F468558

General Info

Members Datasets Scaffolds Average Seq Length
606 273 1212 148

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_101879294|Ga0070708_1018792941
Length 149
Sequence MTKPVYILNGPNLDRLGTREPEIYGRTTLDEIHAMIRTRAGELGLEIVDCFQSNHEGELIDRLHRRDFDVSVVNAAGLTHTSVSLRDALTGIGRPFIEVHLSDPWERDAFRKVNFIHDVAFETIKGQGPKGYLFALEVIAERLTGATNG

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
143 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
144 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
145 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
146 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
147 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
148 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
149 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
150 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
151 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
152 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
153 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
154 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
155 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
156 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
157 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
158 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
159 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
160 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
161 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
162 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
163 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
164 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
165 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
166 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
167 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
168 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
169 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
170 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
171 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
172 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
173 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
174 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
175 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
176 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
177 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
178 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
179 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
180 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
181 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
182 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
183 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
184 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
185 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
186 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
187 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
188 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
189 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
190 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
191 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
192 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
193 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
194 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
195 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
196 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
197 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
198 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
199 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
200 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
201 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
202 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
203 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
204 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
205 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
206 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
207 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
208 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
209 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
210 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
211 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
212 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
213 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
214 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
215 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
216 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
217 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
218 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
219 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
220 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
221 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
222 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
223 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
224 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
225 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
226 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
227 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
228 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
243 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
244 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
245 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
246 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
247 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
248 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
249 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
250 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
251 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
252 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
253 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
254 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
255 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
256 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
257 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
260 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
261 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
262 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
263 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
264 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
