 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
315 2738541277 Variovorax sp. GV051 Isolate Unclassified
316 2738541307 Variovorax sp. GV008 Isolate Unclassified
317 2738543019 Variovorax sp. GV040 Isolate Unclassified
318 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
319 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
320 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
321 2818991446 Variovorax sp. 1180 Isolate Unclassified
322 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
323 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
324 2855730933 Achromobacter sp. HZ28 Isolate Nodule
325 2855767633 Achromobacter sp. HZ34 Isolate Nodule
326 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
327 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
328 2858950400 Achromobacter sp. K91 Isolate Unclassified
329 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
330 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
331 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
332 2885198086 Variovorax sp. 679 Isolate Unclassified
333 2885211737 Variovorax sp. 553 Isolate Unclassified
334 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
335 2899924645 Variovorax sp. 369 Isolate Unclassified
336 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
337 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
338 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
339 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
340 2928037797 Variovorax sp. 1126 Isolate Unclassified
341 2928044640 Variovorax sp. 1128 Isolate Unclassified
342 2928051484 Variovorax sp. 1133 Isolate Unclassified
343 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
344 2928070936 Variovorax gossypii 1167 Isolate Unclassified
345 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
346 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
347 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
348 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
349 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
350 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
351 2941479691
352 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
353 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
354 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
355 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
356 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
357 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
358 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
359 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 88.94
Metatranscriptomes 0
Isolates 11.06

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.81
Nodule 2.64
Rhizoplane 1.82
Rhizosphere 61.55
Stem 0
Stem Tuber 0
Unclassified 0.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10006742 3300003187 Bacteria 5717
2 JGI25156J39149_1014617 3300002705 Bacteria 1608
3 JGI25154J39366_1005966 3300002738 Bacteria 1854
4 JGI25157J39369_1000059 3300002741 Bacteria 106388
5 JGI25152J39213_1001574 3300002773 Bacteria 9576
6 JGI25159J45721_1001236 3300002987 Bacteria 10779
7 JGI25151J46595_10001321 3300003187 Bacteria 17340
8 JGI25151J46595_10001847 3300003187 Bacteria 13633
9 JGI25151J46595_10002423 3300003187 Bacteria 11247
10 JGI25151J46595_10003001 3300003187 Bacteria 9602
11 JGI25151J46595_10003009 3300003187 Bacteria 9576
12 JGI25165J46597_1001353 3300003214 Bacteria 13648
13 JGI25153J46596_10002982 3300003215 Bacteria 9576
14 JGI25153J46596_10006821 3300003215 Bacteria 5715
15 rootH2_10053935 3300003320 Bacteria 5156
16 JGI25160J50197_1000090 3300003354 Bacteria 90580
17 Ga0055539_1001176 3300003752 Bacteria 5336
18 Ga0055532_1000281 3300003758 Bacteria 33007
19 Ga0055527_1000252 3300003760 Bacteria 33007
20 Ga0055535_1000322 3300003761 Bacteria 48378
21 Ga0055535_1000415 3300003761 Bacteria 40129
22 Ga0055535_1000532 3300003761 Bacteria 33007
23 Ga0055542_1000004 3300003762 Bacteria 553532
24 Ga0055542_1000554 3300003762 Bacteria 33007
25 Ga0055529_1000529 3300003763 Bacteria 33007
26 Ga0055536_1000124 3300003781 Bacteria 66148
27 Ga0055534_1002263 3300003784 Bacteria 6800
28 Ga0055534_1002471 3300003784 Bacteria 6373
29 Ga0055531_10010180 3300003794 Bacteria 4707
30 Ga0065165_1000593 3300005262 Bacteria 53114
31 Ga0065165_1002672 3300005262 Bacteria 14396
32 Ga0070658_10010399 3300005327 Bacteria 7461
33 Ga0070676_10029140 3300005328 Bacteria 3138
34 Ga0070683_100002204 3300005329 Bacteria 15431
35 Ga0070683_100122728 3300005329 Bacteria 2454
36 Ga0070677_10016366 3300005333 Bacteria 2639
37 Ga0068868_100121031 3300005338 Bacteria 2135
38 Ga0070661_100001194 3300005344 Bacteria 18335
39 Ga0070669_100107641 3300005353 Bacteria 2112
40 Ga0070675_100017170 3300005354 Bacteria 5752
41 Ga0070671_100014242 3300005355 Bacteria 6421
42 Ga0070673_100002966 3300005364 Bacteria 10466
43 Ga0070659_100019592 3300005366 Bacteria 5130
44 Ga0070667_100000705 3300005367 Bacteria 32287
45 Ga0070667_100024895 3300005367 Bacteria 4972
46 Ga0070667_100081940 3300005367 Bacteria 2761
47 Ga0070709_10004057 3300005434 Bacteria 7898
48 Ga0070714_100028778 3300005435 Bacteria 4614
49 Ga0070714_100099647 3300005435 Bacteria 2557
50 Ga0070713_100017101 3300005436 Bacteria 5473
51 Ga0070713_100134400 3300005436 Bacteria 2184
52 Ga0070711_100062747 3300005439 Bacteria 2591
53 Ga0070708_100168972 3300005445 Bacteria 2041
54 Ga0070662_100080010 3300005457 Bacteria 2432
55 Ga0070681_10127530 3300005458 Bacteria 2477
56 Ga0068867_100007596 3300005459 Bacteria 7669
57 Ga0070684_100002133 3300005535 Bacteria 14603
58 Ga0068853_100097385 3300005539 Bacteria 2597
59 Ga0068855_100004798 3300005563 Bacteria 16506
60 Ga0068855_100072810 3300005563 Bacteria 3993
61 Ga0070664_100002007 3300005564 Bacteria 16325
62 Ga0068857_100002378 3300005577 Bacteria 15341
