F468591

General Info

Members Datasets Scaffolds Average Seq Length
606 364 1212 127

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10009564|Ga0157370_100095643
Length 151
Sequence MCCPAALGGRNLGPLPRPSHPWSATMPLARIDLRKGKSVEYRQRVGEAIYQAMRAVGVPENDRFQIFQEHDAGTLVYDPGYLGITRTDDFICIQITWNEGRTLEQKKALYAGIADGLHAAVGIRREDVFINLVEVKRENWSFGNGQAQYVS

Samples

Sample ID Description Type Environment
1 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
7 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
13 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
14 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
15 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
16 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
17 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
18 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
19 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
20 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
21 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
22 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
23 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
24 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
25 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
26 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
27 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
28 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
29 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
30 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
31 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
32 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
33 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
36 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
37 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
38 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
39 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
40 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
43 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
44 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
50 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
51 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
52 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
74 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
75 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
76 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
77 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
78 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
79 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
80 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
81 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
86 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
87 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
88 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
93 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
94 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
95 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
96 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
97 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
99 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
104 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
105 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
106 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
109 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
110 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
115 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
116 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
117 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
118 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
119 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
120 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
121 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
122 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
123 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
124 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
125 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
126 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
129 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
130 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
132 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
133 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
135 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
136 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
139 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
142 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
143 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
145 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
190 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
191 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
192 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
193 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
194 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
195 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
196 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
197 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
198 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
199 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
200 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
201 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
202 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
203 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
204 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
205 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
206 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
207 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
208 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
209 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
210 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
211 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
212 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
213 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
214 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
215 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
216 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
217 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
218 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
219 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
220 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
221 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
222 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
223 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
224 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
225 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
226 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
227 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
228 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
229 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
230 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
231 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
232 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
233 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
234 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
235 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
236 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
237 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
238 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
239 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
240 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
241 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
242 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
243 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
244 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
245 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
246 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
247 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
248 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
249 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
250 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
251 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
252 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
253 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
254 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
255 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
256 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
257 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
258 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
259 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
260 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
261 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
262 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
263 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
264 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
265 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
266 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
267 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
268 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
269 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
270 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
271 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
272 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
273 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
274 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
275 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
276 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
277 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
278 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
279 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
280 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
281 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
282 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
283 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
284 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
285 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
286 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
287 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
288 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
289 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
290 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
291 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
292 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
293 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
294 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
295 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
296 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
297 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
298 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
299 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
300 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
301 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
302 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
303 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
304 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
305 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
306 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
307 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
308 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
309 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
310 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
311 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
312 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
313 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
314 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
315 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
316 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
317 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
318 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
319 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
320 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
321 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
322 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
323 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
324 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
325 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
326 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
327 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
328 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
329 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
330 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
331 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
332 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
333 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
334 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
335 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
336 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
337 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
338 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
339 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
340 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
341 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
342 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
343 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
344 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
345 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
346 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
347 2831864461 Roseateles noduli HZ7 Isolate Nodule
348 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
349 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
350 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
351 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
352 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
353 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
354 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
355 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
356 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
357 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
358 2941471342 Luteibacter sp. 621 Isolate Unclassified
359 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
360 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
361 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
362 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
363 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
364 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root

