F468607

General Info

Members Datasets Scaffolds Average Seq Length
606 273 1212 104

Family's Representative Sequence

Representative Sequence 3300032002|Ga0307416_103746545|Ga0307416_1037465452
Length 119
Sequence LRQKSGFTTSSKAQMLIVHVFVHVKPESVAAFTAATLENARNSVQEPGIVRFDVIQQDDDPTRFVLVEIYRTADDPARHKETAHYLTWRNAVESMMAEPRRSVKYGAVFPGPAGWEMPR

Samples

Sample ID Description Type Environment
1 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
73 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
74 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
77 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
78 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
82 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
83 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
89 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
113 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
161 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
163 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
167 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
168 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
169 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
170 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
171 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
172 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
173 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
174 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
175 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
176 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
177 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
178 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
179 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
180 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
181 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
182 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
183 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
184 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
185 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
186 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
187 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
188 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
189 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
190 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
191 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
192 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
193 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
194 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
198 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
199 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
200 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
201 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
202 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
203 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
204 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
205 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
206 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
207 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
208 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
209 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
210 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
211 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
212 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
213 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
214 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
215 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
216 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
217 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
218 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
219 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
220 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
221 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
222 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
223 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
224 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
225 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
226 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
227 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
228 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
229 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
230 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
231 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
232 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
233 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
234 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
235 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
236 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
237 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