63 Ga0068857_100011778 3300005577 Bacteria 7607
64 Ga0068857_100031355 3300005577 Bacteria 4696
65 Ga0068857_100136746 3300005577 Bacteria 2213
66 Ga0068854_100001921 3300005578 Bacteria 12670
67 Ga0068854_100119908 3300005578 Bacteria 1995
68 Ga0068856_100000183 3300005614 Bacteria 65005
69 Ga0068856_100009723 3300005614 Bacteria 9343
70 Ga0068852_100005481 3300005616 Bacteria 9082
71 Ga0068851_10015729 3300005834 Bacteria 3609
72 Ga0068862_100049868 3300005844 Bacteria 3576
73 Ga0070717_10092606 3300006028 Bacteria 2554
74 Ga0075366_10019168 3300006195 Bacteria 3954
75 Ga0075366_10037871 3300006195 Bacteria 2848
76 Ga0068871_100078210 3300006358 Bacteria 2735
77 Ga0068865_100066229 3300006881 Bacteria 2548
78 Ga0105240_10001899 3300009093 Bacteria 34678
79 Ga0105240_10063040 3300009093 Bacteria 4613
80 Ga0105243_10002525 3300009148 Bacteria 15279
81 Ga0105243_10102195 3300009148 Bacteria 2381
82 Ga0105243_10156988 3300009148 Bacteria 1957
83 Ga0105237_10002284 3300009545 Bacteria 23834
84 Ga0105237_10007183 3300009545 Bacteria 12232
85 Ga0105237_10038136 3300009545 Bacteria 4854
86 Ga0105237_10052456 3300009545 Bacteria 4094
87 Ga0105238_10008515 3300009551 Bacteria 10264
88 Ga0105238_10018626 3300009551 Bacteria 7070
89 Ga0105238_10034450 3300009551 Bacteria 5152
90 Ga0105238_10118115 3300009551 Bacteria 2632
91 Ga0105239_10000832 3300010375 Bacteria 43848
92 Ga0105239_10024929 3300010375 Bacteria 6588
93 Ga0157373_10011906 3300013100 Bacteria 6391
94 Ga0157371_10062185 3300013102 Bacteria 2647
95 Ga0157370_10013435 3300013104 Bacteria 8434
96 Ga0157370_10018516 3300013104 Bacteria 7001
97 Ga0157370_10052053 3300013104 Bacteria 3910
98 Ga0157370_10230940 3300013104 Bacteria 1712
99 Ga0157369_10005656 3300013105 Bacteria 14523
100 Ga0157369_10008411 3300013105 Bacteria 11833
101 Ga0157369_10017339 3300013105 Bacteria 8095
102 Ga0157369_10057894 3300013105 Unclassified 4180
103 Ga0157369_10067390 3300013105 Bacteria 3848
104 Ga0157369_10238387 3300013105 Bacteria 1900
105 Ga0157374_10011426 3300013296 Bacteria 7687
106 Ga0163162_10136672 3300013306 Bacteria 2562
107 Ga0157372_10133203 3300013307 Bacteria 2861
108 Ga0157375_10130505 3300013308 Bacteria 2632
109 Ga0157375_10200643 3300013308 Bacteria 2151
110 Ga0182008_10006902 3300014497 Bacteria 6308
111 Ga0182008_10050604 3300014497 Bacteria 2062
112 Ga0182007_10001138 3300015262 Bacteria 14409
113 Ga0163161_10000112 3300017792 Bacteria 77235
114 Ga0213872_10002690 3300021361 Bacteria 10259
115 Ga0209672_100021 3300025228 Bacteria 428473
116 Ga0209672_100497 3300025228 Bacteria 21856
117 Ga0209147_100025 3300025229 Bacteria 428473
118 Ga0209147_101326 3300025229 Bacteria 9452
119 Ga0209258_100022 3300025242 Bacteria 553584
120 Ga0209258_100025 3300025242 Bacteria 534777
121 Ga0209258_100037 3300025242 Bacteria 428473
122 Ga0207425_1000138 3300025245 Bacteria 65477
123 Ga0209646_1000112 3300025246 Bacteria 153075
124 Ga0209026_1000038 3300025250 Bacteria 281227
125 Ga0209677_100320 3300025253 Bacteria 31179
126 Ga0209148_1000034 3300025254 Bacteria 553584
127 Ga0209148_1000049 3300025254 Bacteria 428473
128 Ga0209759_1000031 3300025256 Bacteria 281227
129 Ga0209759_1000139 3300025256 Bacteria 124929
130 Ga0209759_1002804 3300025256 Bacteria 7357
131 Ga0209759_1007472 3300025256 Bacteria 3510
132 Ga0209129_1000023 3300025258 Bacteria 420646
133 Ga0209129_1000558 3300025258 Bacteria 25653
134 Ga0209129_1005045 3300025258 Bacteria 4851
135 Ga0209233_1000398 3300025261 Bacteria 36043
136 Ga0209565_1000403 3300025263 Bacteria 36050
137 Ga0209565_1001540 3300025263 Bacteria 9923
138 Ga0209455_1000041 3300025272 Bacteria 428473
139 Ga0209455_1000112 3300025272 Bacteria 186237
140 Ga0209673_1000673 3300025273 Bacteria 49581
141 Ga0209673_1000928 3300025273 Bacteria 36961
142 Ga0209130_1000222 3300025284 Bacteria 74607
143 Ga0209130_1000763 3300025284 Bacteria 27891
144 Ga0209675_1000129 3300025291 Bacteria 102806
145 Ga0209675_1001282 3300025291 Bacteria 14952
146 Ga0209675_1003428 3300025291 Bacteria 7544
147 Ga0209676_1000005 3300025292 Bacteria 1076001
148 Ga0209676_1000014 3300025292 Bacteria 793514
149 Ga0209025_1000028 3300025294 Bacteria 490678
150 Ga0209025_1000157 3300025294 Bacteria 168790
151 Ga0209025_1000232 3300025294 Bacteria 130663
152 Ga0209025_1000476 3300025294 Bacteria 77754
153 Ga0209025_1001078 3300025294 Bacteria 39551
154 Ga0209025_1030274 3300025294 Bacteria 2594
155 Ga0209564_1000309 3300025295 Bacteria 96154
156 Ga0209564_1000400 3300025295 Bacteria 77039
157 Ga0209564_1000669 3300025295 Bacteria 50623
158 Ga0209564_1000898 3300025295 Bacteria 39109
159 Ga0209758_1000064 3300025297 Bacteria 311812
160 Ga0209758_1005231 3300025297 Bacteria 10167
161 Ga0209050_1000007 3300025298 Bacteria 1187891
162 Ga0209256_1000038 3300025299 Bacteria 375225
163 Ga0209256_1000115 3300025299 Bacteria 173607
164 Ga0207426_1000001 3300025302 Bacteria 1341301
165 Ga0207426_1000110 3300025302 Bacteria 235630
166 Ga0207426_1000785 3300025302 Bacteria 34741
167 Ga0209051_1000009 3300025303 Bacteria 706778
168 Ga0209051_1002266 3300025303 Bacteria 14106
169 Ga0209051_1002476 3300025303 Bacteria 13189
170 Ga0209051_1009721 3300025303 Bacteria 4929
171 Ga0209051_1010655 3300025303 Bacteria 4614
172 Ga0209257_1000011 3300025304 Bacteria 1112630
173 Ga0209257_1000508 3300025304 Bacteria 68156
174 Ga0209257_1004838 3300025304 Bacteria 9971
175 Ga0209257_1017431 3300025304 Bacteria 2828
176 Ga0207656_10010156 3300025321 Bacteria 3516
177 Ga0207699_10012259 3300025906 Bacteria 4357
178 Ga0207645_10009502 3300025907 Bacteria 6722
179 Ga0207705_10046145 3300025909 Bacteria 3131
180 Ga0207654_10039007 3300025911 Bacteria 2668
181 Ga0207707_10066362 3300025912 Bacteria 3142
182 Ga0207695_10023931 3300025913 Bacteria 6889