Type Distribution

Type Percentage (%)
Metagenomes 96.04
Metatranscriptomes 0
Isolates 3.96

Biome Distribution

Category Percentage (%)
Aerial Root 0.17
Bulb 0
Endosphere 11.06
Nodule 0.33
Rhizoplane 1.82
Rhizosphere 72.94
Stem 0
Stem Tuber 0
Unclassified 1.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157370_10009564 3300013104 Bacteria 10330
2 SwRhRL2b_contig_1309206 2162886007 Bacteria 3329
3 JGI24735J21928_10000803 3300002067 Bacteria 11182
4 JGI25162J39368_1000521 3300002737 Bacteria 28709
5 JGI25157J39369_1006196 3300002741 Bacteria 1852
6 JGI25163J39215_1001632 3300002771 Bacteria 3338
7 JGI25164J39214_1000288 3300002772 Bacteria 35469
8 JGI25165J46597_1000532 3300003214 Bacteria 35455
9 rootH1_10053922 3300003316 Bacteria 5010
10 rootH2_10014721 3300003320 Bacteria 28161
11 rootH1_10024560 3300003323 Bacteria 3805
12 JGI25404J52841_10010472 3300003659 Bacteria 1994
13 Ga0055538_1009509 3300003751 Bacteria 786
14 Ga0055535_1000429 3300003761 Bacteria 39272
15 Ga0055542_1000648 3300003762 Bacteria 28709
16 Ga0055529_1000467 3300003763 Bacteria 39162
17 Ga0055529_1005372 3300003763 Bacteria 1861
18 Ga0055526_1001268 3300003771 Bacteria 18113
19 Ga0055526_1058039 3300003771 Bacteria 839
20 Ga0055537_1000489 3300003773 Bacteria 24277
21 Ga0055524_1004767 3300003775 Bacteria 6191
22 Ga0055536_1004397 3300003781 Bacteria 7226
23 Ga0055534_1000069 3300003784 Bacteria 80193
24 Ga0055528_1000650 3300003790 Bacteria 25293
25 Ga0055531_10013756 3300003794 Bacteria 3707
26 Ga0058692_1000022 3300003856 Bacteria 237321
27 Ga0065714_10079630 3300005288 Bacteria 2499
28 Ga0065704_10006474 3300005289 Bacteria 4682
29 Ga0065704_10533879 3300005289 Bacteria 636
30 Ga0065707_10338039 3300005295 Bacteria 938
31 Ga0070658_10000355 3300005327 Bacteria 39796
32 Ga0070683_100488266 3300005329 Bacteria 1176
33 Ga0070670_100098726 3300005331 Bacteria 2513
34 Ga0070670_100110425 3300005331 Bacteria 2369
35 Ga0070666_10000013 3300005335 Bacteria 230442
36 Ga0070666_10217618 3300005335 Bacteria 1346
37 Ga0070680_101775138 3300005336 Bacteria 535
38 Ga0070687_100369573 3300005343 Bacteria 931
39 Ga0070687_100490988 3300005343 Bacteria 825
40 Ga0070661_100002265 3300005344 Bacteria 13193
41 Ga0070661_100011543 3300005344 Bacteria 6154
42 Ga0070661_100696143 3300005344 Bacteria 828
43 Ga0070692_10327363 3300005345 Bacteria 944
44 Ga0070668_100156758 3300005347 Bacteria 1845
45 Ga0070668_100752573 3300005347 Bacteria 863
46 Ga0070669_100013051 3300005353 Bacteria 5901
47 Ga0070669_100032604 3300005353 Bacteria 3763
48 Ga0070675_100535706 3300005354 Bacteria 1058
49 Ga0070671_100744331 3300005355 Unclassified 852
50 Ga0070671_100887498 3300005355 Bacteria 779
51 Ga0070674_100054050 3300005356 Bacteria 2776
52 Ga0070674_100180488 3300005356 Bacteria 1616
53 Ga0070667_100170798 3300005367 Bacteria 1919
54 Ga0070667_100353370 3300005367 Bacteria 1331
55 Ga0070667_100788628 3300005367 Bacteria 882
56 Ga0070667_101544860 3300005367 Bacteria 624
57 Ga0070713_101072721 3300005436 Unclassified 778
58 Ga0070713_101681300 3300005436 Bacteria 616
59 Ga0070700_100009720 3300005441 Bacteria 5286
60 Ga0070708_100108142 3300005445 Bacteria 2553
61 Ga0070708_100377119 3300005445 Bacteria 1337
62 Ga0070708_100386119 3300005445 Bacteria 1320
63 Ga0070663_100063077 3300005455 Bacteria 2674
64 Ga0070678_100030615 3300005456 Bacteria 3702
65 Ga0070678_100263647 3300005456 Bacteria 1450
66 Ga0070678_100614793 3300005456 Bacteria 971
67 Ga0068867_100008982 3300005459 Bacteria 7051
68 Ga0070685_10010846 3300005466 Bacteria 4749
69 Ga0070685_10434326 3300005466 Bacteria 916
70 Ga0070706_100716210 3300005467 Bacteria 928
71 Ga0070707_100154071 3300005468 Bacteria 2238
72 Ga0070698_100119646 3300005471 Bacteria 2594
73 Ga0070698_100258304 3300005471 Bacteria 1674
74 Ga0070699_100030342 3300005518 Bacteria 4666
75 Ga0070684_100232575 3300005535 Bacteria 1683
76 Ga0070684_100352471 3300005535 Bacteria 1354
77 Ga0070697_100524126 3300005536 Bacteria 1037
78 Ga0068853_100039870 3300005539 Bacteria 4006
79 Ga0070672_100092949 3300005543 Bacteria 2436
80 Ga0070695_100707506 3300005545 Bacteria 800
81 Ga0070665_100086606 3300005548 Bacteria 3138
82 Ga0070665_100087649 3300005548 Bacteria 3118
83 Ga0070665_100792682 3300005548 Bacteria 960
84 Ga0070704_101899106 3300005549 Bacteria 552
85 Ga0068855_100103719 3300005563 Bacteria 3271
86 Ga0070664_100000365 3300005564 Bacteria 33436
87 Ga0070664_100128568 3300005564 Bacteria 2224
88 Ga0068857_100007248 3300005577 Bacteria 9547
89 Ga0068857_100079514 3300005577 Bacteria 2927
90 Ga0068857_100339822 3300005577 Bacteria 1389
91 Ga0068856_100219463 3300005614 Bacteria 1917
92 Ga0068852_101284399 3300005616 Bacteria 753
93 Ga0068859_100011593 3300005617 Bacteria 8864
94 Ga0068859_101274721 3300005617 Bacteria 810
95 Ga0068864_100158132 3300005618 Bacteria 2058
96 Ga0068866_10233021 3300005718 Bacteria 1117
97 Ga0068861_100066625 3300005719 Bacteria 2776
98 Ga0068863_101278552 3300005841 Bacteria 740
99 Ga0068858_100007849 3300005842 Bacteria 10292
100 Ga0068858_100329068 3300005842 Bacteria 1461
101 Ga0068858_100575860 3300005842 Bacteria 1091
102 Ga0068858_100958062 3300005842 Bacteria 838
103 Ga0068860_100000498 3300005843 Bacteria 48732
104 Ga0068860_101082145 3300005843 Bacteria 821
105 Ga0068860_102228899 3300005843 Bacteria 569
106 Ga0068862_100002138 3300005844 Bacteria 17796
107 Ga0068862_100026277 3300005844 Bacteria 4893
108 Ga0068862_100156806 3300005844 Bacteria 2030
109 Ga0068862_100367615 3300005844 Bacteria 1338
110 Ga0068862_101169170 3300005844 Bacteria 767
111 Ga0081540_1000030 3300005983 Bacteria 148780
112 Ga0081539_10039453 3300005985 Bacteria 2785
113 Ga0075368_10111110 3300006042 Bacteria 1130
114 Ga0075364_10387299 3300006051 Bacteria 954
115 Ga0070715_10357773 3300006163 Bacteria 799
116 Ga0070712_100603475 3300006175 Bacteria 929
117 Ga0075362_10190811 3300006177 Bacteria 995
118 Ga0075367_10077193 3300006178 Bacteria 2011
119 Ga0075366_10113895 3300006195 Bacteria 1628
120 Ga0097621_100078222 3300006237 Bacteria 2748
121 Ga0097621_100685411 3300006237 Bacteria 942
122 Ga0097621_101872422 3300006237 Bacteria 572
123 Ga0075370_10025336 3300006353 Bacteria 3280
124 Ga0068871_100843920 3300006358 Bacteria 846
125 Ga0075428_101592755 3300006844 Bacteria 683
126 Ga0075430_100981211 3300006846 Bacteria 696
127 Ga0075431_100542592 3300006847 Bacteria 1151
128 Ga0075431_101114298 3300006847 Bacteria 754
129 Ga0075431_101602455 3300006847 Bacteria 609
130 Ga0075433_11742663 3300006852 Bacteria 536
131 Ga0068865_100036476 3300006881 Bacteria 3315
132 Ga0075436_100590686 3300006914 Bacteria 817
133 Ga0097620_100011593 3300006931 Bacteria 8864
134 Ga0097620_101274531 3300006931 Bacteria 810
135 Ga0099794_10007793 3300007265 Bacteria 4421
136 Ga0099794_10256977 3300007265 Bacteria 901
137 Ga0099795_10048804 3300007788 Bacteria 1534
138 Ga0099795_10050451 3300007788 Bacteria 1514
139 Ga0099795_10108887 3300007788 Bacteria 1096
140 Ga0105244_10101096 3300009036 Bacteria 1410
141 Ga0105250_10106744 3300009092 Bacteria 1145
142 Ga0105240_10020844 3300009093 Bacteria 8731
143 Ga0105240_11561425 3300009093 Bacteria 691