265 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
266 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
267 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
268 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
269 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
270 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
271 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
272 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
273 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.17
Nodule 0
Rhizoplane 7.76
Rhizosphere 91.42
Stem 0
Stem Tuber 0
Unclassified 3.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_101879294 3300005445 Bacteria 555
2 Ga0070690_100068392 3300005330 Bacteria 2304
3 Ga0070670_100749214 3300005331 Bacteria 880
4 Ga0070670_101426507 3300005331 Bacteria 635
5 Ga0068869_100123624 3300005334 Bacteria 1982
6 Ga0068869_100136839 3300005334 Bacteria 1888
7 Ga0070666_10193615 3300005335 Bacteria 1429
8 Ga0070680_100000064 3300005336 Bacteria 55845
9 Ga0070680_100109073 3300005336 Bacteria 2303
10 Ga0070682_100072469 3300005337 Bacteria 2208
11 Ga0070682_100320174 3300005337 Bacteria 1145
12 Ga0070682_100887105 3300005337 Bacteria 732
13 Ga0068868_100093433 3300005338 Bacteria 2425
14 Ga0068868_100220440 3300005338 Bacteria 1588
15 Ga0068868_100230998 3300005338 Bacteria 1552
16 Ga0068868_101130455 3300005338 Bacteria 722
17 Ga0070660_100213094 3300005339 Bacteria 1569
18 Ga0070689_100037490 3300005340 Bacteria 3706
19 Ga0070689_101152026 3300005340 Bacteria 695
20 Ga0070691_10120011 3300005341 Bacteria 1323
21 Ga0070691_10123398 3300005341 Bacteria 1306
22 Ga0070687_100188326 3300005343 Unclassified 1241
23 Ga0070661_100197565 3300005344 Bacteria 1536
24 Ga0070692_10012592 3300005345 Bacteria 3920
25 Ga0070692_10270976 3300005345 Bacteria 1025
26 Ga0070668_100102089 3300005347 Unclassified 2274
27 Ga0070668_100224078 3300005347 Bacteria 1552
28 Ga0070668_100826879 3300005347 Bacteria 824
29 Ga0070668_101212462 3300005347 Bacteria 684
30 Ga0070669_100016773 3300005353 Bacteria 5227
31 Ga0070669_100319632 3300005353 Bacteria 1253
32 Ga0070675_100013259 3300005354 Bacteria 6477
33 Ga0070675_100855712 3300005354 Bacteria 832
34 Ga0070671_100582137 3300005355 Bacteria 967
35 Ga0070674_100038948 3300005356 Bacteria 3207
36 Ga0070674_100462924 3300005356 Bacteria 1049
37 Ga0070673_100231631 3300005364 Bacteria 1602
38 Ga0070659_100843351 3300005366 Bacteria 798
39 Ga0070714_101172012 3300005435 Unclassified 749
40 Ga0070701_10023624 3300005438 Unclassified 2964
41 Ga0070701_10436690 3300005438 Bacteria 837
42 Ga0070705_100034043 3300005440 Bacteria 2845
43 Ga0070705_100076960 3300005440 Bacteria 2036
44 Ga0070705_100178886 3300005440 Bacteria 1435
45 Ga0070705_100246413 3300005440 Bacteria 1252
46 Ga0070705_100495666 3300005440 Bacteria 926
47 Ga0070700_100061043 3300005441 Bacteria 2377
48 Ga0070700_100146502 3300005441 Bacteria 1610
49 Ga0070700_100212175 3300005441 Bacteria 1367
50 Ga0070700_100242695 3300005441 Bacteria 1288
51 Ga0070694_100109660 3300005444 Bacteria 1965
52 Ga0070694_100476323 3300005444 Bacteria 990
53 Ga0070694_100500502 3300005444 Bacteria 967
54 Ga0070708_100029319 3300005445 Bacteria 4744
55 Ga0070708_100030313 3300005445 Bacteria 4675
56 Ga0070708_100458916 3300005445 Bacteria 1202
57 Ga0070678_100155180 3300005456 Bacteria 1848
58 Ga0070678_101938210 3300005456 Bacteria 557
59 Ga0070662_100262510 3300005457 Bacteria 1392
60 Ga0070681_11075180 3300005458 Unclassified 725
61 Ga0068867_100236391 3300005459 Bacteria 1479
62 Ga0070706_100005018 3300005467 Bacteria 12654
63 Ga0070706_100047843 3300005467 Bacteria 3947
64 Ga0070706_100553818 3300005467 Bacteria 1070
65 Ga0070707_100006720 3300005468 Bacteria 10659
66 Ga0070707_100011522 3300005468 Bacteria 8244
67 Ga0070707_100064043 3300005468 Bacteria 3529
68 Ga0070707_100328616 3300005468 Bacteria 1486
69 Ga0070698_100003028 3300005471 Bacteria 18521
70 Ga0070698_100011233 3300005471 Bacteria 9511
71 Ga0070698_100071030 3300005471 Bacteria 3492
72 Ga0070698_100303809 3300005471 Bacteria 1526
73 Ga0070698_101710385 3300005471 Bacteria 581
74 Ga0070699_100009488 3300005518 Bacteria 8427
75 Ga0070699_100470666 3300005518 Bacteria 1140
76 Ga0070699_100940783 3300005518 Bacteria 792
77 Ga0070699_101196585 3300005518 Bacteria 697
78 Ga0070679_100483867 3300005530 Bacteria 1182
79 Ga0070684_101453023 3300005535 Bacteria 646
80 Ga0070697_100018732 3300005536 Bacteria 5462
81 Ga0070697_100021089 3300005536 Bacteria 5160
82 Ga0070697_100093146 3300005536 Bacteria 2494
83 Ga0070697_100105447 3300005536 Bacteria 2345
84 Ga0070697_100930605 3300005536 Bacteria 772
85 Ga0070697_101465874 3300005536 Bacteria 610
86 Ga0068853_100635447 3300005539 Bacteria 1015
87 Ga0070686_100051300 3300005544 Bacteria 2625
88 Ga0070686_100138261 3300005544 Bacteria 1693
89 Ga0070686_100245029 3300005544 Bacteria 1307
90 Ga0070686_101178098 3300005544 Bacteria 636
91 Ga0070695_100043376 3300005545 Bacteria 2860
92 Ga0070695_100370184 3300005545 Bacteria 1079
93 Ga0070695_100476566 3300005545 Bacteria 961
94 Ga0070696_100005146 3300005546 Bacteria 8742
95 Ga0070696_100101674 3300005546 Bacteria 2060
96 Ga0070696_100335096 3300005546 Bacteria 1168
97 Ga0070696_101022048 3300005546 Bacteria 691
98 Ga0070693_100059608 3300005547 Bacteria 2213
99 Ga0070693_100873944 3300005547 Bacteria 672
100 Ga0070693_100881419 3300005547 Bacteria 669
101 Ga0070704_100054595 3300005549 Bacteria 2828
102 Ga0068855_100585401 3300005563 Bacteria 1205
103 Ga0070664_101121284 3300005564 Bacteria 741
104 Ga0068857_100085746 3300005577 Bacteria 2815
105 Ga0068857_100195777 3300005577 Bacteria 1841
106 Ga0068857_100405852 3300005577 Unclassified 1268
107 Ga0068854_100079223 3300005578 Bacteria 2422
108 Ga0068854_100211304 3300005578 Bacteria 1530
109 Ga0068854_100307982 3300005578 Bacteria 1284
110 Ga0070702_100038924 3300005615 Bacteria 2651
111 Ga0070702_100084196 3300005615 Bacteria 1912
112 Ga0068852_100258049 3300005616 Bacteria 1672
113 Ga0068859_100267721 3300005617 Bacteria 1801
114 Ga0068859_100485362 3300005617 Bacteria 1331
115 Ga0068864_100034436 3300005618 Bacteria 4308
116 Ga0068866_10053756 3300005718 Bacteria 2060
117 Ga0068866_10491641 3300005718 Bacteria 810
118 Ga0068861_100316862 3300005719 Bacteria 1357
119 Ga0068861_101580160 3300005719 Bacteria 646
120 Ga0068870_10118048 3300005840 Bacteria 1524
121 Ga0068870_10167404 3300005840 Bacteria 1309
122 Ga0068870_10172368 3300005840 Bacteria 1292
123 Ga0068858_100526779 3300005842 Bacteria 1143