183 Ga0207695_10122722 3300025913 Bacteria 2564
184 Ga0207695_10122958 3300025913 Bacteria 2561
185 Ga0207671_10006328 3300025914 Bacteria 10569
186 Ga0207671_10061173 3300025914 Bacteria 2794
187 Ga0207671_10094187 3300025914 Bacteria 2260
188 Ga0207663_10029917 3300025916 Bacteria 3205
189 Ga0207657_10017242 3300025919 Bacteria 6934
190 Ga0207649_10038654 3300025920 Bacteria 2890
191 Ga0207649_10043055 3300025920 Bacteria 2758
192 Ga0207649_10105582 3300025920 Bacteria 1872
193 Ga0207652_10075264 3300025921 Bacteria 2942
194 Ga0207694_10008131 3300025924 Bacteria 7925
195 Ga0207694_10012738 3300025924 Bacteria 6335
196 Ga0207650_10083245 3300025925 Bacteria 2430
197 Ga0207700_10050830 3300025928 Bacteria 3090
198 Ga0207664_10076496 3300025929 Bacteria 2709
199 Ga0207690_10069054 3300025932 Bacteria 2430
200 Ga0207706_10069517 3300025933 Bacteria 3097
201 Ga0207709_10002298 3300025935 Bacteria 12110
202 Ga0207709_10072056 3300025935 Bacteria 2196
203 Ga0207704_10058135 3300025938 Bacteria 2379
204 Ga0207665_10019051 3300025939 Bacteria 4509
205 Ga0207691_10010898 3300025940 Bacteria 8724
206 Ga0207661_10003294 3300025944 Bacteria 11210
207 Ga0207661_10138496 3300025944 Bacteria 2092
208 Ga0207679_10004812 3300025945 Bacteria 8413
209 Ga0207679_10013854 3300025945 Bacteria 5287
210 Ga0207667_10005305 3300025949 Bacteria 15707
211 Ga0207667_10030418 3300025949 Bacteria 5842
212 Ga0207667_10076407 3300025949 Bacteria 3475
213 Ga0207667_10217679 3300025949 Bacteria 1957
214 Ga0207651_10005996 3300025960 Bacteria 6302
215 Ga0207640_10023760 3300025981 Bacteria 3689
216 Ga0207658_10013438 3300025986 Bacteria 5592
217 Ga0207678_10010673 3300026067 Bacteria 8068
218 Ga0207702_10003006 3300026078 Bacteria 15677
219 Ga0207702_10023391 3300026078 Bacteria 5124
220 Ga0207702_10028810 3300026078 Bacteria 4619
221 Ga0207648_10004697 3300026089 Bacteria 13967
222 Ga0207674_10000083 3300026116 Bacteria 101460
223 Ga0207674_10005476 3300026116 Bacteria 15081
224 Ga0207674_10017002 3300026116 Bacteria 7942
225 Ga0207674_10041039 3300026116 Bacteria 4788
226 Ga0207674_10083304 3300026116 Bacteria 3198
227 Ga0209371_1010428 3300027312 Bacteria 2857
228 Ga0307517_10000058 3300028786 Bacteria 148725
229 Ga0307515_10001640 3300028794 Bacteria 49762
230 Ga0307515_10041504 3300028794 Bacteria 7230
231 Ga0265338_10000045 3300028800 Bacteria 223264
232 Ga0265338_10000385 3300028800 Bacteria 79013
233 Ga0265338_10000877 3300028800 Bacteria 50749
234 Ga0265338_10001069 3300028800 Bacteria 45514
235 Ga0265338_10012131 3300028800 Bacteria 9846
236 Ga0265338_10013684 3300028800 Bacteria 9131
237 Ga0265324_10005057 3300029957 Bacteria 5780
238 Ga0268256_1011185 3300030500 Bacteria 2857
239 Ga0307511_10045505 3300030521 Bacteria 3625
240 Ga0265330_10018681 3300031235 Bacteria 3182
241 Ga0265339_10024920 3300031249 Bacteria 3442
242 Ga0265331_10011343 3300031250 Bacteria 4885
243 Ga0265327_10004536 3300031251 Bacteria 12242
244 Ga0265316_10038098 3300031344 Bacteria 3877
245 Ga0307513_10031976 3300031456 Bacteria 5945
246 Ga0307509_10000063 3300031507 Bacteria 143708
247 Ga0265313_10017025 3300031595 Bacteria 4152
248 Ga0307508_10000280 3300031616 Bacteria 62637
249 Ga0265314_10025829 3300031711 Bacteria 4423
250 Ga0265342_10014824 3300031712 Bacteria 5159
251 Ga0307516_10005543 3300031730 Bacteria 15055
252 Ga0307412_10001070 3300031911 Bacteria 15660
253 Ga0307507_10059322 3300033179 Bacteria 3583
254 Ga0307510_10023782 3300033180 Bacteria 7096
255 Ga0373934_0000911 3300035086 Bacteria 10689
256 Ga0373939_0006018 3300035114 Bacteria 2910
257 Ga0373953_0000342 3300035117 Bacteria 12557
258 Ga0373953_0080946 3300035117 Bacteria 1350
259 Ga0373954_0038831 3300035118 Bacteria 2215
260 Ga0373956_0000661 3300035119 Bacteria 14184
261 Ga0373955_0000251 3300035172 Bacteria 22333
262 Ga0373935_0046111 3300035692 Bacteria 2752
263 Ga0373933_0000038 3300035724 Bacteria 80976
264 Ga0373933_0000886 3300035724 Bacteria 18310
265 Ga0373933_0028683 3300035724 Bacteria 3212
266 Ga0373937_0010463 3300036401 Bacteria 8100
267 Ga0373937_0014582 3300036401 Bacteria 6942
268 Ga0395899_0000774 3300037312 Bacteria 31573
269 Ga0395899_0003479 3300037312 Bacteria 12474
270 Ga0395899_0008909 3300037312 Bacteria 7726
271 Ga0395899_0040913 3300037312 Bacteria 3465
272 Ga0395899_0076075 3300037312 Bacteria 2451
273 Ga0395900_0005516 3300037418 Bacteria 13245
274 Ga0395900_0012523 3300037418 Bacteria 8676
275 Ga0395900_0026115 3300037418 Bacteria 5980
276 Ga0395900_0073403 3300037418 Bacteria 3517
277 Ga0395900_0149508 3300037418 Bacteria 2386
278 Ga0395898_0004948 3300037466 Bacteria 14463
279 Ga0395898_0005599 3300037466 Bacteria 13545
280 Ga0395898_0047212 3300037466 Bacteria 4226
281 Ga0395905_0019538 3300037471 Bacteria 6422
282 Ga0395905_0180215 3300037471 Bacteria 1983
283 Ga0436364_0610319 3300037853 Bacteria 5888
284 Ga0395901_0000105 3300038443 Bacteria 114318
285 Ga0395901_0002652 3300038443 Bacteria 18087
286 Ga0395901_0007448 3300038443 Bacteria 11045
287 Ga0395901_0014452 3300038443 Bacteria 8034
288 Ga0395901_0026756 3300038443 Bacteria 5921
289 Ga0395901_0030200 3300038443 Bacteria 5583
290 Ga0436361_0019520 3300039447 Bacteria 10241
291 Ga0466960_0015685 3300044901 Bacteria 3272
292 Ga0466959_0068514 3300045049 Bacteria 2571
293 Ga0495592_0000193 3300046454 Bacteria 52351
294 Ga0495592_0001115 3300046454 Bacteria 18689
295 Ga0495592_0011803 3300046454 Bacteria 6619
296 Ga0495603_0000395 3300046455 Bacteria 23955
297 Ga0495603_0038731 3300046455 Bacteria 2858
298 Ga0495629_0000119 3300046459 Bacteria 69922
299 Ga0495629_0003382 3300046459 Bacteria 12059
300 Ga0495638_0002000 3300046460 Bacteria 17405
301 Ga0495638_0021833 3300046460 Bacteria 4209
302 Ga0495651_0002362 3300046462 Bacteria 14575
303 Ga0495653_0000105 3300046463 Bacteria 69642