144 Ga0111539_10328035 3300009094 Bacteria 1781
145 Ga0105247_10007619 3300009101 Bacteria 6628
146 Ga0105247_10223638 3300009101 Bacteria 1275
147 Ga0114129_10235699 3300009147 Bacteria 2462
148 Ga0114129_10314795 3300009147 Bacteria 2082
149 Ga0114129_12859162 3300009147 Bacteria 572
150 Ga0105243_10694504 3300009148 Bacteria 991
151 Ga0105242_10091965 3300009176 Bacteria 2555
152 Ga0105242_11730260 3300009176 Bacteria 662
153 Ga0105248_10284033 3300009177 Bacteria 1863
154 Ga0105248_10842862 3300009177 Bacteria 1035
155 Ga0105237_11712779 3300009545 Bacteria 636
156 Ga0105237_12455482 3300009545 Bacteria 531
157 Ga0105238_10000098 3300009551 Bacteria 98005
158 Ga0105238_10060126 3300009551 Bacteria 3805
159 Ga0105238_10124718 3300009551 Bacteria 2555
160 Ga0105238_12157729 3300009551 Bacteria 592
161 Ga0105238_12187834 3300009551 Unclassified 588
162 Ga0105238_12222671 3300009551 Unclassified 583
163 Ga0105249_10006601 3300009553 Bacteria 10095
164 Ga0105249_10219262 3300009553 Bacteria 1871
165 Ga0105249_10565287 3300009553 Bacteria 1189
166 Ga0105249_10706001 3300009553 Bacteria 1069
167 Ga0105249_12201466 3300009553 Bacteria 624
168 Ga0099796_10005646 3300010159 Bacteria 3134
169 Ga0099796_10027255 3300010159 Bacteria 1823
170 Ga0099796_10170732 3300010159 Bacteria 868
171 Ga0099796_10416002 3300010159 Bacteria 592
172 Ga0105239_11108286 3300010375 Bacteria 911
173 Ga0105246_10137693 3300011119 Bacteria 1832
174 Ga0105246_10632918 3300011119 Bacteria 929
175 Ga0157373_10104398 3300013100 Bacteria 1993
176 Ga0157373_10290807 3300013100 Bacteria 1159
177 Ga0157373_10462942 3300013100 Bacteria 913
178 Ga0157371_10010819 3300013102 Bacteria 7081
179 Ga0157371_10442905 3300013102 Bacteria 954
180 Ga0157371_10864161 3300013102 Bacteria 684
181 Ga0157370_10012991 3300013104 Bacteria 8605
182 Ga0157370_10070662 3300013104 Bacteria 3295
183 Ga0157370_10113437 3300013104 Bacteria 2533
184 Ga0157370_11129302 3300013104 Bacteria 708
185 Ga0157369_10000529 3300013105 Bacteria 50408
186 Ga0157369_10014229 3300013105 Bacteria 8989
187 Ga0157369_10141557 3300013105 Bacteria 2545
188 Ga0157369_10334811 3300013105 Bacteria 1572
189 Ga0157378_10014824 3300013297 Bacteria 6822
190 Ga0157378_11976649 3300013297 Bacteria 633
191 Ga0163162_10017833 3300013306 Bacteria 6945
192 Ga0163162_10054707 3300013306 Bacteria 4015
193 Ga0163162_10066676 3300013306 Bacteria 3648
194 Ga0163162_12417824 3300013306 Bacteria 604
195 Ga0157372_10842273 3300013307 Bacteria 1065
196 Ga0157375_10009593 3300013308 Bacteria 8502
197 Ga0163163_10064415 3300014325 Bacteria 3637
198 Ga0163163_10728456 3300014325 Bacteria 1055
199 Ga0157380_10054623 3300014326 Bacteria 3170
200 Ga0182008_10007949 3300014497 Bacteria 5818
201 Ga0182008_10024015 3300014497 Bacteria 3106
202 Ga0157379_10070638 3300014968 Bacteria 3124
203 Ga0157379_10192859 3300014968 Bacteria 1841
204 Ga0157379_10399481 3300014968 Bacteria 1263
205 Ga0157379_10968722 3300014968 Bacteria 810
206 Ga0157379_11086430 3300014968 Bacteria 766
207 Ga0157376_10240073 3300014969 Bacteria 1688
208 Ga0182006_1004753 3300015261 Bacteria 6632
209 Ga0182006_1047666 3300015261 Bacteria 1659
210 Ga0182006_1082600 3300015261 Bacteria 1170
211 Ga0182006_1082954 3300015261 Bacteria 1167
212 Ga0182005_1013283 3300015265 Bacteria 2316
213 Ga0163161_10019177 3300017792 Bacteria 4796
214 Ga0163161_10150414 3300017792 Bacteria 1769
215 Ga0163161_10226654 3300017792 Bacteria 1449
216 Ga0163161_10235068 3300017792 Bacteria 1423
217 Ga0163161_10809654 3300017792 Bacteria 788
218 Ga0213872_10001721 3300021361 Bacteria 13758
219 Ga0213872_10300277 3300021361 Bacteria 667
220 Ga0209760_101733 3300025207 Bacteria 2199
221 Ga0209784_100216 3300025224 Bacteria 39416
222 Ga0209672_107210 3300025228 Bacteria 1731
223 Ga0207427_100267 3300025231 Bacteria 39803
224 Ga0209437_100037 3300025233 Bacteria 459730
225 Ga0209258_100034 3300025242 Bacteria 437372
226 Ga0209646_1000436 3300025246 Bacteria 22879
227 Ga0209026_1000255 3300025250 Bacteria 66879
228 Ga0209148_1000001 3300025254 Bacteria 2545271
229 Ga0209759_1020921 3300025256 Bacteria 1505
230 Ga0209233_1000002 3300025261 Bacteria 2501366
231 Ga0209565_1000033 3300025263 Bacteria 313960
232 Ga0209455_1000054 3300025272 Bacteria 358936
233 Ga0209673_1000062 3300025273 Bacteria 260727
234 Ga0209675_1000869 3300025291 Bacteria 19459
235 Ga0209676_1000037 3300025292 Bacteria 457562
236 Ga0209025_1022787 3300025294 Bacteria 3304
237 Ga0209564_1000367 3300025295 Bacteria 83971
238 Ga0209564_1023983 3300025295 Bacteria 2098
239 Ga0209050_1003874 3300025298 Bacteria 10627
240 Ga0209050_1028304 3300025298 Bacteria 1822
241 Ga0209050_1048287 3300025298 Bacteria 1101
242 Ga0209256_1007003 3300025299 Bacteria 5729
243 Ga0209256_1018000 3300025299 Bacteria 2318
244 Ga0209257_1007853 3300025304 Bacteria 6295
245 Ga0209257_1024194 3300025304 Bacteria 2110
246 Ga0209257_1024942 3300025304 Bacteria 2056
247 Ga0207642_10021216 3300025899 Bacteria 2553
248 Ga0207642_10071858 3300025899 Bacteria 1649
249 Ga0207710_10009951 3300025900 Bacteria 3998
250 Ga0207710_10010020 3300025900 Bacteria 3986
251 Ga0207710_10147837 3300025900 Bacteria 1138
252 Ga0207688_10323193 3300025901 Bacteria 947
253 Ga0207680_10000001 3300025903 Bacteria 1091453
254 Ga0207680_10073898 3300025903 Bacteria 2121
255 Ga0207647_10000008 3300025904 Bacteria 192602
256 Ga0207647_10187688 3300025904 Bacteria 1198
257 Ga0207705_10001178 3300025909 Bacteria 21244
258 Ga0207684_10442473 3300025910 Bacteria 1116
259 Ga0207654_10702281 3300025911 Bacteria 727
260 Ga0207695_10126167 3300025913 Bacteria 2521
261 Ga0207671_10182038 3300025914 Bacteria 1636
262 Ga0207693_10850375 3300025915 Bacteria 702
263 Ga0207657_10616067 3300025919 Bacteria 846
264 Ga0207649_10001906 3300025920 Bacteria 11906
265 Ga0207649_10088438 3300025920 Bacteria 2023
266 Ga0207649_10722301 3300025920 Bacteria 774
267 Ga0207646_10015591 3300025922 Bacteria 7174
268 Ga0207646_10020287 3300025922 Bacteria 6161
269 Ga0207646_11345845 3300025922 Bacteria 622
270 Ga0207646_11693473 3300025922 Bacteria 543
271 Ga0207681_10093642 3300025923 Bacteria 2151
272 Ga0207694_10000180 3300025924 Bacteria 65444
273 Ga0207694_10047552 3300025924 Bacteria 3318
274 Ga0207694_11435330 3300025924 Unclassified 583
275 Ga0207700_10404360 3300025928 Bacteria 1197
276 Ga0207644_10049504 3300025931 Bacteria 3009
277 Ga0207709_10002458 3300025935 Bacteria 11631
278 Ga0207669_10231816 3300025937 Bacteria 1363
279 Ga0207669_10802191 3300025937 Bacteria 781
280 Ga0207704_10224823 3300025938 Bacteria 1392
281 Ga0207691_10008769 3300025940 Bacteria 9702
282 Ga0207711_10649563 3300025941 Bacteria 984
283 Ga0207689_11018861 3300025942 Unclassified 698
284 Ga0207661_10700729 3300025944 Bacteria 931
285 Ga0207679_10000365 3300025945 Bacteria 32727
286 Ga0207712_10118990 3300025961 Bacteria 1995
287 Ga0207712_10359067 3300025961 Bacteria 1213
288 Ga0207668_10085932 3300025972 Bacteria 2297
289 Ga0207668_10282054 3300025972 Bacteria 1363
290 Ga0207658_10412723 3300025986 Bacteria 1189
291 Ga0207658_10584524 3300025986 Bacteria 1002
292 Ga0207658_11041215 3300025986 Bacteria 747