238 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
239 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
240 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
241 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
242 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
243 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
244 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
245 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
246 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
247 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
250 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
251 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
252 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
253 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
254 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
255 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
256 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
257 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
258 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
259 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
260 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
261 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
262 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
263 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
264 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
265 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
266 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
267 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
268 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
269 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
270 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
271 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
272 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
273 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.01
Metatranscriptomes 0.99
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.64
Nodule 0
Rhizoplane 1.49
Rhizosphere 94.55
Stem 0
Stem Tuber 0
Unclassified 25.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307416_103746545 3300032002 Unclassified 509
2 rootH2_10292872 3300003320 Bacteria 1454
3 rootL2_10074260 3300003322 Bacteria 18154
4 rootH1_10251148 3300003323 Bacteria 1974
5 Ga0065712_10771314 3300005290 Bacteria 521
6 Ga0065715_10572832 3300005293 Unclassified 726
7 Ga0065715_11180901 3300005293 Bacteria 502
8 Ga0065707_10072404 3300005295 Unclassified 579
9 Ga0070658_10188636 3300005327 Unclassified 1737
10 Ga0070658_10475561 3300005327 Bacteria 1078
11 Ga0070658_11070963 3300005327 Bacteria 701
12 Ga0070658_11482348 3300005327 Unclassified 588
13 Ga0070676_10571860 3300005328 Bacteria 811
14 Ga0070676_10674642 3300005328 Bacteria 752
15 Ga0070676_10695671 3300005328 Unclassified 742
16 Ga0070683_100007411 3300005329 Bacteria 9269
17 Ga0070683_100013075 3300005329 Bacteria 7229
18 Ga0070683_100217453 3300005329 Bacteria 1816
19 Ga0070683_100559787 3300005329 Unclassified 1093
20 Ga0070683_100686074 3300005329 Bacteria 981
21 Ga0070683_100986474 3300005329 Unclassified 809
22 Ga0070683_100993324 3300005329 Bacteria 806
23 Ga0070690_100503012 3300005330 Bacteria 907
24 Ga0070670_100082189 3300005331 Bacteria 2768
25 Ga0070670_100299806 3300005331 Unclassified 1406
26 Ga0070670_101092804 3300005331 Bacteria 727
27 Ga0070670_101597590 3300005331 Bacteria 599
28 Ga0068869_100883708 3300005334 Bacteria 772
29 Ga0068869_101375319 3300005334 Unclassified 624
30 Ga0070666_11136126 3300005335 Bacteria 581
31 Ga0070680_100007703 3300005336 Bacteria 8216
32 Ga0070680_100722727 3300005336 Unclassified 857
33 Ga0070680_100867684 3300005336 Bacteria 778
34 Ga0070682_101008853 3300005337 Bacteria 691
35 Ga0068868_100620240 3300005338 Unclassified 960
36 Ga0068868_101087051 3300005338 Unclassified 735
37 Ga0068868_101220510 3300005338 Bacteria 696
38 Ga0070660_100464398 3300005339 Bacteria 1051
39 Ga0070689_100013514 3300005340 Bacteria 5911
40 Ga0070691_10401215 3300005341 Bacteria 773
41 Ga0070691_11066618 3300005341 Bacteria 507
42 Ga0070661_100000731 3300005344 Bacteria 23961
43 Ga0070692_10008651 3300005345 Bacteria 4549
44 Ga0070692_10136343 3300005345 Unclassified 1385
45 Ga0070692_10708994 3300005345 Unclassified 678
46 Ga0070668_100012928 3300005347 Bacteria 6216
47 Ga0070668_100026784 3300005347 Bacteria 4376
48 Ga0070668_100031211 3300005347 Bacteria 4054
49 Ga0070669_100000789 3300005353 Bacteria 22983
50 Ga0070669_100131466 3300005353 Unclassified 1921
51 Ga0070669_100151216 3300005353 Bacteria 1797
52 Ga0070669_100303253 3300005353 Bacteria 1285
53 Ga0070669_100362852 3300005353 Unclassified 1178
54 Ga0070675_100260509 3300005354 Bacteria 1519
55 Ga0070675_100483431 3300005354 Bacteria 1114
56 Ga0070675_101054637 3300005354 Unclassified 747
57 Ga0070675_101816007 3300005354 Unclassified 562