304 Ga0495653_0001366 3300046463 Bacteria 18943
305 Ga0495653_0002557 3300046463 Bacteria 14498
306 Ga0495653_0011587 3300046463 Bacteria 7198
307 Ga0495653_0032293 3300046463 Bacteria 4158
308 Ga0495650_0001833 3300046471 Bacteria 19020
309 Ga0495650_0007573 3300046471 Bacteria 6501
310 Ga0495650_0008856 3300046471 Bacteria 5809
311 Ga0495650_0027866 3300046471 Bacteria 2603
312 Ga0495580_0000024 3300046472 Bacteria 87183
313 Ga0495580_0000323 3300046472 Bacteria 39066
314 Ga0495580_0002234 3300046472 Bacteria 16916
315 Ga0495580_0003279 3300046472 Bacteria 13837
316 Ga0495582_0005971 3300046473 Bacteria 6786
317 Ga0495582_0006122 3300046473 Bacteria 6697
318 Ga0495605_0005007 3300046474 Bacteria 7742
319 Ga0495605_0008308 3300046474 Bacteria 5870
320 Ga0495664_0068120 3300046477 Bacteria 2124
321 Ga0495594_0052068 3300046499 Bacteria 2253
322 Ga0495596_0000078 3300046500 Bacteria 67709
323 Ga0495596_0000403 3300046500 Bacteria 27580
324 Ga0495596_0013849 3300046500 Bacteria 3409
325 Ga0495583_0000040 3300046506 Bacteria 236558
326 Ga0495583_0000071 3300046506 Bacteria 183691
327 Ga0495583_0000255 3300046506 Bacteria 88289
328 Ga0495583_0014674 3300046506 Bacteria 4307
329 Ga0495606_0004513 3300046507 Bacteria 13855
330 Ga0495606_0026107 3300046507 Bacteria 4166
331 Ga0495608_0004320 3300046511 Bacteria 10177
332 Ga0495608_0022653 3300046511 Bacteria 4308
333 Ga0495610_0010748 3300046512 Bacteria 5661
334 Ga0495618_0002768 3300046514 Bacteria 11145
335 Ga0495618_0006846 3300046514 Bacteria 6907
336 Ga0495618_0015904 3300046514 Bacteria 4593
337 Ga0495618_0101468 3300046514 Bacteria 1842
338 Ga0495628_0010838 3300046516 Bacteria 7717
339 Ga0495628_0039354 3300046516 Bacteria 3782
340 Ga0495628_0040751 3300046516 Bacteria 3709
341 Ga0495628_0170273 3300046516 Bacteria 1651
342 Ga0495630_0000889 3300046517 Bacteria 20972
343 Ga0495630_0002177 3300046517 Bacteria 13651
344 Ga0495630_0002237 3300046517 Bacteria 13467
345 Ga0495630_0006184 3300046517 Bacteria 8493
346 Ga0495631_0001178 3300046518 Bacteria 16164
347 Ga0495648_0000756 3300046524 Bacteria 34518
348 Ga0495648_0003672 3300046524 Bacteria 13419
349 Ga0495648_0005342 3300046524 Bacteria 10705
350 Ga0495666_0003121 3300046526 Bacteria 8328
351 Ga0495652_0004066 3300046529 Bacteria 14134
352 Ga0495652_0047394 3300046529 Bacteria 3685
353 Ga0495652_0095109 3300046529 Bacteria 2428
354 Ga0495665_0006163 3300046531 Bacteria 6478
355 Ga0495665_0021815 3300046531 Bacteria 3444
356 Ga0495665_0030564 3300046531 Bacteria 2883
357 Ga0495640_0002055 3300046533 Bacteria 16055
358 Ga0495640_0026017 3300046533 Bacteria 4236
359 Ga0495586_0017036 3300046535 Bacteria 3864
360 Ga0495587_0001662 3300046536 Bacteria 14848
361 Ga0495587_0041985 3300046536 Bacteria 2728
362 Ga0495609_0014893 3300046538 Bacteria 3648
363 Ga0495621_0008864 3300046539 Bacteria 3032
364 Ga0495645_0044555 3300046543 Bacteria 3235
365 Ga0495633_0001764 3300046558 Bacteria 16041
366 Ga0495667_0017486 3300046559 Bacteria 4842
367 Ga0495668_0055477 3300046616 Bacteria 2188
368 Ga0495611_0006324 3300046648 Bacteria 5046
369 Ga0495625_0037174 3300046660 Bacteria 3574
370 Ga0495635_0001063 3300046663 Bacteria 18175
371 Ga0495635_0010129 3300046663 Bacteria 6593
372 Ga0495635_0025917 3300046663 Bacteria 4083
373 Ga0495661_0004127 3300046665 Bacteria 10576
374 Ga0495599_0001267 3300046678 Bacteria 14348
375 Ga0495599_0023526 3300046678 Bacteria 3852
376 Ga0495599_0051460 3300046678 Bacteria 2580
377 Ga0495623_0008746 3300046679 Bacteria 6574
378 Ga0495623_0012053 3300046679 Bacteria 5599
379 Ga0495623_0024985 3300046679 Bacteria 3848
380 Ga0495646_0001051 3300046680 Bacteria 15983
381 Ga0495646_0004012 3300046680 Bacteria 9221
382 Ga0495646_0055513 3300046680 Bacteria 2378
383 Ga0495669_0071465 3300046684 Bacteria 1582
384 Ga0495613_0001334 3300046689 Bacteria 18846
385 Ga0495613_0003593 3300046689 Bacteria 11621
386 Ga0495624_0000231 3300046690 Bacteria 43799
387 Ga0495624_0000412 3300046690 Bacteria 34010
388 Ga0495624_0030802 3300046690 Bacteria 3492
389 Ga0495671_0006076 3300046692 Bacteria 7013
390 Ga0495671_0020416 3300046692 Bacteria 3491
391 Ga0495649_0000286 3300046694 Bacteria 44673
392 Ga0495589_0002843 3300046794 Bacteria 9577
393 Ga0495589_0012389 3300046794 Bacteria 4417
394 Ga0495600_0006948 3300046809 Bacteria 6906
395 Ga0495660_0085233 3300046810 Bacteria 1651
396 Ga0495604_0002555 3300047317 Bacteria 14548
397 Ga0495604_0002846 3300047317 Bacteria 13888
398 Ga0495604_0012604 3300047317 Bacteria 6726
399 Ga0495604_0052737 3300047317 Bacteria 3147
400 Ga0495674_0000035 3300047319 Bacteria 104643
401 Ga0495674_0000381 3300047319 Bacteria 39676
402 Ga0495674_0036323 3300047319 Bacteria 4435
403 Ga0495674_0044560 3300047319 Bacteria 3943
404 Ga0495674_0069856 3300047319 Bacteria 3036
405 Ga0495674_0092887 3300047319 Bacteria 2576
406 Ga0495672_0031102 3300047320 Bacteria 3336
407 Ga0495672_0070900 3300047320 Bacteria 1973
408 Ga0495676_0022853 3300047321 Bacteria 5434
409 Ga0495676_0119795 3300047321 Bacteria 1916
410 Ga0495680_0033514 3300047322 Bacteria 4156
411 Ga0495680_0047330 3300047322 Bacteria 3383
412 Ga0495680_0069648 3300047322 Bacteria 2683
413 Ga0495683_0004879 3300047323 Bacteria 7514
414 Ga0495683_0027824 3300047323 Bacteria 2890
415 Ga0495675_0001018 3300047444 Bacteria 17023
416 Ga0495675_0008617 3300047444 Bacteria 6322
417 Ga0495675_0016629 3300047444 Bacteria 4653
418 Ga0495679_000036 3300047446 Bacteria 161473
419 Ga0495679_005309 3300047446 Bacteria 5733
420 Ga0495673_0009078 3300047469 Bacteria 5525
421 Ga0495673_0025324 3300047469 Bacteria 2851
422 Ga0495681_0035649 3300047470 Bacteria 2468
423 Ga0495684_0001827 3300047471 Bacteria 17110
424 Ga0495686_0002094 3300047472 Bacteria 19595
425 Ga0495686_0015295 3300047472 Bacteria 5246