293 Ga0207658_11183875 3300025986 Bacteria 698
294 Ga0207658_11628570 3300025986 Bacteria 590
295 Ga0207703_10000449 3300026035 Bacteria 43340
296 Ga0207678_10041673 3300026067 Bacteria 3981
297 Ga0207708_10040080 3300026075 Bacteria 3570
298 Ga0207641_10000337 3300026088 Bacteria 57031
299 Ga0207648_10005014 3300026089 Bacteria 13447
300 Ga0207648_10607317 3300026089 Bacteria 1009
301 Ga0207674_10014081 3300026116 Bacteria 8836
302 Ga0207674_10119709 3300026116 Bacteria 2602
303 Ga0207674_10168055 3300026116 Bacteria 2147
304 Ga0207675_100004084 3300026118 Bacteria 14126
305 Ga0207675_102196965 3300026118 Bacteria 567
306 Ga0207683_10451369 3300026121 Bacteria 1185
307 Ga0207683_10632716 3300026121 Bacteria 991
308 Ga0207698_10348554 3300026142 Bacteria 1398
309 Ga0209371_1000004 3300027312 Bacteria 1098197
310 Ga0209588_1006399 3300027671 Bacteria 3421
311 Ga0209588_1063368 3300027671 Bacteria 1195
312 Ga0209588_1281338 3300027671 Bacteria 503
313 Ga0268266_10000059 3300028379 Bacteria 269485
314 Ga0268265_10008026 3300028380 Bacteria 7129
315 Ga0268265_10031652 3300028380 Bacteria 3822
316 Ga0268265_10123579 3300028380 Bacteria 2137
317 Ga0268265_10471576 3300028380 Bacteria 1177
318 Ga0268264_10000989 3300028381 Bacteria 29019
319 Ga0268264_10017316 3300028381 Bacteria 5904
320 Ga0268264_10274680 3300028381 Bacteria 1576
321 Ga0268256_1000005 3300030500 Bacteria 1082342
322 Ga0316179_1115110 3300030734 Bacteria 547
323 Ga0316183_1021823 3300030742 Bacteria 12937
324 Ga0265328_10047870 3300031239 Bacteria 1571
325 Ga0265331_10010282 3300031250 Bacteria 5186
326 Ga0265327_10010277 3300031251 Bacteria 6599
327 Ga0307509_10234623 3300031507 Bacteria 1634
328 Ga0307410_10643416 3300031852 Bacteria 889
329 Ga0307406_10653869 3300031901 Bacteria 873
330 Ga0307412_10000238 3300031911 Bacteria 35923
331 Ga0307409_102603056 3300031995 Bacteria 534
332 Ga0307414_10048862 3300032004 Bacteria 2921
333 Ga0307414_10885622 3300032004 Bacteria 818
334 Ga0307510_10000001 3300033180 Bacteria 1172244
335 Ga0307510_10000070 3300033180 Bacteria 77054
336 Ga0307510_10045758 3300033180 Bacteria 4717
337 Ga0307510_10066350 3300033180 Bacteria 3645
338 Ga0373926_0254526 3300035083 Bacteria 681
339 Ga0373926_0300138 3300035083 Bacteria 627
340 Ga0373934_0068558 3300035086 Bacteria 1417
341 Ga0373936_0032173 3300035113 Bacteria 2074
342 Ga0373945_0005237 3300035116 Bacteria 4146
343 Ga0373954_0069901 3300035118 Bacteria 1667
344 Ga0373954_0639784 3300035118 Bacteria 527
345 Ga0373956_0123620 3300035119 Bacteria 1209
346 Ga0373957_0232532 3300035120 Bacteria 773
347 Ga0373955_0018962 3300035172 Bacteria 3431
348 Ga0373924_0100799 3300035410 Bacteria 1242
349 Ga0373931_0511727 3300035691 Unclassified 776
350 Ga0373935_0000495 3300035692 Bacteria 20438
351 Ga0373927_0000308 3300035695 Bacteria 38418
352 Ga0373927_0479498 3300035695 Bacteria 822
353 Ga0373947_0005725 3300035725 Bacteria 7249
354 Ga0373947_0157242 3300035725 Bacteria 1468
355 Ga0373937_0012823 3300036401 Bacteria 7382
356 Ga0373925_0026337 3300037068 Bacteria 4255
357 Ga0373925_0287630 3300037068 Bacteria 1325
358 Ga0436360_0705644 3300039438 Bacteria 845
359 Ga0436360_1090132 3300039438 Bacteria 2547
360 Ga0436361_0001950 3300039447 Bacteria 15059
361 Ga0436361_0488811 3300039447 Bacteria 1341
362 Ga0436361_0575458 3300039447 Bacteria 3162
363 Ga0436363_0674425 3300039450 Bacteria 1465
364 Ga0439432_002147 3300042006 Bacteria 7438
365 Ga0439432_017631 3300042006 Bacteria 2394
366 Ga0439456_038341 3300042013 Bacteria 1036
367 Ga0439463_000279 3300042016 Bacteria 14150
368 Ga0439463_003685 3300042016 Bacteria 3861
369 Ga0439463_005718 3300042016 Bacteria 3089
370 Ga0450911_001038 3300042115 Bacteria 7087
371 Ga0451577_0058340 3300042876 Bacteria 3441
372 Ga0453684_0282414 3300044712 Bacteria 1893
373 Ga0466968_0077810 3300044735 Bacteria 1453
374 Ga0451576_0414318 3300045051 Bacteria 1413
375 Ga0495627_099473 3300046453 Bacteria 831
376 Ga0495592_0230696 3300046454 Bacteria 1233
377 Ga0495603_0004869 3300046455 Bacteria 8028
378 Ga0495603_0030265 3300046455 Bacteria 3261
379 Ga0495603_0048417 3300046455 Bacteria 2531
380 Ga0495591_000130 3300046458 Bacteria 82467
381 Ga0495591_034250 3300046458 Bacteria 1497
382 Ga0495629_0000170 3300046459 Bacteria 57733
383 Ga0495629_0062163 3300046459 Bacteria 2609
384 Ga0495638_0000223 3300046460 Bacteria 78235
385 Ga0495638_0001630 3300046460 Bacteria 19966
386 Ga0495641_0002571 3300046461 Bacteria 14249
387 Ga0495653_0465233 3300046463 Bacteria 793
388 Ga0495650_0000332 3300046471 Bacteria 84720
389 Ga0495650_0002051 3300046471 Bacteria 17548
390 Ga0495580_0016736 3300046472 Bacteria 5503
391 Ga0495580_0117148 3300046472 Bacteria 1850
392 Ga0495582_0000053 3300046473 Bacteria 58155
393 Ga0495605_0000310 3300046474 Bacteria 51402
394 Ga0495639_0017358 3300046475 Bacteria 3125
395 Ga0495662_0035290 3300046476 Bacteria 2413
396 Ga0495584_0000019 3300046491 Bacteria 140608
397 Ga0495584_0000301 3300046491 Bacteria 34886
398 Ga0495585_0003752 3300046492 Bacteria 10140
399 Ga0495585_0017400 3300046492 Bacteria 4152
400 Ga0495594_0000267 3300046499 Bacteria 25600
401 Ga0495607_0000713 3300046501 Bacteria 32111
402 Ga0495583_0000131 3300046506 Bacteria 125393
403 Ga0495583_0004927 3300046506 Bacteria 9281
404 Ga0495583_0005937 3300046506 Bacteria 8110
405 Ga0495606_0000630 3300046507 Bacteria 55478
406 Ga0495606_0023674 3300046507 Bacteria 4444
407 Ga0495606_0024568 3300046507 Bacteria 4338
408 Ga0495606_0051898 3300046507 Bacteria 2672
409 Ga0495606_0667325 3300046507 Bacteria 501
410 Ga0495610_0016898 3300046512 Bacteria 4180
411 Ga0495610_0038745 3300046512 Bacteria 2417
412 Ga0495610_0144798 3300046512 Bacteria 1019
413 Ga0495616_0000129 3300046513 Bacteria 66170
414 Ga0495618_0044831 3300046514 Bacteria 2789
415 Ga0495620_0000369 3300046515 Bacteria 30874
416 Ga0495620_0031203 3300046515 Bacteria 2444
417 Ga0495628_0082136 3300046516 Bacteria 2503
418 Ga0495630_0036321 3300046517 Bacteria 3684
419 Ga0495631_0000210 3300046518 Bacteria 40095
420 Ga0495631_0033178 3300046518 Bacteria 2320
421 Ga0495632_0088157 3300046519 Bacteria 1474
422 Ga0495632_0093130 3300046519 Bacteria 1426
423 Ga0495632_0136148 3300046519 Bacteria 1141
424 Ga0495632_0451257 3300046519 Bacteria 558
425 Ga0495643_0000986 3300046522 Bacteria 29160
426 Ga0495648_0004349 3300046524 Bacteria 12128
427 Ga0495648_0035889 3300046524 Bacteria 3208
428 Ga0495648_0095954 3300046524 Bacteria 1649
429 Ga0495663_0000441 3300046525 Bacteria 15206
430 Ga0495666_0026158 3300046526 Bacteria 2879
431 Ga0495652_0057077 3300046529 Bacteria 3313
432 Ga0495654_0000059 3300046530 Bacteria 137056
433 Ga0495654_0007317 3300046530 Bacteria 6184
434 Ga0495665_0000132 3300046531 Bacteria 35776
435 Ga0495640_0163037 3300046533 Bacteria 1427
436 Ga0495609_0084135 3300046538 Bacteria 1388
437 Ga0495622_0001155 3300046557 Bacteria 13734
438 Ga0495622_0001348 3300046557 Bacteria 12543
439 Ga0495622_0222522 3300046557 Bacteria 836
440 Ga0495633_0017813 3300046558 Bacteria 3619
441 Ga0495668_0044727 3300046616 Bacteria 2461
442 Ga0495634_0002240 3300046642 Bacteria 16205
443 Ga0495634_0237755 3300046642 Bacteria 1118