124 Ga0068860_100083011 3300005843 Bacteria 3047
125 Ga0068862_100130184 3300005844 Bacteria 2225
126 Ga0068862_100141175 3300005844 Bacteria 2138
127 Ga0068862_100228015 3300005844 Bacteria 1689
128 Ga0081455_10357646 3300005937 Bacteria 1028
129 Ga0070712_100511237 3300006175 Bacteria 1008
130 Ga0097621_100225314 3300006237 Bacteria 1635
131 Ga0068871_100832165 3300006358 Unclassified 852
132 Ga0075428_100867293 3300006844 Bacteria 958
133 Ga0075431_100217820 3300006847 Bacteria 1948
134 Ga0075433_11336032 3300006852 Bacteria 621
135 Ga0075434_100223052 3300006871 Bacteria 1905
136 Ga0075434_100287007 3300006871 Bacteria 1665
137 Ga0075434_100412327 3300006871 Bacteria 1372
138 Ga0068865_100064837 3300006881 Bacteria 2572
139 Ga0068865_100118074 3300006881 Bacteria 1967
140 Ga0075436_100314098 3300006914 Bacteria 1125
141 Ga0075436_100756326 3300006914 Bacteria 722
142 Ga0097620_100267728 3300006931 Bacteria 1801
143 Ga0097620_100485312 3300006931 Bacteria 1331
144 Ga0075435_100049453 3300007076 Bacteria 3382
145 Ga0111539_10040579 3300009094 Bacteria 5601
146 Ga0111539_10176858 3300009094 Bacteria 2493
147 Ga0111539_10215328 3300009094 Bacteria 2238
148 Ga0111539_10666138 3300009094 Bacteria 1212
149 Ga0111539_10950171 3300009094 Bacteria 999
150 Ga0105245_10016155 3300009098 Bacteria 6505
151 Ga0105245_10063385 3300009098 Bacteria 3337
152 Ga0105245_10189985 3300009098 Bacteria 1967
153 Ga0114129_10260085 3300009147 Bacteria 2327
154 Ga0114129_10376129 3300009147 Bacteria 1877
155 Ga0114129_10488095 3300009147 Bacteria 1611
156 Ga0114129_11124739 3300009147 Bacteria 982
157 Ga0114129_11983200 3300009147 Bacteria 704
158 Ga0105243_10021952 3300009148 Bacteria 4848
159 Ga0105243_10052898 3300009148 Bacteria 3218
160 Ga0105243_10463787 3300009148 Bacteria 1192
161 Ga0105243_11115908 3300009148 Bacteria 798
162 Ga0105243_11211641 3300009148 Bacteria 768
163 Ga0105241_10747713 3300009174 Bacteria 896
164 Ga0105242_10031514 3300009176 Bacteria 4236
165 Ga0105242_10141908 3300009176 Bacteria 2085
166 Ga0105242_11042471 3300009176 Bacteria 828
167 Ga0105242_11680178 3300009176 Bacteria 671
168 Ga0105242_11727077 3300009176 Bacteria 663
169 Ga0105248_10242749 3300009177 Bacteria 2028
170 Ga0105248_11176222 3300009177 Bacteria 867
171 Ga0105238_10093432 3300009551 Bacteria 2996
172 Ga0105249_10175104 3300009553 Bacteria 2083
173 Ga0105249_10320768 3300009553 Bacteria 1560
174 Ga0105249_10701692 3300009553 Bacteria 1072
175 Ga0105249_10866895 3300009553 Bacteria 969
176 Ga0105249_11833816 3300009553 Bacteria 679
177 Ga0105239_10381642 3300010375 Bacteria 1593
178 Ga0105239_10445367 3300010375 Bacteria 1469
179 Ga0105239_11349683 3300010375 Bacteria 823
180 Ga0105246_10175913 3300011119 Bacteria 1643
181 Ga0105246_10211192 3300011119 Bacteria 1515
182 Ga0157371_10915854 3300013102 Bacteria 665
183 Ga0157374_11878538 3300013296 Bacteria 625
184 Ga0157378_10003032 3300013297 Bacteria 14929
185 Ga0157378_10024428 3300013297 Bacteria 5318
186 Ga0157378_10307421 3300013297 Bacteria 1536
187 Ga0157378_10434883 3300013297 Unclassified 1299
188 Ga0157372_10883564 3300013307 Bacteria 1037
189 Ga0157375_10151635 3300013308 Bacteria 2454
190 Ga0157375_10313520 3300013308 Bacteria 1733
191 Ga0157375_12144122 3300013308 Bacteria 665
192 Ga0163163_10105205 3300014325 Bacteria 2848
193 Ga0157380_10148624 3300014326 Bacteria 2022
194 Ga0157380_10248278 3300014326 Bacteria 1609
195 Ga0157380_12551356 3300014326 Bacteria 577
196 Ga0182008_10521155 3300014497 Bacteria 656
197 Ga0157377_10042535 3300014745 Bacteria 2523
198 Ga0157379_10057781 3300014968 Bacteria 3467
199 Ga0157379_10477344 3300014968 Bacteria 1154
200 Ga0157379_11070740 3300014968 Bacteria 771
201 Ga0157376_10177650 3300014969 Bacteria 1943
202 Ga0207642_10032317 3300025899 Bacteria 2202
203 Ga0207688_10115639 3300025901 Bacteria 1561
204 Ga0207688_10259718 3300025901 Bacteria 1054
205 Ga0207647_10389793 3300025904 Unclassified 786
206 Ga0207645_10045596 3300025907 Bacteria 2801
207 Ga0207645_10077240 3300025907 Bacteria 2133
208 Ga0207643_10067417 3300025908 Bacteria 2054
209 Ga0207643_10491262 3300025908 Bacteria 784
210 Ga0207684_10017135 3300025910 Bacteria 6218
211 Ga0207684_10058459 3300025910 Bacteria 3272
212 Ga0207660_10000002 3300025917 Bacteria 883566
213 Ga0207660_10377251 3300025917 Bacteria 1139
214 Ga0207660_10737097 3300025917 Bacteria 804
215 Ga0207660_11057548 3300025917 Bacteria 662
216 Ga0207662_10008434 3300025918 Bacteria 5640
217 Ga0207662_10025525 3300025918 Bacteria 3403
218 Ga0207662_10381392 3300025918 Bacteria 952
219 Ga0207657_10300253 3300025919 Bacteria 1272
220 Ga0207649_10374254 3300025920 Unclassified 1060
221 Ga0207646_10141769 3300025922 Bacteria 2165
222 Ga0207646_10231031 3300025922 Unclassified 1671
223 Ga0207646_10237906 3300025922 Bacteria 1645
224 Ga0207646_10388851 3300025922 Bacteria 1260
225 Ga0207681_10023657 3300025923 Bacteria 3933
226 Ga0207650_10115980 3300025925 Bacteria 2079
227 Ga0207650_10348816 3300025925 Bacteria 1217
228 Ga0207659_10131662 3300025926 Bacteria 1931
229 Ga0207687_10053169 3300025927 Bacteria 2828
230 Ga0207687_10072848 3300025927 Bacteria 2458
231 Ga0207687_11348594 3300025927 Bacteria 613
232 Ga0207664_11351570 3300025929 Unclassified 633
233 Ga0207690_10077228 3300025932 Bacteria 2314
234 Ga0207706_10049698 3300025933 Bacteria 3705
235 Ga0207706_10117031 3300025933 Bacteria 2344
236 Ga0207706_10207558 3300025933 Bacteria 1717
237 Ga0207686_10615321 3300025934 Bacteria 856
238 Ga0207709_10029558 3300025935 Bacteria 3180
239 Ga0207709_10300355 3300025935 Bacteria 1193
240 Ga0207709_10433971 3300025935 Bacteria 1012
241 Ga0207709_10670865 3300025935 Bacteria 827
242 Ga0207670_10323127 3300025936 Bacteria 1215
243 Ga0207669_10007889 3300025937 Bacteria 4962
244 Ga0207669_10012039 3300025937 Bacteria 4237
245 Ga0207669_11561848 3300025937 Bacteria 563
246 Ga0207704_10026976 3300025938 Bacteria 3159
247 Ga0207704_10068329 3300025938 Bacteria 2239
248 Ga0207691_10053258 3300025940 Bacteria 3695
249 Ga0207691_10373837 3300025940 Bacteria 1217
250 Ga0207711_10816570 3300025941 Bacteria 868
251 Ga0207711_11615396 3300025941 Unclassified 592
252 Ga0207689_10036967 3300025942 Bacteria 4053
253 Ga0207689_10063130 3300025942 Bacteria 3047
254 Ga0207689_10265201 3300025942 Bacteria 1421
255 Ga0207661_10312778 3300025944 Bacteria 1410
256 Ga0207679_11421655 3300025945 Bacteria 636
257 Ga0207667_10501174 3300025949 Bacteria 1232
258 Ga0207651_10295496 3300025960 Bacteria 1345
259 Ga0207651_10353110 3300025960 Bacteria 1239
260 Ga0207712_10083803 3300025961 Bacteria 2328