426 Ga0495686_0016859 3300047472 Bacteria 4940
427 Ga0495686_0018540 3300047472 Bacteria 4667
428 Ga0495593_0000717 3300047673 Bacteria 19212
429 Ga0495593_0005854 3300047673 Bacteria 7245
430 Ga0495593_0015696 3300047673 Bacteria 4285
431 Ga0495593_0028370 3300047673 Bacteria 3074
432 Ga0495602_0016442 3300048088 Bacteria 7441
433 Ga0495602_0033992 3300048088 Bacteria 4775
434 Ga0495614_0003058 3300048089 Bacteria 7458
435 Ga0495626_0001767 3300048091 Bacteria 16435
436 Ga0495626_0034436 3300048091 Bacteria 2422
437 Ga0496101_0004301 3300048904 Bacteria 8938
438 Ga0496101_0012221 3300048904 Bacteria 5723
439 Ga0496104_0131629 3300048907 Bacteria 2403
440 Ga0496105_0009840 3300048908 Bacteria 7493
441 Ga0496109_0108589 3300048912 Bacteria 2579
442 Ga0496113_0002954 3300048916 Bacteria 10047
443 Ga0496115_0058737 3300048918 Bacteria 3096
444 Ga0496116_0008603 3300048919 Bacteria 8832
445 Ga0496117_0005331 3300048920 Bacteria 13570
446 Ga0496117_0023275 3300048920 Bacteria 4943
447 Ga0496118_0005856 3300048921 Bacteria 13779
448 Ga0496118_0011443 3300048921 Bacteria 8660
449 Ga0496118_0048123 3300048921 Bacteria 3298
450 Ga0496118_0072099 3300048921 Bacteria 2483
451 Ga0496119_0014415 3300048922 Bacteria 6189
452 Ga0496119_0038342 3300048922 Bacteria 3098
453 Ga0496120_0014159 3300048923 Bacteria 5324
454 Ga0496121_0000041 3300048924 Bacteria 346686
455 Ga0496121_0000125 3300048924 Bacteria 169274
456 Ga0496121_0000186 3300048924 Bacteria 138418
457 Ga0496121_0000188 3300048924 Bacteria 138221
458 Ga0496121_0000313 3300048924 Bacteria 100952
459 Ga0496121_0000748 3300048924 Bacteria 59722
460 Ga0496121_0001152 3300048924 Bacteria 46357
461 Ga0496121_0005309 3300048924 Bacteria 16570
462 Ga0496121_0007227 3300048924 Bacteria 13447
463 Ga0496121_0009544 3300048924 Bacteria 11117
464 Ga0496121_0016679 3300048924 Bacteria 7560
465 Ga0496121_0027896 3300048924 Bacteria 5273
466 Ga0496122_0003228 3300048925 Bacteria 21667
467 Ga0496123_0001818 3300048926 Bacteria 28065
468 Ga0496124_0000007 3300048927 Bacteria 883534
469 Ga0496124_0006245 3300048927 Bacteria 13052
470 Ga0496124_0023535 3300048927 Bacteria 5621
471 Ga0496125_0000096 3300048928 Bacteria 205618
472 Ga0496125_0040379 3300048928 Bacteria 4004
473 Ga0496126_0000681 3300048929 Bacteria 62495
474 Ga0496126_0001335 3300048929 Bacteria 39121
475 Ga0496126_0002443 3300048929 Bacteria 25088
476 Ga0496126_0008989 3300048929 Bacteria 10690
477 Ga0496126_0026357 3300048929 Bacteria 5575
478 Ga0496126_0060179 3300048929 Bacteria 3417
479 Ga0495678_021624 3300049459 Bacteria 2829
480 Ga0495682_0007270 3300049460 Bacteria 4419
481 Ga0495682_0012913 3300049460 Bacteria 3188
482 Ga0501033_0003108 3300049570 Bacteria 13780
483 Ga0501034_0088088 3300049571 Bacteria 3103
484 Ga0501037_0048377 3300049573 Bacteria 3117
485 Ga0501038_0059329 3300049574 Bacteria 3278
486 Ga0501043_0064332 3300049579 Bacteria 2880
487 Ga0501047_0006778 3300049581 Bacteria 10763
488 Ga0501047_0163043 3300049581 Bacteria 2101
489 Ga0501069_0013538 3300049585 Bacteria 4349
490 Ga0501069_0048618 3300049585 Bacteria 2356
491 Ga0501070_0001844 3300049586 Bacteria 18698
492 Ga0501070_0010334 3300049586 Bacteria 7891
493 Ga0501070_0035132 3300049586 Bacteria 4189
494 Ga0501073_0002180 3300049589 Bacteria 14631
495 Ga0501074_0024501 3300049590 Bacteria 4386
496 Ga0501080_0053021 3300049742 Bacteria 3775
497 Ga0501080_0089039 3300049742 Bacteria 2867
498 Ga0501080_0121540 3300049742 Bacteria 2419
499 Ga0501083_0009975 3300049744 Bacteria 6701
500 Ga0501035_0005816 3300049822 Bacteria 11625
501 Ga0501035_0039055 3300049822 Bacteria 4297
502 Ga0501035_0043172 3300049822 Bacteria 4064
503 Ga0501044_0002263 3300049823 Bacteria 21955
504 Ga0501044_0010043 3300049823 Bacteria 10287
505 Ga0501044_0169713 3300049823 Bacteria 2154
506 Ga0501044_0215175 3300049823 Bacteria 1874
507 nmdc:mga0k408_37375_c1 3300050493 Bacteria 2787
508 nmdc:mga07m45_3533_c1 3300050496 Bacteria 7549
509 nmdc:mga0rr50_64091_c1 3300050513 Bacteria 2778
510 Ga0495601_0056789 3300053077 Bacteria 2479
511 Ga0500635_0000103 3300053080 Bacteria 50667
512 Ga0495595_0038883 3300053084 Bacteria 2169
513 Ga0495619_0074907 3300053085 Bacteria 2270
514 Ga0500651_0000241 3300053093 Bacteria 33596
515 Ga0500651_0003619 3300053093 Bacteria 8484
516 Ga0500651_0036819 3300053093 Bacteria 3083
517 Ga0500566_0000087 3300053094 Bacteria 45921
518 Ga0500640_006312 3300053095 Bacteria 4512
519 Ga0500571_000069 3300053110 Bacteria 32297
520 Ga0500572_000096 3300053111 Bacteria 28795
521 Ga0500593_000466 3300053117 Bacteria 16072
522 Ga0500594_0003077 3300053118 Bacteria 3652
523 Ga0500607_007818 3300053121 Bacteria 6560
524 Ga0500608_040933 3300053122 Bacteria 2221
525 Ga0500658_0001890 3300053134 Bacteria 8211
526 Ga0500559_0000022 3300053136 Bacteria 128071
527 Ga0500559_0014282 3300053136 Bacteria 3355
528 Ga0500559_0016048 3300053136 Bacteria 3163
529 Ga0500568_0000914 3300053139 Bacteria 20361
530 Ga0500616_0022708 3300053153 Bacteria 3500
531 Ga0500619_000087 3300053154 Bacteria 25980
532 Ga0500622_0002037 3300053156 Bacteria 15073
533 Ga0500627_0003931 3300053158 Bacteria 4693
534 Ga0500630_004510 3300053159 Bacteria 6771
535 Ga0500638_003658 3300053162 Bacteria 5748
536 Ga0500639_000264 3300053163 Bacteria 25991
537 Ga0500639_063862 3300053163 Bacteria 1892
538 Ga0500596_000928 3300053735 Bacteria 5845
539 Ga0500596_001336 3300053735 Bacteria 4971
540 2508693019 2508501042 Bacteria 8719808
541 2509149511 2508501128 Bacteria 8613869
542 2513231447 2513020051 Bacteria 6053213
543 2514052531 2513237166 Bacteria 10373764
544 2515630102 2515154112 Bacteria 8294334
545 2516018700 2515154189 Bacteria 9629850
546 2524437243 2524023205 Bacteria 8918781
547 2563056592 2562617112 Bacteria 10918404
548 2599624641 2599185214 Bacteria 8209958
549 2599672497 2599185226 Bacteria 8233575