444 Ga0495611_0000308 3300046648 Bacteria 33055
445 Ga0495625_0006064 3300046660 Bacteria 10849
446 Ga0495625_0008519 3300046660 Bacteria 8739
447 Ga0495625_0138616 3300046660 Bacteria 1642
448 Ga0495625_0446824 3300046660 Bacteria 799
449 Ga0495625_0510703 3300046660 Bacteria 733
450 Ga0495635_0000488 3300046663 Bacteria 25029
451 Ga0495661_0000892 3300046665 Bacteria 27549
452 Ga0495588_0034113 3300046674 Bacteria 2574
453 Ga0495657_0587797 3300046675 Bacteria 645
454 Ga0495599_0218091 3300046678 Bacteria 1168
455 Ga0495646_0036373 3300046680 Bacteria 3050
456 Ga0495647_0003052 3300046681 Bacteria 5338
457 Ga0495658_0007931 3300046683 Bacteria 5257
458 Ga0495669_0015524 3300046684 Bacteria 3262
459 Ga0495613_0006627 3300046689 Bacteria 8651
460 Ga0495613_0368773 3300046689 Bacteria 983
461 Ga0495624_0013743 3300046690 Bacteria 5514
462 Ga0495624_0272311 3300046690 Bacteria 1023
463 Ga0495670_0003595 3300046691 Bacteria 7611
464 Ga0495649_0183407 3300046694 Bacteria 1091
465 Ga0495660_0401955 3300046810 Bacteria 600
466 Ga0495581_0001133 3300047315 Bacteria 14586
467 Ga0495674_0001834 3300047319 Bacteria 20944
468 Ga0495674_0131087 3300047319 Bacteria 2112
469 Ga0495672_0000214 3300047320 Bacteria 82882
470 Ga0495676_0008173 3300047321 Bacteria 9598
471 Ga0495680_0085425 3300047322 Bacteria 2376
472 Ga0495687_182920 3300047443 Bacteria 682
473 Ga0495679_000233 3300047446 Bacteria 46629
474 Ga0495673_0000077 3300047469 Bacteria 204403
475 Ga0495673_0000495 3300047469 Bacteria 42046
476 Ga0495673_0003991 3300047469 Bacteria 9423
477 Ga0495673_0007581 3300047469 Bacteria 6213
478 Ga0495673_0041452 3300047469 Bacteria 2073
479 Ga0495684_0020744 3300047471 Bacteria 5063
480 Ga0495686_0001359 3300047472 Bacteria 27282
481 Ga0495686_0011339 3300047472 Bacteria 6283
482 Ga0495686_0028326 3300047472 Bacteria 3648
483 Ga0495686_0052993 3300047472 Bacteria 2543
484 Ga0495593_0000177 3300047673 Bacteria 32957
485 Ga0496101_0555650 3300048904 Bacteria 908
486 Ga0496102_0051714 3300048905 Bacteria 3743
487 Ga0496102_0243571 3300048905 Bacteria 1695
488 Ga0496102_0418188 3300048905 Bacteria 1259
489 Ga0496104_0130152 3300048907 Bacteria 2417
490 Ga0496105_0049705 3300048908 Bacteria 3462
491 Ga0496110_0213559 3300048913 Bacteria 1754
492 Ga0496111_0529180 3300048914 Bacteria 866
493 Ga0496113_0385799 3300048916 Bacteria 1124
494 Ga0496115_0000413 3300048918 Bacteria 34949
495 Ga0496116_0011208 3300048919 Bacteria 7445
496 Ga0496116_0027232 3300048919 Bacteria 4164
497 Ga0496116_0042789 3300048919 Bacteria 3092
498 Ga0496116_0043312 3300048919 Bacteria 3068
499 Ga0496116_0070894 3300048919 Bacteria 2209
500 Ga0496117_0000386 3300048920 Bacteria 75799
501 Ga0496117_0002648 3300048920 Bacteria 22192
502 Ga0496117_0182920 3300048920 Bacteria 1202
503 Ga0496117_0231582 3300048920 Bacteria 1020
504 Ga0496118_0000367 3300048921 Bacteria 75830
505 Ga0496118_0000968 3300048921 Bacteria 44862
506 Ga0496118_0002245 3300048921 Bacteria 26544
507 Ga0496118_0003061 3300048921 Bacteria 21482
508 Ga0496118_0017650 3300048921 Bacteria 6481
509 Ga0496118_0051584 3300048921 Bacteria 3146
510 Ga0496118_0456227 3300048921 Bacteria 647
511 Ga0496119_0019219 3300048922 Bacteria 5045
512 Ga0496119_0025027 3300048922 Bacteria 4178
513 Ga0496120_0022939 3300048923 Bacteria 3915
514 Ga0496120_0332931 3300048923 Bacteria 686
515 Ga0496121_0000148 3300048924 Bacteria 154021
516 Ga0496121_0001599 3300048924 Bacteria 37586
517 Ga0496121_0002683 3300048924 Bacteria 26620
518 Ga0496121_0018183 3300048924 Bacteria 7104
519 Ga0496121_0020678 3300048924 Bacteria 6495
520 Ga0496121_0618519 3300048924 Bacteria 665
521 Ga0496122_0012146 3300048925 Bacteria 8620
522 Ga0496122_0018865 3300048925 Bacteria 6339
523 Ga0496122_0026348 3300048925 Bacteria 5015
524 Ga0496122_0027412 3300048925 Bacteria 4871
525 Ga0496122_0039061 3300048925 Bacteria 3790
526 Ga0496122_0105552 3300048925 Bacteria 1868
527 Ga0496122_0157743 3300048925 Bacteria 1389
528 Ga0496122_0417061 3300048925 Bacteria 676
529 Ga0496123_0005811 3300048926 Bacteria 12244
530 Ga0496123_0009013 3300048926 Bacteria 9052
531 Ga0496123_0016097 3300048926 Bacteria 6093
532 Ga0496123_0032219 3300048926 Bacteria 3800
533 Ga0496123_0140480 3300048926 Bacteria 1321
534 Ga0496123_0297308 3300048926 Bacteria 772
535 Ga0496124_0002152 3300048927 Bacteria 26450
536 Ga0496124_0012852 3300048927 Bacteria 8224
537 Ga0496124_0042912 3300048927 Bacteria 3890
538 Ga0496124_0454390 3300048927 Bacteria 872
539 Ga0496124_0664550 3300048927 Bacteria 666
540 Ga0496125_0000737 3300048928 Bacteria 54074
541 Ga0496125_0014935 3300048928 Bacteria 7541
542 Ga0496125_0017518 3300048928 Bacteria 6823
543 Ga0496125_0022160 3300048928 Bacteria 5903
544 Ga0496125_0064466 3300048928 Bacteria 2911
545 Ga0496125_0104681 3300048928 Bacteria 2071
546 Ga0496125_0204549 3300048928 Bacteria 1288
547 Ga0496126_0013636 3300048929 Bacteria 8249
548 Ga0496126_0015132 3300048929 Bacteria 7771
549 Ga0496126_0033472 3300048929 Bacteria 4835
550 Ga0496126_0151878 3300048929 Bacteria 1984
551 Ga0496126_0168242 3300048929 Bacteria 1869
552 Ga0496126_0447922 3300048929 Bacteria 1039
553 Ga0495682_0000663 3300049460 Bacteria 22883
554 Ga0495682_0003389 3300049460 Bacteria 7102
555 Ga0501073_0685979 3300049589 Bacteria 707
556 nmdc:mga00v17_167045_c1 3300050491 Bacteria 1418
557 nmdc:mga00v17_430573_c1 3300050491 Bacteria 857
558 nmdc:mga0k408_120092_c1 3300050493 Bacteria 1556
559 nmdc:mga06z11_58684_c1 3300050494 Bacteria 1997
560 nmdc:mga07m45_64455_c1 3300050496 Bacteria 2079
561 nmdc:mga05p37_165941_c1 3300050507 Bacteria 2695
562 nmdc:mga05p37_272840_c1 3300050507 Bacteria 2020
563 nmdc:mga06r32_834552_c1 3300050510 Bacteria 881
564 nmdc:mga08y16_726521_c1 3300050511 Bacteria 991
565 nmdc:mga08x19_665648_c1 3300050514 Bacteria 739
566 nmdc:mga0sz30_40012_c1 3300050516 Bacteria 1599
567 Ga0495601_0013173 3300053077 Bacteria 4972
568 Ga0500635_0020662 3300053080 Bacteria 2019
569 Ga0495619_0073351 3300053085 Bacteria 2294
570 Ga0500646_0024463 3300053090 Bacteria 1626
571 Ga0500583_0236207 3300053092 Bacteria 904
572 Ga0500614_210741 3300053123 Bacteria 601
573 Ga0500618_000696 3300053125 Bacteria 19761
574 Ga0500590_214244 3300053148 Bacteria 801
575 Ga0500603_000209 3300053150 Bacteria 15429
576 Ga0500604_0037292 3300053151 Unclassified 1453
577 Ga0500622_0279150 3300053156 Bacteria 721
578 Ga0500633_0009106 3300053160 Bacteria 2594
579 Ga0500634_0000127 3300053161 Bacteria 27556
580 Ga0500638_025547 3300053162 Bacteria 2825
581 Ga0500637_0003369 3300053178 Bacteria 7368
582 Ga0500637_0045398 3300053178 Bacteria 2491
583 2547500519 2547132130 Bacteria 4660562
584 2601624853 2600255283 Bacteria 6061572
585 2747947858 2747842428 Bacteria 4689383
586 2765577931 2765235840 Bacteria 4663337
587 2809214501 2808606445 Bacteria 6057339
588 2816516001 2816332141 Bacteria 4436036
589 2831865583 2831864461 Bacteria 6502356
590 2842394308 2842391507 Bacteria 4486072
591 2874220552 2874220319 Bacteria 4594709
592 2919090595 2919089067 Bacteria 4560942
593 2919121236 2919119836 Bacteria 5208557
594 2919134791 2919134579 Bacteria 4480386
595 2928496563 2928496128 Bacteria 4631123