261 Ga0207668_10035673 3300025972 Bacteria 3314
262 Ga0207668_10165812 3300025972 Bacteria 1727
263 Ga0207640_10157200 3300025981 Bacteria 1677
264 Ga0207640_10216180 3300025981 Bacteria 1464
265 Ga0207640_10834628 3300025981 Bacteria 801
266 Ga0207640_11408445 3300025981 Bacteria 625
267 Ga0207677_10241468 3300026023 Bacteria 1462
268 Ga0207677_10382496 3300026023 Bacteria 1188
269 Ga0207703_10283885 3300026035 Bacteria 1504
270 Ga0207703_10375552 3300026035 Bacteria 1314
271 Ga0207639_10985834 3300026041 Bacteria 789
272 Ga0207678_11483552 3300026067 Bacteria 599
273 Ga0207708_10091470 3300026075 Bacteria 2346
274 Ga0207708_10128466 3300026075 Bacteria 1980
275 Ga0207708_10292774 3300026075 Bacteria 1322
276 Ga0207708_10452371 3300026075 Bacteria 1070
277 Ga0207708_10533597 3300026075 Bacteria 987
278 Ga0207648_10011867 3300026089 Bacteria 8188
279 Ga0207674_10024303 3300026116 Bacteria 6478
280 Ga0207674_10192470 3300026116 Bacteria 1989
281 Ga0207674_10212681 3300026116 Bacteria 1882
282 Ga0207675_100044545 3300026118 Bacteria 4147
283 Ga0207675_100071553 3300026118 Bacteria 3243
284 Ga0207683_11756630 3300026121 Bacteria 569
285 Ga0207698_10308948 3300026142 Bacteria 1475
286 Ga0209983_1021016 3300027665 Bacteria 1363
287 Ga0209998_10023192 3300027717 Bacteria 1341
288 Ga0209998_10033015 3300027717 Bacteria 1152
289 Ga0209974_10215002 3300027876 Bacteria 714
290 Ga0207428_10051142 3300027907 Bacteria 3303
291 Ga0207428_10119707 3300027907 Bacteria 2020
292 Ga0268266_10230517 3300028379 Bacteria 1706
293 Ga0268265_10771492 3300028380 Bacteria 935
294 Ga0268264_10472653 3300028381 Bacteria 1218
295 Ga0265326_10025190 3300028558 Bacteria 1696
296 Ga0265319_1002616 3300028563 Bacteria 9700
297 Ga0265334_10101765 3300028573 Bacteria 1039
298 Ga0265334_10162197 3300028573 Bacteria 785
299 Ga0265318_10015272 3300028577 Bacteria 3199
300 Ga0265318_10020174 3300028577 Bacteria 2692
301 Ga0265318_10038176 3300028577 Bacteria 1837
302 Ga0265318_10149004 3300028577 Bacteria 858
303 Ga0265322_10011152 3300028654 Bacteria 2607
304 Ga0265322_10025135 3300028654 Bacteria 1703
305 Ga0265336_10010948 3300028666 Bacteria 3092
306 Ga0265336_10117665 3300028666 Bacteria 791
307 Ga0265338_10075958 3300028800 Bacteria 2848
308 Ga0265338_10699813 3300028800 Bacteria 699
309 Ga0265338_10967764 3300028800 Bacteria 577
310 Ga0265324_10008203 3300029957 Bacteria 4168
311 Ga0265324_10014166 3300029957 Bacteria 2957
312 Ga0265330_10024642 3300031235 Bacteria 2729
313 Ga0265330_10068322 3300031235 Bacteria 1539
314 Ga0265328_10045638 3300031239 Bacteria 1611
315 Ga0265320_10001226 3300031240 Bacteria 18848
316 Ga0265320_10009070 3300031240 Bacteria 6032
317 Ga0265320_10039466 3300031240 Bacteria 2361
318 Ga0265325_10017224 3300031241 Bacteria 4018
319 Ga0265325_10021027 3300031241 Bacteria 3591
320 Ga0265325_10064891 3300031241 Bacteria 1845
321 Ga0265325_10337454 3300031241 Bacteria 667
322 Ga0265329_10004843 3300031242 Bacteria 5527
323 Ga0265329_10007411 3300031242 Bacteria 4248
324 Ga0265329_10022566 3300031242 Bacteria 2104
325 Ga0265329_10299750 3300031242 Bacteria 543
326 Ga0265340_10004346 3300031247 Bacteria 7939
327 Ga0265339_10010068 3300031249 Bacteria 5892
328 Ga0265339_10190920 3300031249 Bacteria 1015
329 Ga0265327_10130370 3300031251 Bacteria 1184
330 Ga0265316_10052534 3300031344 Bacteria 3196
331 Ga0265316_10055834 3300031344 Bacteria 3087
332 Ga0265316_10144264 3300031344 Bacteria 1786
333 Ga0307408_100185473 3300031548 Bacteria 1672
334 Ga0265313_10032782 3300031595 Bacteria 2647
335 Ga0265313_10035007 3300031595 Bacteria 2533
336 Ga0265314_10002544 3300031711 Bacteria 18542
337 Ga0265314_10198205 3300031711 Bacteria 1189
338 Ga0265342_10004323 3300031712 Bacteria 11242
339 Ga0316576_10078218 3300031727 Bacteria 2451
340 Ga0316576_10615296 3300031727 Bacteria 792
341 Ga0307405_11056533 3300031731 Bacteria 696
342 Ga0316577_10036067 3300031733 Bacteria 2764
343 Ga0307410_10578661 3300031852 Bacteria 934
344 Ga0307407_10255084 3300031903 Bacteria 1204
345 Ga0307407_10409024 3300031903 Unclassified 975
346 Ga0307409_100061092 3300031995 Bacteria 2943
347 Ga0307416_100116570 3300032002 Bacteria 2368
348 Ga0307416_100345429 3300032002 Bacteria 1503
349 Ga0307411_11519720 3300032005 Bacteria 616
350 Ga0307415_100004806 3300032126 Bacteria 7085
351 Ga0316583_10171845 3300032133 Bacteria 754
352 Ga0373932_0030008 3300035112 Bacteria 1505
353 Ga0373962_0086642 3300035242 Bacteria 959
354 Ga0316574_0124590 3300035398 Bacteria 1655
355 Ga0373931_0062743 3300035691 Bacteria 2007
356 Ga0373931_0420444 3300035691 Bacteria 850
357 Ga0373937_1417881 3300036401 Bacteria 642
358 Ga0316582_0044485 3300036647 Bacteria 2791
359 Ga0316582_0257041 3300036647 Bacteria 1197
360 Ga0395905_0581528 3300037471 Bacteria 1021
361 Ga0316581_0072732 3300037588 Bacteria 1056
362 Ga0395901_0293125 3300038443 Bacteria 1688
363 Ga0436365_0347259 3300039437 Bacteria 3323
364 Ga0439438_088329 3300041405 Bacteria 757
365 Ga0439466_0054668 3300041411 Bacteria 1300
366 Ga0439466_0116324 3300041411 Bacteria 827
367 Ga0451793_0196950 3300041452 Bacteria 584
368 Ga0451807_1643506 3300041486 Bacteria 790
369 Ga0451841_1279542 3300041498 Bacteria 707
370 Ga0451851_0789716 3300041507 Bacteria 848
371 Ga0451853_0662573 3300041512 Unclassified 953
372 Ga0439441_001582 3300042001 Bacteria 3025
373 Ga0450923_156723 3300042125 Bacteria 553
374 Ga0450923_173881 3300042125 Bacteria 528
375 Ga0450910_004004 3300042147 Bacteria 1979
376 Ga0450910_019691 3300042147 Bacteria 1015
377 Ga0450908_035093 3300042184 Bacteria 870
378 Ga0450909_034182 3300042185 Bacteria 775
379 Ga0451577_1172157 3300042876 Bacteria 686
380 Ga0453683_0192239 3300044673 Bacteria 1295
381 Ga0451576_1006894 3300045051 Bacteria 873
382 Ga0495641_0117312 3300046461 Bacteria 1187
383 Ga0495651_0023352 3300046462 Bacteria 4808
384 Ga0495651_0433057 3300046462 Bacteria 853
385 Ga0495618_0782455 3300046514 Bacteria 557
386 Ga0495630_0132659 3300046517 Bacteria 1892
387 Ga0495640_0373403 3300046533 Bacteria 878
388 Ga0495634_0192317 3300046642 Bacteria 1272
389 Ga0495657_0646914 3300046675 Bacteria 610
390 Ga0495599_0424970 3300046678 Bacteria 789
391 Ga0495624_0643505 3300046690 Bacteria 631
392 Ga0495600_0439443 3300046809 Bacteria 808
393 Ga0495604_0308816 3300047317 Bacteria 1060
394 Ga0495674_0891033 3300047319 Bacteria 687
395 Ga0495675_0404711 3300047444 Bacteria 795
396 Ga0495677_0336143 3300047445 Bacteria 595
397 Ga0495602_0100628 3300048088 Bacteria 2373
398 Ga0495602_0190879 3300048088 Bacteria 1571