550 2599683497 2599185227 Bacteria 8246414
551 2599694106 2599185229 Bacteria 8216126
552 2599904492 2599185292 Bacteria 6290804
553 2643861081 2643221569 Bacteria 6064337
554 2643983468 2643221594 Bacteria 5811388
555 2644124382 2643221621 Bacteria 6212786
556 2644305403 2643221654 Bacteria 5273570
557 2644328176 2643221658 Bacteria 6064537
558 2644398508 2643221672 Bacteria 6322190
559 2713481400 2711768613 Bacteria 11048459
560 2723875971 2721755763 Bacteria 4464185
561 2738720082 2738541277 Bacteria 7458140
562 2738881624 2738541307 Bacteria 8606193
563 2739279281 2738543019 Bacteria 7459457
564 2745076461 2744054633 Bacteria 8678936
565 2792832518 2791355137 Bacteria 9654227
566 2792837407 2791355137 Bacteria 9654227
567 2809032619 2808606395 Bacteria 6020352
568 2819596038 2818991446 Bacteria 7757362
569 2831266812 2831265667 Bacteria 7184833
570 2838056869 2838054893 Bacteria 7451788
571 2855733761 2855730933 Bacteria 7047938
572 2855772022 2855767633 Bacteria 7049357
573 2857542309 2857537821 Bacteria 5248181
574 2857544161 2857542790 Bacteria 5326616
575 2858955368 2858950400 Bacteria 6783797
576 2876769942 2876761206 Bacteria 10111113
577 2881417611 2881412998 Bacteria 6492157
578 2883090199 2883087390 Bacteria 9532701
579 2885201377 2885198086 Bacteria 7212419
580 2885215043 2885211737 Bacteria 7212420
581 2894025190 2894023352 Bacteria 5167372
582 2899925388 2899924645 Bacteria 7487985
583 2900642503 2900634093 Bacteria 10263517
584 2904490673 2904483920 Bacteria 7545285
585 2904548492 2904541872 Bacteria 8915136
586 2904623102 2904615490 Bacteria 10047340
587 2928038490 2928037797 Bacteria 7273642
588 2928045905 2928044640 Bacteria 7271509
589 2928053580 2928051484 Bacteria 7773759
590 2928067127 2928064002 Bacteria 7419480
591 2928070968 2928070936 Bacteria 8062541
592 2928085080 2928084124 Bacteria 7159212
593 2929163890 2929160207 Bacteria 9075316
594 2929200561 2929199973 Bacteria 7260745
595 2932426315 2932422444 Bacteria 4678430
596 2935700841 2935694250 Bacteria 9291695
597 2935981867 2935975950 Bacteria 8347125
598 2941485451
599 2945912600 2945909444 Bacteria 7065066
600 2945985114 2945984333 Bacteria 7358892
601 8019629612 8019629233 Bacteria 8687553
602 8019648304 8019638758 Bacteria 9062356
603 8019669214 8019668869 Bacteria 8791617
604 8019678285 8019678201 Bacteria 8863603
605 8054008612 8054002106 Bacteria 7987183
606 8055913881 8055909800 Bacteria 7278581
607 JGI25151J46595_10006742
608 JGI25156J39149_1014617
609 JGI25154J39366_1005966
610 JGI25157J39369_1000059
611 JGI25152J39213_1001574
612 JGI25159J45721_1001236
613 JGI25151J46595_10001321
614 JGI25151J46595_10001847
615 JGI25151J46595_10002423
616 JGI25151J46595_10003001
617 JGI25151J46595_10003009
618 JGI25165J46597_1001353
619 JGI25153J46596_10002982
620 JGI25153J46596_10006821
621 rootH2_10053935
622 JGI25160J50197_1000090
623 Ga0055539_1001176
624 Ga0055532_1000281
625 Ga0055527_1000252
626 Ga0055535_1000322
627 Ga0055535_1000415
628 Ga0055535_1000532
629 Ga0055542_1000004
630 Ga0055542_1000554
631 Ga0055529_1000529
632 Ga0055536_1000124
633 Ga0055534_1002263
634 Ga0055534_1002471
635 Ga0055531_10010180
636 Ga0065165_1000593
637 Ga0065165_1002672
638 Ga0070658_10010399
639 Ga0070676_10029140
640 Ga0070683_100002204
641 Ga0070683_100122728
642 Ga0070677_10016366
643 Ga0068868_100121031
644 Ga0070661_100001194
645 Ga0070669_100107641
646 Ga0070675_100017170
647 Ga0070671_100014242
648 Ga0070673_100002966
649 Ga0070659_100019592
650 Ga0070667_100000705
651 Ga0070667_100024895
652 Ga0070667_100081940
653 Ga0070709_10004057
654 Ga0070714_100028778
655 Ga0070714_100099647
656 Ga0070713_100017101
657 Ga0070713_100134400
658 Ga0070711_100062747
659 Ga0070708_100168972
660 Ga0070662_100080010
661 Ga0070681_10127530
662 Ga0068867_100007596
663 Ga0070684_100002133
664 Ga0068853_100097385
665 Ga0068855_100004798
666 Ga0068855_100072810
667 Ga0070664_100002007
668 Ga0068857_100002378
669 Ga0068857_100011778
670 Ga0068857_100031355
671 Ga0068857_100136746
672 Ga0068854_100001921
673 Ga0068854_100119908
674 Ga0068856_100000183
675 Ga0068856_100009723
676 Ga0068852_100005481
677 Ga0068851_10015729
678 Ga0068862_100049868
679 Ga0070717_10092606
680 Ga0075366_10019168
681 Ga0075366_10037871
682 Ga0068871_100078210
683 Ga0068865_100066229
684 Ga0105240_10001899
685 Ga0105240_10063040
686 Ga0105243_10002525
687 Ga0105243_10102195
688 Ga0105243_10156988
689 Ga0105237_10002284
690 Ga0105237_10007183
691 Ga0105237_10038136
692 Ga0105237_10052456
693 Ga0105238_10008515
694 Ga0105238_10018626
695 Ga0105238_10034450
696 Ga0105238_10118115
697 Ga0105239_10000832
698 Ga0105239_10024929
699 Ga0157373_10011906
700 Ga0157371_10062185
701 Ga0157370_10013435
702 Ga0157370_10018516
703 Ga0157370_10052053
704 Ga0157370_10230940
705 Ga0157369_10005656
706 Ga0157369_10008411
707 Ga0157369_10017339
708 Ga0157369_10057894
709 Ga0157369_10067390
710 Ga0157369_10238387
711 Ga0157374_10011426
712 Ga0163162_10136672
713 Ga0157372_10133203
714 Ga0157375_10130505
715 Ga0157375_10200643
716 Ga0182008_10006902
717 Ga0182008_10050604
718 Ga0182007_10001138
719 Ga0163161_10000112
720 Ga0213872_10002690
721 Ga0209672_100021
722 Ga0209672_100497
723 Ga0209147_100025
724 Ga0209147_101326
725 Ga0209258_100022
726 Ga0209258_100025
727 Ga0209258_100037
728 Ga0207425_1000138
729 Ga0209646_1000112
730 Ga0209026_1000038
731 Ga0209677_100320
732 Ga0209148_1000034
733 Ga0209148_1000049
734 Ga0209759_1000031
735 Ga0209759_1000139
736 Ga0209759_1002804
737 Ga0209759_1007472
738 Ga0209129_1000023
739 Ga0209129_1000558
740 Ga0209129_1005045
741 Ga0209233_1000398
742 Ga0209565_1000403
743 Ga0209565_1001540
744 Ga0209455_1000041
745 Ga0209455_1000112
746 Ga0209673_1000673
747 Ga0209673_1000928
748 Ga0209130_1000222
749 Ga0209130_1000763
750 Ga0209675_1000129