596 2931381814 2931380184 Bacteria 4455911
597 2937611419 2937610967 Bacteria 4618818
598 2939592816 2939589442 Bacteria 4214238
599 2939630485 2939626828 Bacteria 4695272
600 2941475403 2941471342 Bacteria 5018624
601 2946009649 2946006987 Bacteria 6705746
602 2961047317 2961047084 Bacteria 4594415
603 2961068666 2961064222 Bacteria 4749990
604 2974310761 2974307012 Bacteria 4172388
605 2977251506 2977247770 Bacteria 4160543
606 2984517863 2984514374 Bacteria 4172479
607 Ga0157370_10009564
608 SwRhRL2b_contig_1309206
609 JGI24735J21928_10000803
610 JGI25162J39368_1000521
611 JGI25157J39369_1006196
612 JGI25163J39215_1001632
613 JGI25164J39214_1000288
614 JGI25165J46597_1000532
615 rootH1_10053922
616 rootH2_10014721
617 rootH1_10024560
618 JGI25404J52841_10010472
619 Ga0055538_1009509
620 Ga0055535_1000429
621 Ga0055542_1000648
622 Ga0055529_1000467
623 Ga0055529_1005372
624 Ga0055526_1001268
625 Ga0055526_1058039
626 Ga0055537_1000489
627 Ga0055524_1004767
628 Ga0055536_1004397
629 Ga0055534_1000069
630 Ga0055528_1000650
631 Ga0055531_10013756
632 Ga0058692_1000022
633 Ga0065714_10079630
634 Ga0065704_10006474
635 Ga0065704_10533879
636 Ga0065707_10338039
637 Ga0070658_10000355
638 Ga0070683_100488266
639 Ga0070670_100098726
640 Ga0070670_100110425
641 Ga0070666_10000013
642 Ga0070666_10217618
643 Ga0070680_101775138
644 Ga0070687_100369573
645 Ga0070687_100490988
646 Ga0070661_100002265
647 Ga0070661_100011543
648 Ga0070661_100696143
649 Ga0070692_10327363
650 Ga0070668_100156758
651 Ga0070668_100752573
652 Ga0070669_100013051
653 Ga0070669_100032604
654 Ga0070675_100535706
655 Ga0070671_100744331
656 Ga0070671_100887498
657 Ga0070674_100054050
658 Ga0070674_100180488
659 Ga0070667_100170798
660 Ga0070667_100353370
661 Ga0070667_100788628
662 Ga0070667_101544860
663 Ga0070713_101072721
664 Ga0070713_101681300
665 Ga0070700_100009720
666 Ga0070708_100108142
667 Ga0070708_100377119
668 Ga0070708_100386119
669 Ga0070663_100063077
670 Ga0070678_100030615
671 Ga0070678_100263647
672 Ga0070678_100614793
673 Ga0068867_100008982
674 Ga0070685_10010846
675 Ga0070685_10434326
676 Ga0070706_100716210
677 Ga0070707_100154071
678 Ga0070698_100119646
679 Ga0070698_100258304
680 Ga0070699_100030342
681 Ga0070684_100232575
682 Ga0070684_100352471
683 Ga0070697_100524126
684 Ga0068853_100039870
685 Ga0070672_100092949
686 Ga0070695_100707506
687 Ga0070665_100086606
688 Ga0070665_100087649
689 Ga0070665_100792682
690 Ga0070704_101899106
691 Ga0068855_100103719
692 Ga0070664_100000365
693 Ga0070664_100128568
694 Ga0068857_100007248
695 Ga0068857_100079514
696 Ga0068857_100339822
697 Ga0068856_100219463
698 Ga0068852_101284399
699 Ga0068859_100011593
700 Ga0068859_101274721
701 Ga0068864_100158132
702 Ga0068866_10233021
703 Ga0068861_100066625
704 Ga0068863_101278552
705 Ga0068858_100007849
706 Ga0068858_100329068
707 Ga0068858_100575860
708 Ga0068858_100958062
709 Ga0068860_100000498
710 Ga0068860_101082145
711 Ga0068860_102228899
712 Ga0068862_100002138
713 Ga0068862_100026277
714 Ga0068862_100156806
715 Ga0068862_100367615
716 Ga0068862_101169170
717 Ga0081540_1000030
718 Ga0081539_10039453
719 Ga0075368_10111110
720 Ga0075364_10387299
721 Ga0070715_10357773
722 Ga0070712_100603475
723 Ga0075362_10190811
724 Ga0075367_10077193
725 Ga0075366_10113895
726 Ga0097621_100078222
727 Ga0097621_100685411
728 Ga0097621_101872422
729 Ga0075370_10025336
730 Ga0068871_100843920
731 Ga0075428_101592755
732 Ga0075430_100981211
733 Ga0075431_100542592
734 Ga0075431_101114298
735 Ga0075431_101602455
736 Ga0075433_11742663
737 Ga0068865_100036476
738 Ga0075436_100590686
739 Ga0097620_100011593
740 Ga0097620_101274531
741 Ga0099794_10007793
742 Ga0099794_10256977
743 Ga0099795_10048804
744 Ga0099795_10050451
745 Ga0099795_10108887
746 Ga0105244_10101096
747 Ga0105250_10106744
748 Ga0105240_10020844
749 Ga0105240_11561425
750 Ga0111539_10328035
751 Ga0105247_10007619
752 Ga0105247_10223638
753 Ga0114129_10235699
754 Ga0114129_10314795
755 Ga0114129_12859162
756 Ga0105243_10694504
757 Ga0105242_10091965
758 Ga0105242_11730260
759 Ga0105248_10284033
760 Ga0105248_10842862
761 Ga0105237_11712779
762 Ga0105237_12455482
763 Ga0105238_10000098
764 Ga0105238_10060126
765 Ga0105238_10124718
766 Ga0105238_12157729
767 Ga0105238_12187834
768 Ga0105238_12222671
769 Ga0105249_10006601
770 Ga0105249_10219262
771 Ga0105249_10565287
772 Ga0105249_10706001
773 Ga0105249_12201466
774 Ga0099796_10005646
775 Ga0099796_10027255
776 Ga0099796_10170732
777 Ga0099796_10416002
778 Ga0105239_11108286
779 Ga0105246_10137693
780 Ga0105246_10632918
781 Ga0157373_10104398
782 Ga0157373_10290807
783 Ga0157373_10462942
784 Ga0157371_10010819
785 Ga0157371_10442905
786 Ga0157371_10864161
787 Ga0157370_10012991
788 Ga0157370_10070662
789 Ga0157370_10113437
790 Ga0157370_11129302
791 Ga0157369_10000529
792 Ga0157369_10014229
793 Ga0157369_10141557
794 Ga0157369_10334811
795 Ga0157378_10014824
796 Ga0157378_11976649
797 Ga0163162_10017833
798 Ga0163162_10054707
799 Ga0163162_10066676
800 Ga0163162_12417824
801 Ga0157372_10842273
802 Ga0157375_10009593
803 Ga0163163_10064415
804 Ga0163163_10728456
805 Ga0157380_10054623
806 Ga0182008_10007949
807 Ga0182008_10024015
808 Ga0157379_10070638
809 Ga0157379_10192859
810 Ga0157379_10399481
811 Ga0157379_10968722
812 Ga0157379_11086430
813 Ga0157376_10240073
814 Ga0182006_1004753
815 Ga0182006_1047666
816 Ga0182006_1082600
817 Ga0182006_1082954
818 Ga0182005_1013283
819 Ga0163161_10019177
820 Ga0163161_10150414
821 Ga0163161_10226654
822 Ga0163161_10235068
823 Ga0163161_10809654
824 Ga0213872_10001721
825 Ga0213872_10300277
826 Ga0209760_101733
827 Ga0209784_100216
828 Ga0209672_107210
829 Ga0207427_100267
830 Ga0209437_100037
831 Ga0209258_100034
832 Ga0209646_1000436
833 Ga0209026_1000255
834 Ga0209148_1000001
835 Ga0209759_1020921
836 Ga0209233_1000002
837 Ga0209565_1000033
838 Ga0209455_1000054
839 Ga0209673_1000062
840 Ga0209675_1000869
841 Ga0209676_1000037
842 Ga0209025_1022787
843 Ga0209564_1000367
844 Ga0209564_1023983
845 Ga0209050_1003874
846 Ga0209050_1028304
847 Ga0209050_1048287
848 Ga0209256_1007003
849 Ga0209256_1018000
850 Ga0209257_1007853
851 Ga0209257_1024194
852 Ga0209257_1024942
853 Ga0207642_10021216
854 Ga0207642_10071858
855 Ga0207710_10009951
856 Ga0207710_10010020
857 Ga0207710_10147837
858 Ga0207688_10323193
859 Ga0207680_10000001
860 Ga0207680_10073898
861 Ga0207647_10000008
862 Ga0207647_10187688
863 Ga0207705_10001178
864 Ga0207684_10442473
865 Ga0207654_10702281
866 Ga0207695_10126167
867 Ga0207671_10182038
868 Ga0207693_10850375
869 Ga0207657_10616067
870 Ga0207649_10001906
871 Ga0207649_10088438
872 Ga0207649_10722301
873 Ga0207646_10015591
874 Ga0207646_10020287
875 Ga0207646_11345845
876 Ga0207646_11693473
877 Ga0207681_10093642
878 Ga0207694_10000180
879 Ga0207694_10047552
880 Ga0207694_11435330
881 Ga0207700_10404360
882 Ga0207644_10049504
883 Ga0207709_10002458
884 Ga0207669_10231816
885 Ga0207669_10802191
886 Ga0207704_10224823
887 Ga0207691_10008769
888 Ga0207711_10649563
889 Ga0207689_11018861
890 Ga0207661_10700729
891 Ga0207679_10000365
892 Ga0207712_10118990
893 Ga0207712_10359067