399 Ga0496100_1062761 3300048903 Bacteria 637
400 Ga0496100_1623782 3300048903 Unclassified 511
401 Ga0496101_0006551 3300048904 Bacteria 7500
402 Ga0496101_0514735 3300048904 Bacteria 946
403 Ga0496102_0136558 3300048905 Bacteria 2298
404 Ga0496102_0182680 3300048905 Bacteria 1976
405 Ga0496102_0894371 3300048905 Bacteria 810
406 Ga0496102_1742865 3300048905 Bacteria 540
407 Ga0496103_0179915 3300048906 Bacteria 1359
408 Ga0496104_0182135 3300048907 Bacteria 2011
409 Ga0496104_0313586 3300048907 Bacteria 1481
410 Ga0496104_1009341 3300048907 Bacteria 736
411 Ga0496105_0025812 3300048908 Bacteria 4786
412 Ga0496105_0064463 3300048908 Bacteria 3023
413 Ga0496105_0348511 3300048908 Bacteria 1183
414 Ga0496105_0824766 3300048908 Bacteria 704
415 Ga0496106_1454746 3300048909 Bacteria 528
416 Ga0496107_0100929 3300048910 Bacteria 2116
417 Ga0496107_0428827 3300048910 Unclassified 983
418 Ga0496108_0025060 3300048911 Bacteria 4915
419 Ga0496108_0060962 3300048911 Bacteria 3174
420 Ga0496108_0144050 3300048911 Bacteria 2053
421 Ga0496108_0166394 3300048911 Bacteria 1907
422 Ga0496109_0009839 3300048912 Bacteria 8161
423 Ga0496109_0069119 3300048912 Bacteria 3238
424 Ga0496109_0156520 3300048912 Bacteria 2134
425 Ga0496109_0157410 3300048912 Bacteria 2128
426 Ga0496109_0629679 3300048912 Bacteria 1009
427 Ga0496110_0091358 3300048913 Bacteria 2723
428 Ga0496110_0134063 3300048913 Bacteria 2238
429 Ga0496110_0175716 3300048913 Bacteria 1944
430 Ga0496111_0271503 3300048914 Bacteria 1258
431 Ga0496112_0000098 3300048915 Bacteria 56421
432 Ga0496112_0112510 3300048915 Bacteria 2693
433 Ga0496112_0261497 3300048915 Bacteria 1680
434 Ga0496112_0519953 3300048915 Bacteria 1125
435 Ga0496112_0567524 3300048915 Bacteria 1068
436 Ga0496113_0016363 3300048916 Bacteria 5122
437 Ga0496113_0049277 3300048916 Unclassified 3136
438 Ga0496113_0141285 3300048916 Bacteria 1895
439 Ga0496113_0541861 3300048916 Bacteria 934
440 Ga0496114_0005648 3300048917 Bacteria 9808
441 Ga0496114_0649343 3300048917 Bacteria 928
442 Ga0496114_1078640 3300048917 Bacteria 688
443 Ga0496114_1359364 3300048917 Bacteria 597
444 Ga0501031_0012895 3300049568 Bacteria 5460
445 Ga0501031_0112241 3300049568 Bacteria 1780
446 Ga0501031_0123908 3300049568 Bacteria 1688
447 Ga0501031_0793235 3300049568 Bacteria 607
448 Ga0501032_0651644 3300049569 Bacteria 669
449 Ga0501033_0070780 3300049570 Bacteria 2562
450 Ga0501036_0049920 3300049572 Bacteria 3544
451 Ga0501036_0133330 3300049572 Bacteria 2096
452 Ga0501036_0388146 3300049572 Bacteria 1165
453 Ga0501036_0841775 3300049572 Bacteria 754
454 Ga0501036_1231487 3300049572 Bacteria 609
455 Ga0501037_0044880 3300049573 Bacteria 3245
456 Ga0501037_0323223 3300049573 Bacteria 1068
457 Ga0501037_1124276 3300049573 Bacteria 508
458 Ga0501038_0033237 3300049574 Bacteria 4544
459 Ga0501038_0132177 3300049574 Bacteria 2048
460 Ga0501038_0212084 3300049574 Bacteria 1549
461 Ga0501038_0464997 3300049574 Bacteria 971
462 Ga0501038_0881486 3300049574 Bacteria 661
463 Ga0501039_0048851 3300049575 Bacteria 3271
464 Ga0501039_0052113 3300049575 Bacteria 3166
465 Ga0501039_0253543 3300049575 Bacteria 1383
466 Ga0501039_0371126 3300049575 Bacteria 1124
467 Ga0501040_0003818 3300049576 Bacteria 9774
468 Ga0501040_0021971 3300049576 Bacteria 4266
469 Ga0501040_0032384 3300049576 Bacteria 3537
470 Ga0501040_0058738 3300049576 Bacteria 2642
471 Ga0501040_0120915 3300049576 Bacteria 1837
472 Ga0501040_0178934 3300049576 Bacteria 1503
473 Ga0501041_0014508 3300049577 Bacteria 4680
474 Ga0501041_0020238 3300049577 Bacteria 3976
475 Ga0501041_0039211 3300049577 Bacteria 2875
476 Ga0501041_0042474 3300049577 Bacteria 2763
477 Ga0501041_0075737 3300049577 Bacteria 2070
478 Ga0501041_0079735 3300049577 Bacteria 2015
479 Ga0501042_0093254 3300049578 Bacteria 2162
480 Ga0501042_0107737 3300049578 Bacteria 2006
481 Ga0501042_0164726 3300049578 Bacteria 1599
482 Ga0501042_0339815 3300049578 Bacteria 1085
483 Ga0501042_0662065 3300049578 Bacteria 759
484 Ga0501042_0690799 3300049578 Bacteria 742
485 Ga0501043_0023595 3300049579 Bacteria 4825
486 Ga0501043_0270823 3300049579 Bacteria 1304
487 Ga0501046_0068309 3300049580 Bacteria 2767
488 Ga0501046_0076648 3300049580 Bacteria 2590
489 Ga0501046_0330019 3300049580 Bacteria 1110
490 Ga0501047_1104934 3300049581 Bacteria 606
491 Ga0501048_0062362 3300049582 Bacteria 2638
492 Ga0501048_0116204 3300049582 Bacteria 1890
493 Ga0501048_0261926 3300049582 Bacteria 1228
494 Ga0501048_0285276 3300049582 Bacteria 1174
495 Ga0501048_0718455 3300049582 Bacteria 717
496 Ga0501067_0212450 3300049583 Bacteria 1077
497 Ga0501068_0550259 3300049584 Bacteria 750
498 Ga0501068_0557647 3300049584 Bacteria 745
499 Ga0501069_0016906 3300049585 Bacteria 3920
500 Ga0501069_0022459 3300049585 Bacteria 3432
501 Ga0501070_0120823 3300049586 Bacteria 2165
502 Ga0501070_0178885 3300049586 Bacteria 1746
503 Ga0501071_0012113 3300049587 Bacteria 5833
504 Ga0501071_0029835 3300049587 Bacteria 3852
505 Ga0501071_0088916 3300049587 Bacteria 2266
506 Ga0501071_0123344 3300049587 Bacteria 1921
507 Ga0501071_0236032 3300049587 Bacteria 1378
508 Ga0501071_0315794 3300049587 Bacteria 1186
509 Ga0501071_0372121 3300049587 Bacteria 1089
510 Ga0501072_0011361 3300049588 Bacteria 6805
511 Ga0501072_0049781 3300049588 Bacteria 3298
512 Ga0501072_0104541 3300049588 Bacteria 2251
513 Ga0501072_0334369 3300049588 Bacteria 1203
514 Ga0501072_0733308 3300049588 Bacteria 776
515 Ga0501073_0044364 3300049589 Bacteria 3134
516 Ga0501073_0701719 3300049589 Bacteria 698
517 Ga0501074_0034551 3300049590 Bacteria 3664
518 Ga0501074_0161060 3300049590 Bacteria 1603
519 Ga0501074_0298494 3300049590 Bacteria 1144
520 Ga0501075_0007785 3300049591 Bacteria 7438
521 Ga0501075_0009521 3300049591 Bacteria 6799
522 Ga0501075_0037370 3300049591 Bacteria 3627
523 Ga0501075_0047359 3300049591 Bacteria 3231
524 Ga0501075_0187626 3300049591 Bacteria 1577
525 Ga0501075_0417107 3300049591 Bacteria 1024
526 Ga0501075_0649592 3300049591 Bacteria 804
527 Ga0501075_0955425 3300049591 Unclassified 651
528 Ga0501075_1239405 3300049591 Bacteria 566
529 Ga0501076_0071511 3300049592 Bacteria 2775
530 Ga0501076_0153849 3300049592 Bacteria 1871
531 Ga0501076_0185167 3300049592 Bacteria 1698
532 Ga0501076_0214259 3300049592 Bacteria 1574
533 Ga0501076_0288909 3300049592 Bacteria 1343
534 Ga0501076_1048380 3300049592 Bacteria 672
535 Ga0501077_0012888 3300049593 Bacteria 5237
536 Ga0501077_0025972 3300049593 Bacteria 3715
537 Ga0501077_0032309 3300049593 Bacteria 3332
538 Ga0501077_0034977 3300049593 Bacteria 3198