58 Ga0070671_100060271 3300005355 Bacteria 3160
59 Ga0070671_101225213 3300005355 Unclassified 661
60 Ga0070674_100093742 3300005356 Bacteria 2173
61 Ga0070674_100100221 3300005356 Bacteria 2109
62 Ga0070674_100197507 3300005356 Bacteria 1551
63 Ga0070674_100280618 3300005356 Unclassified 1320
64 Ga0070673_100216362 3300005364 Bacteria 1656
65 Ga0070673_100601657 3300005364 Bacteria 1003
66 Ga0070673_100863867 3300005364 Unclassified 838
67 Ga0070673_100955030 3300005364 Bacteria 797
68 Ga0070673_101732134 3300005364 Unclassified 591
69 Ga0070673_102313536 3300005364 Bacteria 511
70 Ga0070688_100135393 3300005365 Unclassified 1667
71 Ga0070659_100048102 3300005366 Bacteria 3349
72 Ga0070659_100511031 3300005366 Unclassified 1025
73 Ga0070659_101131387 3300005366 Unclassified 691
74 Ga0070667_100379697 3300005367 Bacteria 1283
75 Ga0070667_100445500 3300005367 Unclassified 1183
76 Ga0070667_100531278 3300005367 Bacteria 1080
77 Ga0070667_100799721 3300005367 Bacteria 875
78 Ga0070703_10517484 3300005406 Bacteria 539
79 Ga0070709_10165021 3300005434 Bacteria 1543
80 Ga0070709_10597427 3300005434 Unclassified 849
81 Ga0070714_100238725 3300005435 Bacteria 1677
82 Ga0070701_11346752 3300005438 Bacteria 512
83 Ga0070711_100047720 3300005439 Bacteria 2925
84 Ga0070711_101298162 3300005439 Unclassified 631
85 Ga0070705_101515561 3300005440 Bacteria 562
86 Ga0070700_100046453 3300005441 Bacteria 2683
87 Ga0070700_100171156 3300005441 Unclassified 1504
88 Ga0070700_100542890 3300005441 Bacteria 902
89 Ga0070694_100130976 3300005444 Bacteria 1812
90 Ga0070663_100029438 3300005455 Unclassified 3753
91 Ga0070663_101350837 3300005455 Unclassified 630
92 Ga0070678_101020757 3300005456 Unclassified 761
93 Ga0070662_100033839 3300005457 Bacteria 3601
94 Ga0070662_100118250 3300005457 Bacteria 2028
95 Ga0070662_100173157 3300005457 Bacteria 1696
96 Ga0070662_100276015 3300005457 Bacteria 1359
97 Ga0070662_100334408 3300005457 Unclassified 1238
98 Ga0070662_100573555 3300005457 Unclassified 947
99 Ga0070662_100910775 3300005457 Bacteria 750
100 Ga0070662_101903750 3300005457 Unclassified 514
101 Ga0070681_10004395 3300005458 Bacteria 13428
102 Ga0070681_10041447 3300005458 Bacteria 4615
103 Ga0070681_10068438 3300005458 Bacteria 3517
104 Ga0070681_11048312 3300005458 Unclassified 736
105 Ga0068867_100067113 3300005459 Bacteria 2673
106 Ga0068867_100864784 3300005459 Unclassified 811
107 Ga0070685_10900360 3300005466 Bacteria 658
108 Ga0070706_101874507 3300005467 Bacteria 544
109 Ga0070707_101133672 3300005468 Bacteria 748
110 Ga0070707_102097866 3300005468 Bacteria 533
111 Ga0070698_100186061 3300005471 Bacteria 2015
112 Ga0070679_100014713 3300005530 Bacteria 7521
113 Ga0070679_100067877 3300005530 Bacteria 3557
114 Ga0070679_100203233 3300005530 Bacteria 1946
115 Ga0070679_100237247 3300005530 Bacteria 1782
116 Ga0070679_100757961 3300005530 Bacteria 914
117 Ga0070684_100001494 3300005535 Bacteria 16887
118 Ga0070684_100110356 3300005535 Bacteria 2466
119 Ga0070684_100139609 3300005535 Bacteria 2191
120 Ga0070684_100397708 3300005535 Bacteria 1270
121 Ga0070684_101345952 3300005535 Unclassified 672
122 Ga0068853_100008804 3300005539 Bacteria 8118
123 Ga0070672_100022529 3300005543 Bacteria 4629
124 Ga0070672_100035476 3300005543 Bacteria 3791
125 Ga0070672_100066539 3300005543 Bacteria 2853
126 Ga0070672_100229945 3300005543 Bacteria 1558
127 Ga0070672_100263490 3300005543 Bacteria 1454
128 Ga0070672_101406550 3300005543 Bacteria 624
129 Ga0070672_101527623 3300005543 Bacteria 598
130 Ga0070696_100925865 3300005546 Bacteria 724
131 Ga0070693_101512394 3300005547 Bacteria 525
132 Ga0070665_100011325 3300005548 Bacteria 9021
133 Ga0070665_101649141 3300005548 Unclassified 649
134 Ga0070704_100163772 3300005549 Bacteria 1761
135 Ga0070704_100394661 3300005549 Bacteria 1179
136 Ga0070704_101522947 3300005549 Unclassified 615
137 Ga0068855_100481484 3300005563 Bacteria 1351
138 Ga0068855_100960374 3300005563 Bacteria 900
139 Ga0070664_100025723 3300005564 Bacteria 4880
140 Ga0070664_100097859 3300005564 Bacteria 2548
141 Ga0070664_100112805 3300005564 Bacteria 2374
142 Ga0070664_100398063 3300005564 Bacteria 1259
143 Ga0068857_100118696 3300005577 Unclassified 2381
144 Ga0068854_100136057 3300005578 Bacteria 1881
145 Ga0068854_100281119 3300005578 Bacteria 1340
146 Ga0068852_100148278 3300005616 Bacteria 2178
147 Ga0068852_100268104 3300005616 Unclassified 1642
148 Ga0068852_100431413 3300005616 Bacteria 1301
149 Ga0068852_100924658 3300005616 Bacteria 890
150 Ga0068859_100530634 3300005617 Bacteria 1272
151 Ga0068864_100089746 3300005618 Bacteria 2708
152 Ga0068864_100093951 3300005618 Bacteria 2650
153 Ga0068866_10138221 3300005718 Bacteria 1395
154 Ga0068861_100004971 3300005719 Bacteria 8958
155 Ga0068861_100006078 3300005719 Bacteria 8212
156 Ga0068861_100612384 3300005719 Bacteria 1001
157 Ga0068861_101020580 3300005719 Unclassified 791
158 Ga0068851_10065015 3300005834 Bacteria 1876