894 Ga0207668_10085932
895 Ga0207668_10282054
896 Ga0207658_10412723
897 Ga0207658_10584524
898 Ga0207658_11041215
899 Ga0207658_11183875
900 Ga0207658_11628570
901 Ga0207703_10000449
902 Ga0207678_10041673
903 Ga0207708_10040080
904 Ga0207641_10000337
905 Ga0207648_10005014
906 Ga0207648_10607317
907 Ga0207674_10014081
908 Ga0207674_10119709
909 Ga0207674_10168055
910 Ga0207675_100004084
911 Ga0207675_102196965
912 Ga0207683_10451369
913 Ga0207683_10632716
914 Ga0207698_10348554
915 Ga0209371_1000004
916 Ga0209588_1006399
917 Ga0209588_1063368
918 Ga0209588_1281338
919 Ga0268266_10000059
920 Ga0268265_10008026
921 Ga0268265_10031652
922 Ga0268265_10123579
923 Ga0268265_10471576
924 Ga0268264_10000989
925 Ga0268264_10017316
926 Ga0268264_10274680
927 Ga0268256_1000005
928 Ga0316179_1115110
929 Ga0316183_1021823
930 Ga0265328_10047870
931 Ga0265331_10010282
932 Ga0265327_10010277
933 Ga0307509_10234623
934 Ga0307410_10643416
935 Ga0307406_10653869
936 Ga0307412_10000238
937 Ga0307409_102603056
938 Ga0307414_10048862
939 Ga0307414_10885622
940 Ga0307510_10000001
941 Ga0307510_10000070
942 Ga0307510_10045758
943 Ga0307510_10066350
944 Ga0373926_0254526
945 Ga0373926_0300138
946 Ga0373934_0068558
947 Ga0373936_0032173
948 Ga0373945_0005237
949 Ga0373954_0069901
950 Ga0373954_0639784
951 Ga0373956_0123620
952 Ga0373957_0232532
953 Ga0373955_0018962
954 Ga0373924_0100799
955 Ga0373931_0511727
956 Ga0373935_0000495
957 Ga0373927_0000308
958 Ga0373927_0479498
959 Ga0373947_0005725
960 Ga0373947_0157242
961 Ga0373937_0012823
962 Ga0373925_0026337
963 Ga0373925_0287630
964 Ga0436360_0705644
965 Ga0436360_1090132
966 Ga0436361_0001950
967 Ga0436361_0488811
968 Ga0436361_0575458
969 Ga0436363_0674425
970 Ga0439432_002147
971 Ga0439432_017631
972 Ga0439456_038341
973 Ga0439463_000279
974 Ga0439463_003685
975 Ga0439463_005718
976 Ga0450911_001038
977 Ga0451577_0058340
978 Ga0453684_0282414
979 Ga0466968_0077810
980 Ga0451576_0414318
981 Ga0495627_099473
982 Ga0495592_0230696
983 Ga0495603_0004869
984 Ga0495603_0030265
985 Ga0495603_0048417
986 Ga0495591_000130
987 Ga0495591_034250
988 Ga0495629_0000170
989 Ga0495629_0062163
990 Ga0495638_0000223
991 Ga0495638_0001630
992 Ga0495641_0002571
993 Ga0495653_0465233
994 Ga0495650_0000332
995 Ga0495650_0002051
996 Ga0495580_0016736
997 Ga0495580_0117148
998 Ga0495582_0000053
999 Ga0495605_0000310
1000 Ga0495639_0017358
1001 Ga0495662_0035290
1002 Ga0495584_0000019
1003 Ga0495584_0000301
1004 Ga0495585_0003752
1005 Ga0495585_0017400
1006 Ga0495594_0000267
1007 Ga0495607_0000713
1008 Ga0495583_0000131
1009 Ga0495583_0004927
1010 Ga0495583_0005937
1011 Ga0495606_0000630
1012 Ga0495606_0023674
1013 Ga0495606_0024568
1014 Ga0495606_0051898
1015 Ga0495606_0667325
1016 Ga0495610_0016898
1017 Ga0495610_0038745
1018 Ga0495610_0144798
1019 Ga0495616_0000129
1020 Ga0495618_0044831
1021 Ga0495620_0000369
1022 Ga0495620_0031203
1023 Ga0495628_0082136
1024 Ga0495630_0036321
1025 Ga0495631_0000210
1026 Ga0495631_0033178
1027 Ga0495632_0088157
1028 Ga0495632_0093130
1029 Ga0495632_0136148
1030 Ga0495632_0451257
1031 Ga0495643_0000986
1032 Ga0495648_0004349
1033 Ga0495648_0035889
1034 Ga0495648_0095954
1035 Ga0495663_0000441
1036 Ga0495666_0026158
1037 Ga0495652_0057077
1038 Ga0495654_0000059
1039 Ga0495654_0007317
1040 Ga0495665_0000132
1041 Ga0495640_0163037
1042 Ga0495609_0084135
1043 Ga0495622_0001155
1044 Ga0495622_0001348
1045 Ga0495622_0222522
1046 Ga0495633_0017813
1047 Ga0495668_0044727
1048 Ga0495634_0002240
1049 Ga0495634_0237755
1050 Ga0495611_0000308
1051 Ga0495625_0006064
1052 Ga0495625_0008519
1053 Ga0495625_0138616
1054 Ga0495625_0446824
1055 Ga0495625_0510703
1056 Ga0495635_0000488
1057 Ga0495661_0000892
1058 Ga0495588_0034113
1059 Ga0495657_0587797
1060 Ga0495599_0218091
1061 Ga0495646_0036373
1062 Ga0495647_0003052
1063 Ga0495658_0007931
1064 Ga0495669_0015524
1065 Ga0495613_0006627
1066 Ga0495613_0368773
1067 Ga0495624_0013743
1068 Ga0495624_0272311
1069 Ga0495670_0003595
1070 Ga0495649_0183407
1071 Ga0495660_0401955
1072 Ga0495581_0001133
1073 Ga0495674_0001834
1074 Ga0495674_0131087
1075 Ga0495672_0000214
1076 Ga0495676_0008173
1077 Ga0495680_0085425
1078 Ga0495687_182920
1079 Ga0495679_000233
1080 Ga0495673_0000077
1081 Ga0495673_0000495
1082 Ga0495673_0003991
1083 Ga0495673_0007581
1084 Ga0495673_0041452
1085 Ga0495684_0020744
1086 Ga0495686_0001359
1087 Ga0495686_0011339
1088 Ga0495686_0028326
1089 Ga0495686_0052993
1090 Ga0495593_0000177
1091 Ga0496101_0555650
1092 Ga0496102_0051714
1093 Ga0496102_0243571
1094 Ga0496102_0418188
1095 Ga0496104_0130152
1096 Ga0496105_0049705
1097 Ga0496110_0213559
1098 Ga0496111_0529180
1099 Ga0496113_0385799
1100 Ga0496115_0000413
1101 Ga0496116_0011208
1102 Ga0496116_0027232
1103 Ga0496116_0042789
1104 Ga0496116_0043312
1105 Ga0496116_0070894
1106 Ga0496117_0000386
1107 Ga0496117_0002648
1108 Ga0496117_0182920
1109 Ga0496117_0231582
1110 Ga0496118_0000367
1111 Ga0496118_0000968
1112 Ga0496118_0002245
1113 Ga0496118_0003061
1114 Ga0496118_0017650
1115 Ga0496118_0051584
1116 Ga0496118_0456227
1117 Ga0496119_0019219
1118 Ga0496119_0025027
1119 Ga0496120_0022939
1120 Ga0496120_0332931
1121 Ga0496121_0000148
1122 Ga0496121_0001599
1123 Ga0496121_0002683
1124 Ga0496121_0018183
1125 Ga0496121_0020678
1126 Ga0496121_0618519
1127 Ga0496122_0012146
1128 Ga0496122_0018865
1129 Ga0496122_0026348
1130 Ga0496122_0027412
1131 Ga0496122_0039061
1132 Ga0496122_0105552
1133 Ga0496122_0157743
1134 Ga0496122_0417061
1135 Ga0496123_0005811
1136 Ga0496123_0009013
1137 Ga0496123_0016097
1138 Ga0496123_0032219
1139 Ga0496123_0140480
1140 Ga0496123_0297308
1141 Ga0496124_0002152
1142 Ga0496124_0012852
1143 Ga0496124_0042912
1144 Ga0496124_0454390
1145 Ga0496124_0664550
1146 Ga0496125_0000737
1147 Ga0496125_0014935
1148 Ga0496125_0017518
1149 Ga0496125_0022160
1150 Ga0496125_0064466
1151 Ga0496125_0104681
1152 Ga0496125_0204549
1153 Ga0496126_0013636
1154 Ga0496126_0015132
1155 Ga0496126_0033472
1156 Ga0496126_0151878
1157 Ga0496126_0168242
1158 Ga0496126_0447922
1159 Ga0495682_0000663
1160 Ga0495682_0003389
1161 Ga0501073_0685979
1162 nmdc:mga00v17_167045_c1
1163 nmdc:mga00v17_430573_c1
1164 nmdc:mga0k408_120092_c1
1165 nmdc:mga06z11_58684_c1
1166 nmdc:mga07m45_64455_c1
1167 nmdc:mga05p37_165941_c1
1168 nmdc:mga05p37_272840_c1
1169 nmdc:mga06r32_834552_c1
1170 nmdc:mga08y16_726521_c1
1171 nmdc:mga08x19_665648_c1
1172 nmdc:mga0sz30_40012_c1
1173 Ga0495601_0013173
1174 Ga0500635_0020662
1175 Ga0495619_0073351
1176 Ga0500646_0024463
1177 Ga0500583_0236207
1178 Ga0500614_210741
1179 Ga0500618_000696
1180 Ga0500590_214244
1181 Ga0500603_000209
1182 Ga0500604_0037292
1183 Ga0500622_0279150
1184 Ga0500633_0009106
1185 Ga0500634_0000127
1186 Ga0500638_025547
1187 Ga0500637_0003369
1188 Ga0500637_0045398
1189 2547500519
1190 2601624853
1191 2747947858
1192 2765577931
1193 2809214501
1194 2816516001
1195 2831865583
1196 2842394308
1197 2874220552
1198 2919090595
1199 2919121236
1200 2919134791
1201 2928496563
1202 2931381814
1203 2937611419
1204 2939592816
1205 2939630485
1206 2941475403
1207 2946009649
1208 2961047317
1209 2961068666
1210 2974310761
1211 2977251506
1212 2984517863