539 Ga0501079_0032539 3300049741 Bacteria 4010
540 Ga0501079_0037474 3300049741 Bacteria 3737
541 Ga0501079_0054487 3300049741 Bacteria 3084
542 Ga0501079_0103590 3300049741 Bacteria 2207
543 Ga0501079_0103887 3300049741 Bacteria 2204
544 Ga0501079_0131802 3300049741 Bacteria 1945
545 Ga0501080_0029655 3300049742 Bacteria 5092
546 Ga0501080_0034338 3300049742 Bacteria 4734
547 Ga0501080_0101670 3300049742 Bacteria 2667
548 Ga0501080_1013706 3300049742 Bacteria 720
549 Ga0501081_0024997 3300049743 Bacteria 4015
550 Ga0501081_0084743 3300049743 Bacteria 2223
551 Ga0501081_0096676 3300049743 Bacteria 2083
552 Ga0501081_0242711 3300049743 Bacteria 1314
553 Ga0501081_0625964 3300049743 Bacteria 806
554 Ga0501083_0112226 3300049744 Bacteria 1791
555 Ga0501035_0089541 3300049822 Bacteria 2710
556 Ga0501035_0217364 3300049822 Bacteria 1633
557 Ga0501044_0318432 3300049823 Bacteria 1480
558 Ga0501045_0005760 3300049824 Bacteria 8573
559 Ga0501045_0014739 3300049824 Bacteria 5542
560 Ga0501045_0051355 3300049824 Bacteria 3009
561 Ga0501045_0064976 3300049824 Bacteria 2679
562 Ga0501045_0118173 3300049824 Bacteria 1967
563 Ga0501045_0143371 3300049824 Bacteria 1777
564 Ga0501045_0206460 3300049824 Bacteria 1464
565 nmdc:mga0yw44_207652_c1 3300050492 Bacteria 1295
566 nmdc:mga05p37_291185_c1 3300050507 Bacteria 1943
567 nmdc:mga05p37_342691_c1 3300050507 Bacteria 1762
568 nmdc:mga05p37_824661_c1 3300050507 Bacteria 1011
569 nmdc:mga06r32_119337_c1 3300050510 Bacteria 2600
570 nmdc:mga08y16_1148637_c1 3300050511 Bacteria 749
571 nmdc:mga08y16_181149_c1 3300050511 Bacteria 2188
572 nmdc:mga08y16_94926_c1 3300050511 Bacteria 3107
573 nmdc:mga0n895_189236_c1 3300050512 Bacteria 2089
574 nmdc:mga0n895_317692_c1 3300050512 Bacteria 1578
575 nmdc:mga0rr50_110431_c1 3300050513 Bacteria 2175
576 nmdc:mga0rr50_59636_c1 3300050513 Bacteria 2866
577 nmdc:mga08x19_1021961_c1 3300050514 Bacteria 587
578 nmdc:mga08x19_328459_c1 3300050514 Bacteria 1065
579 nmdc:mga0a205_1182214_c1 3300050515 Bacteria 612
580 nmdc:mga0a205_156715_c1 3300050515 Bacteria 2175
581 nmdc:mga0a205_63714_c1 3300050515 Bacteria 3561
582 Ga0495601_0355096 3300053077 Bacteria 953
583 Ga0495612_0351531 3300053078 Bacteria 666
584 Ga0495595_0403847 3300053084 Bacteria 692
585 Ga0501084_0016480 3300054114 Bacteria 6136
586 Ga0501084_0079234 3300054114 Bacteria 2753
587 Ga0501084_0119763 3300054114 Bacteria 2213
588 Ga0501084_0128484 3300054114 Bacteria 2133
589 Ga0501084_0373527 3300054114 Bacteria 1205
590 Ga0501084_0695825 3300054114 Bacteria 857
591 Ga0501084_1079535 3300054114 Bacteria 674
592 Ga0501082_0046235 3300060353 Bacteria 3752
593 Ga0501082_0048928 3300060353 Bacteria 3645
594 Ga0501082_0053683 3300060353 Bacteria 3473
595 Ga0501082_0179399 3300060353 Bacteria 1842
596 Ga0501082_0224053 3300060353 Bacteria 1636
597 Ga0501082_0301863 3300060353 Bacteria 1394
598 Ga0501082_1612989 3300060353 Bacteria 566
599 Ga0530510_0002811 3300061734 Bacteria 11973
600 Ga0530510_0010156 3300061734 Bacteria 6599
601 Ga0530510_0026774 3300061734 Bacteria 4130
602 Ga0530510_0060038 3300061734 Bacteria 2751
603 Ga0530510_0177881 3300061734 Bacteria 1577
604 Ga0530510_0217593 3300061734 Bacteria 1419
605 Ga0530510_0399575 3300061734 Unclassified 1036
606 Ga0530510_0411435 3300061734 Bacteria 1020
607 Ga0070708_101879294
608 Ga0070690_100068392
609 Ga0070670_100749214
610 Ga0070670_101426507
611 Ga0068869_100123624
612 Ga0068869_100136839
613 Ga0070666_10193615
614 Ga0070680_100000064
615 Ga0070680_100109073
616 Ga0070682_100072469
617 Ga0070682_100320174
618 Ga0070682_100887105
619 Ga0068868_100093433
620 Ga0068868_100220440
621 Ga0068868_100230998
622 Ga0068868_101130455
623 Ga0070660_100213094
624 Ga0070689_100037490
625 Ga0070689_101152026
626 Ga0070691_10120011
627 Ga0070691_10123398
628 Ga0070687_100188326
629 Ga0070661_100197565
630 Ga0070692_10012592
631 Ga0070692_10270976
632 Ga0070668_100102089
633 Ga0070668_100224078
634 Ga0070668_100826879
635 Ga0070668_101212462
636 Ga0070669_100016773
637 Ga0070669_100319632
638 Ga0070675_100013259
639 Ga0070675_100855712
640 Ga0070671_100582137
641 Ga0070674_100038948
642 Ga0070674_100462924
643 Ga0070673_100231631
644 Ga0070659_100843351
645 Ga0070714_101172012
646 Ga0070701_10023624
647 Ga0070701_10436690
648 Ga0070705_100034043
649 Ga0070705_100076960
650 Ga0070705_100178886
651 Ga0070705_100246413
652 Ga0070705_100495666
653 Ga0070700_100061043
654 Ga0070700_100146502
655 Ga0070700_100212175
656 Ga0070700_100242695
657 Ga0070694_100109660
658 Ga0070694_100476323
659 Ga0070694_100500502
660 Ga0070708_100029319
661 Ga0070708_100030313
662 Ga0070708_100458916
663 Ga0070678_100155180
664 Ga0070678_101938210
665 Ga0070662_100262510
666 Ga0070681_11075180
667 Ga0068867_100236391
668 Ga0070706_100005018
669 Ga0070706_100047843
670 Ga0070706_100553818
671 Ga0070707_100006720
672 Ga0070707_100011522
673 Ga0070707_100064043
674 Ga0070707_100328616
675 Ga0070698_100003028
676 Ga0070698_100011233
677 Ga0070698_100071030
678 Ga0070698_100303809
679 Ga0070698_101710385
680 Ga0070699_100009488
681 Ga0070699_100470666
682 Ga0070699_100940783
683 Ga0070699_101196585
684 Ga0070679_100483867
685 Ga0070684_101453023
686 Ga0070697_100018732
687 Ga0070697_100021089
688 Ga0070697_100093146
689 Ga0070697_100105447
690 Ga0070697_100930605
691 Ga0070697_101465874
692 Ga0068853_100635447
693 Ga0070686_100051300
694 Ga0070686_100138261
695 Ga0070686_100245029
696 Ga0070686_101178098
697 Ga0070695_100043376
698 Ga0070695_100370184
699 Ga0070695_100476566
700 Ga0070696_100005146
701 Ga0070696_100101674
702 Ga0070696_100335096
703 Ga0070696_101022048
704 Ga0070693_100059608
705 Ga0070693_100873944
706 Ga0070693_100881419
707 Ga0070704_100054595
708 Ga0068855_100585401
709 Ga0070664_101121284
710 Ga0068857_100085746
711 Ga0068857_100195777
712 Ga0068857_100405852
713 Ga0068854_100079223
714 Ga0068854_100211304
715 Ga0068854_100307982
716 Ga0070702_100038924
717 Ga0070702_100084196
718 Ga0068852_100258049
719 Ga0068859_100267721
720 Ga0068859_100485362
721 Ga0068864_100034436
722 Ga0068866_10053756
723 Ga0068866_10491641
724 Ga0068861_100316862
725 Ga0068861_101580160
726 Ga0068870_10118048
727 Ga0068870_10167404
728 Ga0068870_10172368
729 Ga0068858_100526779
730 Ga0068860_100083011
731 Ga0068862_100130184
732 Ga0068862_100141175
733 Ga0068862_100228015
734 Ga0081455_10357646
735 Ga0070712_100511237
736 Ga0097621_100225314
737 Ga0068871_100832165
738 Ga0075428_100867293
739 Ga0075431_100217820
740 Ga0075433_11336032
741 Ga0075434_100223052
742 Ga0075434_100287007
743 Ga0075434_100412327