751 Ga0209675_1001282
752 Ga0209675_1003428
753 Ga0209676_1000005
754 Ga0209676_1000014
755 Ga0209025_1000028
756 Ga0209025_1000157
757 Ga0209025_1000232
758 Ga0209025_1000476
759 Ga0209025_1001078
760 Ga0209025_1030274
761 Ga0209564_1000309
762 Ga0209564_1000400
763 Ga0209564_1000669
764 Ga0209564_1000898
765 Ga0209758_1000064
766 Ga0209758_1005231
767 Ga0209050_1000007
768 Ga0209256_1000038
769 Ga0209256_1000115
770 Ga0207426_1000001
771 Ga0207426_1000110
772 Ga0207426_1000785
773 Ga0209051_1000009
774 Ga0209051_1002266
775 Ga0209051_1002476
776 Ga0209051_1009721
777 Ga0209051_1010655
778 Ga0209257_1000011
779 Ga0209257_1000508
780 Ga0209257_1004838
781 Ga0209257_1017431
782 Ga0207656_10010156
783 Ga0207699_10012259
784 Ga0207645_10009502
785 Ga0207705_10046145
786 Ga0207654_10039007
787 Ga0207707_10066362
788 Ga0207695_10023931
789 Ga0207695_10122722
790 Ga0207695_10122958
791 Ga0207671_10006328
792 Ga0207671_10061173
793 Ga0207671_10094187
794 Ga0207663_10029917
795 Ga0207657_10017242
796 Ga0207649_10038654
797 Ga0207649_10043055
798 Ga0207649_10105582
799 Ga0207652_10075264
800 Ga0207694_10008131
801 Ga0207694_10012738
802 Ga0207650_10083245
803 Ga0207700_10050830
804 Ga0207664_10076496
805 Ga0207690_10069054
806 Ga0207706_10069517
807 Ga0207709_10002298
808 Ga0207709_10072056
809 Ga0207704_10058135
810 Ga0207665_10019051
811 Ga0207691_10010898
812 Ga0207661_10003294
813 Ga0207661_10138496
814 Ga0207679_10004812
815 Ga0207679_10013854
816 Ga0207667_10005305
817 Ga0207667_10030418
818 Ga0207667_10076407
819 Ga0207667_10217679
820 Ga0207651_10005996
821 Ga0207640_10023760
822 Ga0207658_10013438
823 Ga0207678_10010673
824 Ga0207702_10003006
825 Ga0207702_10023391
826 Ga0207702_10028810
827 Ga0207648_10004697
828 Ga0207674_10000083
829 Ga0207674_10005476
830 Ga0207674_10017002
831 Ga0207674_10041039
832 Ga0207674_10083304
833 Ga0209371_1010428
834 Ga0307517_10000058
835 Ga0307515_10001640
836 Ga0307515_10041504
837 Ga0265338_10000045
838 Ga0265338_10000385
839 Ga0265338_10000877
840 Ga0265338_10001069
841 Ga0265338_10012131
842 Ga0265338_10013684
843 Ga0265324_10005057
844 Ga0268256_1011185
845 Ga0307511_10045505
846 Ga0265330_10018681
847 Ga0265339_10024920
848 Ga0265331_10011343
849 Ga0265327_10004536
850 Ga0265316_10038098
851 Ga0307513_10031976
852 Ga0307509_10000063
853 Ga0265313_10017025
854 Ga0307508_10000280
855 Ga0265314_10025829
856 Ga0265342_10014824
857 Ga0307516_10005543
858 Ga0307412_10001070
859 Ga0307507_10059322
860 Ga0307510_10023782
861 Ga0373934_0000911
862 Ga0373939_0006018
863 Ga0373953_0000342
864 Ga0373953_0080946
865 Ga0373954_0038831
866 Ga0373956_0000661
867 Ga0373955_0000251
868 Ga0373935_0046111
869 Ga0373933_0000038
870 Ga0373933_0000886
871 Ga0373933_0028683
872 Ga0373937_0010463
873 Ga0373937_0014582
874 Ga0395899_0000774
875 Ga0395899_0003479
876 Ga0395899_0008909
877 Ga0395899_0040913
878 Ga0395899_0076075
879 Ga0395900_0005516
880 Ga0395900_0012523
881 Ga0395900_0026115
882 Ga0395900_0073403
883 Ga0395900_0149508
884 Ga0395898_0004948
885 Ga0395898_0005599
886 Ga0395898_0047212
887 Ga0395905_0019538
888 Ga0395905_0180215
889 Ga0436364_0610319
890 Ga0395901_0000105
891 Ga0395901_0002652
892 Ga0395901_0007448
893 Ga0395901_0014452
894 Ga0395901_0026756
895 Ga0395901_0030200
896 Ga0436361_0019520
897 Ga0466960_0015685
898 Ga0466959_0068514
899 Ga0495592_0000193
900 Ga0495592_0001115
901 Ga0495592_0011803
902 Ga0495603_0000395
903 Ga0495603_0038731
904 Ga0495629_0000119
905 Ga0495629_0003382
906 Ga0495638_0002000
907 Ga0495638_0021833
908 Ga0495651_0002362
909 Ga0495653_0000105
910 Ga0495653_0001366
911 Ga0495653_0002557
912 Ga0495653_0011587
913 Ga0495653_0032293
914 Ga0495650_0001833
915 Ga0495650_0007573
916 Ga0495650_0008856
917 Ga0495650_0027866
918 Ga0495580_0000024
919 Ga0495580_0000323
920 Ga0495580_0002234
921 Ga0495580_0003279
922 Ga0495582_0005971
923 Ga0495582_0006122
924 Ga0495605_0005007
925 Ga0495605_0008308
926 Ga0495664_0068120
927 Ga0495594_0052068
928 Ga0495596_0000078
929 Ga0495596_0000403
930 Ga0495596_0013849
931 Ga0495583_0000040
932 Ga0495583_0000071
933 Ga0495583_0000255
934 Ga0495583_0014674
935 Ga0495606_0004513
936 Ga0495606_0026107
937 Ga0495608_0004320
938 Ga0495608_0022653
939 Ga0495610_0010748
940 Ga0495618_0002768
941 Ga0495618_0006846
942 Ga0495618_0015904
943 Ga0495618_0101468
944 Ga0495628_0010838
945 Ga0495628_0039354
946 Ga0495628_0040751
947 Ga0495628_0170273
948 Ga0495630_0000889
949 Ga0495630_0002177
950 Ga0495630_0002237
951 Ga0495630_0006184
952 Ga0495631_0001178
953 Ga0495648_0000756
954 Ga0495648_0003672
955 Ga0495648_0005342
956 Ga0495666_0003121
957 Ga0495652_0004066
958 Ga0495652_0047394
959 Ga0495652_0095109
960 Ga0495665_0006163
961 Ga0495665_0021815
962 Ga0495665_0030564
963 Ga0495640_0002055
964 Ga0495640_0026017
965 Ga0495586_0017036
966 Ga0495587_0001662
967 Ga0495587_0041985
968 Ga0495609_0014893
969 Ga0495621_0008864
970 Ga0495645_0044555
971 Ga0495633_0001764
972 Ga0495667_0017486
973 Ga0495668_0055477
974 Ga0495611_0006324
975 Ga0495625_0037174
976 Ga0495635_0001063
977 Ga0495635_0010129
978 Ga0495635_0025917
979 Ga0495661_0004127
980 Ga0495599_0001267
981 Ga0495599_0023526
982 Ga0495599_0051460
983 Ga0495623_0008746
984 Ga0495623_0012053
985 Ga0495623_0024985
986 Ga0495646_0001051
987 Ga0495646_0004012
988 Ga0495646_0055513
989 Ga0495669_0071465
990 Ga0495613_0001334
991 Ga0495613_0003593
992 Ga0495624_0000231
993 Ga0495624_0000412
994 Ga0495624_0030802
995 Ga0495671_0006076
996 Ga0495671_0020416
997 Ga0495649_0000286
998 Ga0495589_0002843
999 Ga0495589_0012389
1000 Ga0495600_0006948
1001 Ga0495660_0085233
1002 Ga0495604_0002555
1003 Ga0495604_0002846
1004 Ga0495604_0012604
1005 Ga0495604_0052737
1006 Ga0495674_0000035
1007 Ga0495674_0000381
1008 Ga0495674_0036323
1009 Ga0495674_0044560