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14552

Tautomerase_2

Tautomerase enzyme

62

143

1

PF01361

Tautomerase

Tautomerase enzyme

92

146

0.95

PF01361

Tautomerase

Tautomerase enzyme

27

83

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lho-assembly1.cif.gz_A crystal structure of fg41malonate semialdehyde decarboxylase inhibited by 3-bromopropiolate 0.9277 3 125
2aag-assembly1.cif.gz_C crystal structures of the wild-type, mutant-p1a and inactivated malonate semialdehyde decarboxylase: a structural basis for the decarboxylase and hydratase activities 0.9262 3 123
2aaj-assembly1.cif.gz_A crystal structures of the wild-type, mutant-p1a and inactivated malonate semialdehyde decarboxylase: a structural basis for the decarboxylase and hydratase activities 0.9248 3 123
6ogm-assembly2.cif.gz_H crystal structure of apo unfused 4-ot 0.9217 69 122
4lkb-assembly1.cif.gz_B crystal structure of a putative 4-oxalocrotonate tautomerase from nostoc sp. pcc 7120 0.9161 1 122
ID Description Score Start End Superfamily
2aagB00 Alpha Beta;2-Layer Sandwich;Macrophage Migration Inhibitory Factor;Macrophage Migration Inhibitory Factor 0.9274 3 123 3.30.429.10
3mjzB00 Alpha Beta;2-Layer Sandwich;Macrophage Migration Inhibitory Factor;Macrophage Migration Inhibitory Factor 0.9263 3 125 3.30.429.10
4lkbC00 Alpha Beta;2-Layer Sandwich;Macrophage Migration Inhibitory Factor;Macrophage Migration Inhibitory Factor 0.9087 1 122 3.30.429.10
2op8B00 Alpha Beta;2-Layer Sandwich;Macrophage Migration Inhibitory Factor;Macrophage Migration Inhibitory Factor 0.9014 69 119 3.30.429.10
3mjzB00 Alpha Beta;2-Layer Sandwich;Macrophage Migration Inhibitory Factor;Macrophage Migration Inhibitory Factor 0.8986 3 125 3.30.429.10
ID Description Score Start End GO Terms
AF-A0A6B8GTZ9-F1-model_v4 deleted 0.9924 1 126
AF-A0A0B1YDD4-F1-model_v4 4-oxalocrotonate tautomerase 0.9895 1 124
AF-A0A2M8ZI30-F1-model_v4 deleted 0.9888 1 124
AF-A0A437QZ60-F1-model_v4 Tautomerase family protein 0.9876 1 123
AF-A0A839YK84-F1-model_v4 Phenylpyruvate tautomerase PptA (4-oxalocrotonate tautomerase family) 0.9875 21 126

Map