744 Ga0068865_100064837
745 Ga0068865_100118074
746 Ga0075436_100314098
747 Ga0075436_100756326
748 Ga0097620_100267728
749 Ga0097620_100485312
750 Ga0075435_100049453
751 Ga0111539_10040579
752 Ga0111539_10176858
753 Ga0111539_10215328
754 Ga0111539_10666138
755 Ga0111539_10950171
756 Ga0105245_10016155
757 Ga0105245_10063385
758 Ga0105245_10189985
759 Ga0114129_10260085
760 Ga0114129_10376129
761 Ga0114129_10488095
762 Ga0114129_11124739
763 Ga0114129_11983200
764 Ga0105243_10021952
765 Ga0105243_10052898
766 Ga0105243_10463787
767 Ga0105243_11115908
768 Ga0105243_11211641
769 Ga0105241_10747713
770 Ga0105242_10031514
771 Ga0105242_10141908
772 Ga0105242_11042471
773 Ga0105242_11680178
774 Ga0105242_11727077
775 Ga0105248_10242749
776 Ga0105248_11176222
777 Ga0105238_10093432
778 Ga0105249_10175104
779 Ga0105249_10320768
780 Ga0105249_10701692
781 Ga0105249_10866895
782 Ga0105249_11833816
783 Ga0105239_10381642
784 Ga0105239_10445367
785 Ga0105239_11349683
786 Ga0105246_10175913
787 Ga0105246_10211192
788 Ga0157371_10915854
789 Ga0157374_11878538
790 Ga0157378_10003032
791 Ga0157378_10024428
792 Ga0157378_10307421
793 Ga0157378_10434883
794 Ga0157372_10883564
795 Ga0157375_10151635
796 Ga0157375_10313520
797 Ga0157375_12144122
798 Ga0163163_10105205
799 Ga0157380_10148624
800 Ga0157380_10248278
801 Ga0157380_12551356
802 Ga0182008_10521155
803 Ga0157377_10042535
804 Ga0157379_10057781
805 Ga0157379_10477344
806 Ga0157379_11070740
807 Ga0157376_10177650
808 Ga0207642_10032317
809 Ga0207688_10115639
810 Ga0207688_10259718
811 Ga0207647_10389793
812 Ga0207645_10045596
813 Ga0207645_10077240
814 Ga0207643_10067417
815 Ga0207643_10491262
816 Ga0207684_10017135
817 Ga0207684_10058459
818 Ga0207660_10000002
819 Ga0207660_10377251
820 Ga0207660_10737097
821 Ga0207660_11057548
822 Ga0207662_10008434
823 Ga0207662_10025525
824 Ga0207662_10381392
825 Ga0207657_10300253
826 Ga0207649_10374254
827 Ga0207646_10141769
828 Ga0207646_10231031
829 Ga0207646_10237906
830 Ga0207646_10388851
831 Ga0207681_10023657
832 Ga0207650_10115980
833 Ga0207650_10348816
834 Ga0207659_10131662
835 Ga0207687_10053169
836 Ga0207687_10072848
837 Ga0207687_11348594
838 Ga0207664_11351570
839 Ga0207690_10077228
840 Ga0207706_10049698
841 Ga0207706_10117031
842 Ga0207706_10207558
843 Ga0207686_10615321
844 Ga0207709_10029558
845 Ga0207709_10300355
846 Ga0207709_10433971
847 Ga0207709_10670865
848 Ga0207670_10323127
849 Ga0207669_10007889
850 Ga0207669_10012039
851 Ga0207669_11561848
852 Ga0207704_10026976
853 Ga0207704_10068329
854 Ga0207691_10053258
855 Ga0207691_10373837
856 Ga0207711_10816570
857 Ga0207711_11615396
858 Ga0207689_10036967
859 Ga0207689_10063130
860 Ga0207689_10265201
861 Ga0207661_10312778
862 Ga0207679_11421655
863 Ga0207667_10501174
864 Ga0207651_10295496
865 Ga0207651_10353110
866 Ga0207712_10083803
867 Ga0207668_10035673
868 Ga0207668_10165812
869 Ga0207640_10157200
870 Ga0207640_10216180
871 Ga0207640_10834628
872 Ga0207640_11408445
873 Ga0207677_10241468
874 Ga0207677_10382496
875 Ga0207703_10283885
876 Ga0207703_10375552
877 Ga0207639_10985834
878 Ga0207678_11483552
879 Ga0207708_10091470
880 Ga0207708_10128466
881 Ga0207708_10292774
882 Ga0207708_10452371
883 Ga0207708_10533597
884 Ga0207648_10011867
885 Ga0207674_10024303
886 Ga0207674_10192470
887 Ga0207674_10212681
888 Ga0207675_100044545
889 Ga0207675_100071553
890 Ga0207683_11756630
891 Ga0207698_10308948
892 Ga0209983_1021016
893 Ga0209998_10023192
894 Ga0209998_10033015
895 Ga0209974_10215002
896 Ga0207428_10051142
897 Ga0207428_10119707
898 Ga0268266_10230517
899 Ga0268265_10771492
900 Ga0268264_10472653
901 Ga0265326_10025190
902 Ga0265319_1002616
903 Ga0265334_10101765
904 Ga0265334_10162197
905 Ga0265318_10015272
906 Ga0265318_10020174
907 Ga0265318_10038176
908 Ga0265318_10149004
909 Ga0265322_10011152
910 Ga0265322_10025135
911 Ga0265336_10010948
912 Ga0265336_10117665
913 Ga0265338_10075958
914 Ga0265338_10699813
915 Ga0265338_10967764
916 Ga0265324_10008203
917 Ga0265324_10014166
918 Ga0265330_10024642
919 Ga0265330_10068322
920 Ga0265328_10045638
921 Ga0265320_10001226
922 Ga0265320_10009070
923 Ga0265320_10039466
924 Ga0265325_10017224
925 Ga0265325_10021027
926 Ga0265325_10064891
927 Ga0265325_10337454
928 Ga0265329_10004843
929 Ga0265329_10007411
930 Ga0265329_10022566
931 Ga0265329_10299750
932 Ga0265340_10004346
933 Ga0265339_10010068
934 Ga0265339_10190920
935 Ga0265327_10130370
936 Ga0265316_10052534
937 Ga0265316_10055834
938 Ga0265316_10144264
939 Ga0307408_100185473
940 Ga0265313_10032782
941 Ga0265313_10035007
942 Ga0265314_10002544
943 Ga0265314_10198205
944 Ga0265342_10004323
945 Ga0316576_10078218
946 Ga0316576_10615296
947 Ga0307405_11056533
948 Ga0316577_10036067
949 Ga0307410_10578661
950 Ga0307407_10255084
951 Ga0307407_10409024
952 Ga0307409_100061092
953 Ga0307416_100116570
954 Ga0307416_100345429
955 Ga0307411_11519720
956 Ga0307415_100004806
957 Ga0316583_10171845
958 Ga0373932_0030008
959 Ga0373962_0086642
960 Ga0316574_0124590
961 Ga0373931_0062743
962 Ga0373931_0420444
963 Ga0373937_1417881
964 Ga0316582_0044485
965 Ga0316582_0257041
966 Ga0395905_0581528
967 Ga0316581_0072732
968 Ga0395901_0293125
969 Ga0436365_0347259
970 Ga0439438_088329
971 Ga0439466_0054668
972 Ga0439466_0116324
973 Ga0451793_0196950
974 Ga0451807_1643506
975 Ga0451841_1279542
976 Ga0451851_0789716
977 Ga0451853_0662573
978 Ga0439441_001582
979 Ga0450923_156723
980 Ga0450923_173881
981 Ga0450910_004004
982 Ga0450910_019691
983 Ga0450908_035093
984 Ga0450909_034182
985 Ga0451577_1172157
986 Ga0453683_0192239
987 Ga0451576_1006894
988 Ga0495641_0117312
989 Ga0495651_0023352
990 Ga0495651_0433057
991 Ga0495618_0782455
992 Ga0495630_0132659
993 Ga0495640_0373403
994 Ga0495634_0192317
995 Ga0495657_0646914
996 Ga0495599_0424970
997 Ga0495624_0643505
998 Ga0495600_0439443
999 Ga0495604_0308816
1000 Ga0495674_0891033
1001 Ga0495675_0404711
1002 Ga0495677_0336143
1003 Ga0495602_0100628
1004 Ga0495602_0190879
1005 Ga0496100_1062761
1006 Ga0496100_1623782
1007 Ga0496101_0006551
1008 Ga0496101_0514735
1009 Ga0496102_0136558
1010 Ga0496102_0182680
1011 Ga0496102_0894371
1012 Ga0496102_1742865
1013 Ga0496103_0179915
1014 Ga0496104_0182135
1015 Ga0496104_0313586
1016 Ga0496104_1009341
1017 Ga0496105_0025812
1018 Ga0496105_0064463
1019 Ga0496105_0348511
1020 Ga0496105_0824766
1021 Ga0496106_1454746
1022 Ga0496107_0100929
1023 Ga0496107_0428827
1024 Ga0496108_0025060
1025 Ga0496108_0060962
1026 Ga0496108_0144050
1027 Ga0496108_0166394
1028 Ga0496109_0009839
1029 Ga0496109_0069119