1010 Ga0495674_0069856
1011 Ga0495674_0092887
1012 Ga0495672_0031102
1013 Ga0495672_0070900
1014 Ga0495676_0022853
1015 Ga0495676_0119795
1016 Ga0495680_0033514
1017 Ga0495680_0047330
1018 Ga0495680_0069648
1019 Ga0495683_0004879
1020 Ga0495683_0027824
1021 Ga0495675_0001018
1022 Ga0495675_0008617
1023 Ga0495675_0016629
1024 Ga0495679_000036
1025 Ga0495679_005309
1026 Ga0495673_0009078
1027 Ga0495673_0025324
1028 Ga0495681_0035649
1029 Ga0495684_0001827
1030 Ga0495686_0002094
1031 Ga0495686_0015295
1032 Ga0495686_0016859
1033 Ga0495686_0018540
1034 Ga0495593_0000717
1035 Ga0495593_0005854
1036 Ga0495593_0015696
1037 Ga0495593_0028370
1038 Ga0495602_0016442
1039 Ga0495602_0033992
1040 Ga0495614_0003058
1041 Ga0495626_0001767
1042 Ga0495626_0034436
1043 Ga0496101_0004301
1044 Ga0496101_0012221
1045 Ga0496104_0131629
1046 Ga0496105_0009840
1047 Ga0496109_0108589
1048 Ga0496113_0002954
1049 Ga0496115_0058737
1050 Ga0496116_0008603
1051 Ga0496117_0005331
1052 Ga0496117_0023275
1053 Ga0496118_0005856
1054 Ga0496118_0011443
1055 Ga0496118_0048123
1056 Ga0496118_0072099
1057 Ga0496119_0014415
1058 Ga0496119_0038342
1059 Ga0496120_0014159
1060 Ga0496121_0000041
1061 Ga0496121_0000125
1062 Ga0496121_0000186
1063 Ga0496121_0000188
1064 Ga0496121_0000313
1065 Ga0496121_0000748
1066 Ga0496121_0001152
1067 Ga0496121_0005309
1068 Ga0496121_0007227
1069 Ga0496121_0009544
1070 Ga0496121_0016679
1071 Ga0496121_0027896
1072 Ga0496122_0003228
1073 Ga0496123_0001818
1074 Ga0496124_0000007
1075 Ga0496124_0006245
1076 Ga0496124_0023535
1077 Ga0496125_0000096
1078 Ga0496125_0040379
1079 Ga0496126_0000681
1080 Ga0496126_0001335
1081 Ga0496126_0002443
1082 Ga0496126_0008989
1083 Ga0496126_0026357
1084 Ga0496126_0060179
1085 Ga0495678_021624
1086 Ga0495682_0007270
1087 Ga0495682_0012913
1088 Ga0501033_0003108
1089 Ga0501034_0088088
1090 Ga0501037_0048377
1091 Ga0501038_0059329
1092 Ga0501043_0064332
1093 Ga0501047_0006778
1094 Ga0501047_0163043
1095 Ga0501069_0013538
1096 Ga0501069_0048618
1097 Ga0501070_0001844
1098 Ga0501070_0010334
1099 Ga0501070_0035132
1100 Ga0501073_0002180
1101 Ga0501074_0024501
1102 Ga0501080_0053021
1103 Ga0501080_0089039
1104 Ga0501080_0121540
1105 Ga0501083_0009975
1106 Ga0501035_0005816
1107 Ga0501035_0039055
1108 Ga0501035_0043172
1109 Ga0501044_0002263
1110 Ga0501044_0010043
1111 Ga0501044_0169713
1112 Ga0501044_0215175
1113 nmdc:mga0k408_37375_c1
1114 nmdc:mga07m45_3533_c1
1115 nmdc:mga0rr50_64091_c1
1116 Ga0495601_0056789
1117 Ga0500635_0000103
1118 Ga0495595_0038883
1119 Ga0495619_0074907
1120 Ga0500651_0000241
1121 Ga0500651_0003619
1122 Ga0500651_0036819
1123 Ga0500566_0000087
1124 Ga0500640_006312
1125 Ga0500571_000069
1126 Ga0500572_000096
1127 Ga0500593_000466
1128 Ga0500594_0003077
1129 Ga0500607_007818
1130 Ga0500608_040933
1131 Ga0500658_0001890
1132 Ga0500559_0000022
1133 Ga0500559_0014282
1134 Ga0500559_0016048
1135 Ga0500568_0000914
1136 Ga0500616_0022708
1137 Ga0500619_000087
1138 Ga0500622_0002037
1139 Ga0500627_0003931
1140 Ga0500630_004510
1141 Ga0500638_003658
1142 Ga0500639_000264
1143 Ga0500639_063862
1144 Ga0500596_000928
1145 Ga0500596_001336
1146 2508693019
1147 2509149511
1148 2513231447
1149 2514052531
1150 2515630102
1151 2516018700
1152 2524437243
1153 2563056592
1154 2599624641
1155 2599672497
1156 2599683497
1157 2599694106
1158 2599904492
1159 2643861081
1160 2643983468
1161 2644124382
1162 2644305403
1163 2644328176
1164 2644398508
1165 2713481400
1166 2723875971
1167 2738720082
1168 2738881624
1169 2739279281
1170 2745076461
1171 2792832518
1172 2792837407
1173 2809032619
1174 2819596038
1175 2831266812
1176 2838056869
1177 2855733761
1178 2855772022
1179 2857542309
1180 2857544161
1181 2858955368
1182 2876769942
1183 2881417611
1184 2883090199
1185 2885201377
1186 2885215043
1187 2894025190
1188 2899925388
1189 2900642503
1190 2904490673
1191 2904548492
1192 2904623102
1193 2928038490
1194 2928045905
1195 2928053580
1196 2928067127
1197 2928070968
1198 2928085080
1199 2929163890
1200 2929200561
1201 2932426315
1202 2935700841
1203 2935981867
1204 2941485451
1205 2945912600
1206 2945985114
1207 8019629612
1208 8019648304
1209 8019669214
1210 8019678285
1211 8054008612
1212 8055913881

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01970

TctA

Tripartite tricarboxylate transporter TctA family

22

441

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4kpp-assembly1.cif.gz_A crystal structure of h+/ca2+ exchanger cax 0.2533 3 487
4kpp-assembly1.cif.gz_A crystal structure of h+/ca2+ exchanger cax 0.2497 3 487
5c5x-assembly2.cif.gz_E crystal structure of the s156e mutant of human aquaporin 5 0.248 15 363
7tak-assembly1.cif.gz_B structure of a nat transporter 0.2414 33 458
7z6n-assembly1.cif.gz_B crystal structure of zn2+-transporter bbzip in a metal-stripped state 0.235 101 487
ID Description Score Start End Superfamily
af_Q7XKI5_16_255_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.2701 16 371 1.20.1080.10
af_A4IA48_423_647_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.2573 172 376 1.20.1250.20
af_Q7XKI5_16_255_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.2525 16 371 1.20.1080.10
af_P45562_195_403_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.2468 154 434 1.20.1250.20
af_P45562_195_403_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.2444 154 434 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A7W8P8T2-F1-model_v4 TctA family transporter 0.9741 2 502 GO:0016020
AF-A0A844W8D4-F1-model_v4 Tripartite tricarboxylate transporter permease 0.9714 4 494 GO:0016020
AF-A0A2S9IWF4-F1-model_v4 DUF112 domain-containing protein 0.97 4 493 GO:0016020
AF-A0A7W8P8T2-F1-model_v4 TctA family transporter 0.9684 2 502 GO:0016020
AF-A0A857C6U4-F1-model_v4 Tripartite tricarboxylate transporter permease 0.9663 7 489 GO:0016020

Map