1030 Ga0496109_0156520
1031 Ga0496109_0157410
1032 Ga0496109_0629679
1033 Ga0496110_0091358
1034 Ga0496110_0134063
1035 Ga0496110_0175716
1036 Ga0496111_0271503
1037 Ga0496112_0000098
1038 Ga0496112_0112510
1039 Ga0496112_0261497
1040 Ga0496112_0519953
1041 Ga0496112_0567524
1042 Ga0496113_0016363
1043 Ga0496113_0049277
1044 Ga0496113_0141285
1045 Ga0496113_0541861
1046 Ga0496114_0005648
1047 Ga0496114_0649343
1048 Ga0496114_1078640
1049 Ga0496114_1359364
1050 Ga0501031_0012895
1051 Ga0501031_0112241
1052 Ga0501031_0123908
1053 Ga0501031_0793235
1054 Ga0501032_0651644
1055 Ga0501033_0070780
1056 Ga0501036_0049920
1057 Ga0501036_0133330
1058 Ga0501036_0388146
1059 Ga0501036_0841775
1060 Ga0501036_1231487
1061 Ga0501037_0044880
1062 Ga0501037_0323223
1063 Ga0501037_1124276
1064 Ga0501038_0033237
1065 Ga0501038_0132177
1066 Ga0501038_0212084
1067 Ga0501038_0464997
1068 Ga0501038_0881486
1069 Ga0501039_0048851
1070 Ga0501039_0052113
1071 Ga0501039_0253543
1072 Ga0501039_0371126
1073 Ga0501040_0003818
1074 Ga0501040_0021971
1075 Ga0501040_0032384
1076 Ga0501040_0058738
1077 Ga0501040_0120915
1078 Ga0501040_0178934
1079 Ga0501041_0014508
1080 Ga0501041_0020238
1081 Ga0501041_0039211
1082 Ga0501041_0042474
1083 Ga0501041_0075737
1084 Ga0501041_0079735
1085 Ga0501042_0093254
1086 Ga0501042_0107737
1087 Ga0501042_0164726
1088 Ga0501042_0339815
1089 Ga0501042_0662065
1090 Ga0501042_0690799
1091 Ga0501043_0023595
1092 Ga0501043_0270823
1093 Ga0501046_0068309
1094 Ga0501046_0076648
1095 Ga0501046_0330019
1096 Ga0501047_1104934
1097 Ga0501048_0062362
1098 Ga0501048_0116204
1099 Ga0501048_0261926
1100 Ga0501048_0285276
1101 Ga0501048_0718455
1102 Ga0501067_0212450
1103 Ga0501068_0550259
1104 Ga0501068_0557647
1105 Ga0501069_0016906
1106 Ga0501069_0022459
1107 Ga0501070_0120823
1108 Ga0501070_0178885
1109 Ga0501071_0012113
1110 Ga0501071_0029835
1111 Ga0501071_0088916
1112 Ga0501071_0123344
1113 Ga0501071_0236032
1114 Ga0501071_0315794
1115 Ga0501071_0372121
1116 Ga0501072_0011361
1117 Ga0501072_0049781
1118 Ga0501072_0104541
1119 Ga0501072_0334369
1120 Ga0501072_0733308
1121 Ga0501073_0044364
1122 Ga0501073_0701719
1123 Ga0501074_0034551
1124 Ga0501074_0161060
1125 Ga0501074_0298494
1126 Ga0501075_0007785
1127 Ga0501075_0009521
1128 Ga0501075_0037370
1129 Ga0501075_0047359
1130 Ga0501075_0187626
1131 Ga0501075_0417107
1132 Ga0501075_0649592
1133 Ga0501075_0955425
1134 Ga0501075_1239405
1135 Ga0501076_0071511
1136 Ga0501076_0153849
1137 Ga0501076_0185167
1138 Ga0501076_0214259
1139 Ga0501076_0288909
1140 Ga0501076_1048380
1141 Ga0501077_0012888
1142 Ga0501077_0025972
1143 Ga0501077_0032309
1144 Ga0501077_0034977
1145 Ga0501079_0032539
1146 Ga0501079_0037474
1147 Ga0501079_0054487
1148 Ga0501079_0103590
1149 Ga0501079_0103887
1150 Ga0501079_0131802
1151 Ga0501080_0029655
1152 Ga0501080_0034338
1153 Ga0501080_0101670
1154 Ga0501080_1013706
1155 Ga0501081_0024997
1156 Ga0501081_0084743
1157 Ga0501081_0096676
1158 Ga0501081_0242711
1159 Ga0501081_0625964
1160 Ga0501083_0112226
1161 Ga0501035_0089541
1162 Ga0501035_0217364
1163 Ga0501044_0318432
1164 Ga0501045_0005760
1165 Ga0501045_0014739
1166 Ga0501045_0051355
1167 Ga0501045_0064976
1168 Ga0501045_0118173
1169 Ga0501045_0143371
1170 Ga0501045_0206460
1171 nmdc:mga0yw44_207652_c1
1172 nmdc:mga05p37_291185_c1
1173 nmdc:mga05p37_342691_c1
1174 nmdc:mga05p37_824661_c1
1175 nmdc:mga06r32_119337_c1
1176 nmdc:mga08y16_1148637_c1
1177 nmdc:mga08y16_181149_c1
1178 nmdc:mga08y16_94926_c1
1179 nmdc:mga0n895_189236_c1
1180 nmdc:mga0n895_317692_c1
1181 nmdc:mga0rr50_110431_c1
1182 nmdc:mga0rr50_59636_c1
1183 nmdc:mga08x19_1021961_c1
1184 nmdc:mga08x19_328459_c1
1185 nmdc:mga0a205_1182214_c1
1186 nmdc:mga0a205_156715_c1
1187 nmdc:mga0a205_63714_c1
1188 Ga0495601_0355096
1189 Ga0495612_0351531
1190 Ga0495595_0403847
1191 Ga0501084_0016480
1192 Ga0501084_0079234
1193 Ga0501084_0119763
1194 Ga0501084_0128484
1195 Ga0501084_0373527
1196 Ga0501084_0695825
1197 Ga0501084_1079535
1198 Ga0501082_0046235
1199 Ga0501082_0048928
1200 Ga0501082_0053683
1201 Ga0501082_0179399
1202 Ga0501082_0224053
1203 Ga0501082_0301863
1204 Ga0501082_1612989
1205 Ga0530510_0002811
1206 Ga0530510_0010156
1207 Ga0530510_0026774
1208 Ga0530510_0060038
1209 Ga0530510_0177881
1210 Ga0530510_0217593
1211 Ga0530510_0399575
1212 Ga0530510_0411435

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01220

DHquinase_II

Dehydroquinase class II

4

140

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6hs9-assembly1.cif.gz_A the crystal structure of type ii dehydroquinase from butyrivibrio crossotus dsm 2876 0.9759 2 137
8idu-assembly1.cif.gz_A crystal structure of substrate bound-form dehydroquinate dehydratase from corynebacterium glutamicum 0.9752 1 142
3n8k-assembly2.cif.gz_M type ii dehydroquinase from mycobacterium tuberculosis complexed with citrazinic acid 0.9646 3 140
3kip-assembly3.cif.gz_I crystal structure of type-ii 3-dehydroquinase from c. albicans 0.963 1 135
2uyg-assembly1.cif.gz_F crystallogaphic structure of the typeii 3-dehydroquinase from thermus thermophilus 0.9625 4 139
ID Description Score Start End Superfamily
1gqoA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dehydroquinase, class II 0.9557 3 139 3.40.50.9100
4kiuM00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dehydroquinase, class II 0.9363 3 139 3.40.50.9100
3kipN00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dehydroquinase, class II 0.9242 1 139 3.40.50.9100
1gqoA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dehydroquinase, class II 0.9231 3 139 3.40.50.9100
1d0iH00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dehydroquinase, class II 0.9227 2 150 3.40.50.9100
ID Description Score Start End GO Terms
AF-A0A6A0QX71-F1-model_v4 3-dehydroquinate dehydratase (3-dehydroquinase) (EC 4.2.1.10) (Type II DHQase) 0.9858 2 141 GO:0003855
GO:0008652
GO:0009073
GO:0009423
GO:0019631
AF-A0A0H3GWB7-F1-model_v4 3-dehydroquinate dehydratase (3-dehydroquinase) (EC 4.2.1.10) (Type II DHQase) 0.9856 1 144 GO:0003855
GO:0008652
GO:0009073
GO:0009423
GO:0019631
AF-B8E0Z3-F1-model_v4 3-dehydroquinate dehydratase (3-dehydroquinase) (EC 4.2.1.10) (Type II DHQase) 0.9852 1 143 GO:0003855
GO:0008652
GO:0009073
GO:0009423
GO:0019631
AF-A0A0E4GBK7-F1-model_v4 3-dehydroquinate dehydratase (3-dehydroquinase) (EC 4.2.1.10) (Type II DHQase) 0.9851 1 143 GO:0003855
GO:0008652
GO:0009073
GO:0009423
GO:0019631
AF-A0A1E3B026-F1-model_v4 Catabolic 3-dehydroquinase (cDHQase) (EC 4.2.1.10) (3-dehydroquinate dehydratase) 0.9843 2 139 GO:0003855
GO:0004764
GO:0019631
GO:0046279

Map