159 Ga0068851_10176317 3300005834 Bacteria 1182
160 Ga0068870_10005432 3300005840 Bacteria 5567
161 Ga0068863_100700772 3300005841 Bacteria 1006
162 Ga0068863_101076288 3300005841 Bacteria 808
163 Ga0068858_100810396 3300005842 Bacteria 914
164 Ga0068860_100132210 3300005843 Bacteria 2395
165 Ga0068860_100321274 3300005843 Bacteria 1519
166 Ga0068860_100515851 3300005843 Bacteria 1195
167 Ga0068862_100001053 3300005844 Bacteria 26453
168 Ga0068862_100255348 3300005844 Bacteria 1598
169 Ga0070717_10124335 3300006028 Bacteria 2213
170 Ga0070717_10242468 3300006028 Bacteria 1590
171 Ga0075368_10175929 3300006042 Bacteria 901
172 Ga0075364_10786606 3300006051 Unclassified 649
173 Ga0070712_100460928 3300006175 Unclassified 1060
174 Ga0075367_10015424 3300006178 Bacteria 4152
175 Ga0075366_10084683 3300006195 Bacteria 1895
176 Ga0075366_10226305 3300006195 Bacteria 1139
177 Ga0075370_10633230 3300006353 Unclassified 649
178 Ga0068871_101485877 3300006358 Bacteria 640
179 Ga0075428_100014735 3300006844 Bacteria 8683
180 Ga0075428_100587154 3300006844 Bacteria 1190
181 Ga0075428_101011399 3300006844 Bacteria 880
182 Ga0075430_100001058 3300006846 Bacteria 21773
183 Ga0075430_100004042 3300006846 Bacteria 12381
184 Ga0075430_100027099 3300006846 Bacteria 4871
185 Ga0075430_100050865 3300006846 Unclassified 3493
186 Ga0075430_100236351 3300006846 Bacteria 1514
187 Ga0075431_100015377 3300006847 Bacteria 7755
188 Ga0075431_100018606 3300006847 Bacteria 7078
189 Ga0075431_100105102 3300006847 Unclassified 2914
190 Ga0075431_100117256 3300006847 Bacteria 2747
191 Ga0075431_100338421 3300006847 Bacteria 1514
192 Ga0075431_100375381 3300006847 Bacteria 1427
193 Ga0075431_100405948 3300006847 Bacteria 1363
194 Ga0075431_100494321 3300006847 Unclassified 1215
195 Ga0075431_100597695 3300006847 Bacteria 1088
196 Ga0075431_100985782 3300006847 Bacteria 810
197 Ga0075433_10077052 3300006852 Bacteria 2937
198 Ga0075433_10110053 3300006852 Bacteria 2444
199 Ga0075433_10759670 3300006852 Bacteria 848
200 Ga0075434_100005366 3300006871 Bacteria 11663
201 Ga0075434_100376721 3300006871 Bacteria 1440
202 Ga0075429_100088727 3300006880 Bacteria 2696
203 Ga0075429_100218640 3300006880 Bacteria 1669
204 Ga0075429_100360645 3300006880 Bacteria 1273
205 Ga0075429_101620135 3300006880 Bacteria 563
206 Ga0068865_100010287 3300006881 Bacteria 5818
207 Ga0068865_100055486 3300006881 Bacteria 2756
208 Ga0097620_100530541 3300006931 Bacteria 1272
209 Ga0075435_100234282 3300007076 Bacteria 1560
210 Ga0075435_100469506 3300007076 Bacteria 1086
211 Ga0105250_10485297 3300009092 Unclassified 559
212 Ga0105240_10961665 3300009093 Bacteria 915
213 Ga0105240_11584942 3300009093 Bacteria 685
214 Ga0111539_10016737 3300009094 Bacteria 9087
215 Ga0111539_10065157 3300009094 Bacteria 4307
216 Ga0111539_10466893 3300009094 Bacteria 1470
217 Ga0111539_11024999 3300009094 Bacteria 959
218 Ga0105245_10146783 3300009098 Bacteria 2226
219 Ga0105245_11083163 3300009098 Unclassified 847
220 Ga0105247_10376766 3300009101 Unclassified 1005
221 Ga0114129_10142241 3300009147 Bacteria 3287
222 Ga0114129_10205540 3300009147 Bacteria 2665
223 Ga0114129_11181351 3300009147 Unclassified 954
224 Ga0105243_10209312 3300009148 Bacteria 1716
225 Ga0105243_10332328 3300009148 Unclassified 1389
226 Ga0105243_11887938 3300009148 Bacteria 630
227 Ga0105242_10081608 3300009176 Bacteria 2704
228 Ga0105242_10252787 3300009176 Bacteria 1589
229 Ga0105248_10141956 3300009177 Bacteria 2709
230 Ga0105248_10219204 3300009177 Unclassified 2142
231 Ga0105248_10474159 3300009177 Bacteria 1411
232 Ga0105238_10623210 3300009551 Bacteria 1088
233 Ga0105238_11672881 3300009551 Unclassified 667
234 Ga0105249_10002760 3300009553 Bacteria 15178
235 Ga0105249_10048458 3300009553 Unclassified 3873
236 Ga0105249_11079584 3300009553 Bacteria 873
237 Ga0105249_11700231 3300009553 Bacteria 703
238 Ga0105249_12286217 3300009553 Bacteria 613
239 Ga0105249_12417455 3300009553 Bacteria 598
240 Ga0105249_13081464 3300009553 Unclassified 535
241 Ga0105239_10156016 3300010375 Bacteria 2549
242 Ga0157371_10560734 3300013102 Bacteria 847
243 Ga0157374_10637501 3300013296 Bacteria 1077
244 Ga0157378_11383191 3300013297 Unclassified 746
245 Ga0163162_10156665 3300013306 Bacteria 2398
246 Ga0157372_10598030 3300013307 Bacteria 1286
247 Ga0157372_11880026 3300013307 Unclassified 688
248 Ga0157372_12876667 3300013307 Bacteria 551
249 Ga0157375_10069899 3300013308 Bacteria 3519
250 Ga0157375_10283776 3300013308 Bacteria 1819
251 Ga0157375_10507728 3300013308 Bacteria 1370
252 Ga0157375_12272141 3300013308 Bacteria 646
253 Ga0163163_10190635 3300014325 Unclassified 2098
254 Ga0163163_11439538 3300014325 Unclassified 751
255 Ga0163163_12233221 3300014325 Unclassified 606
256 Ga0157380_10003185 3300014326 Bacteria 11195
257 Ga0157380_10648226 3300014326 Bacteria 1053
258 Ga0157380_11408105 3300014326 Unclassified 748
259 Ga0157379_10441923 3300014968 Bacteria 1199
260 Ga0157379_11200263 3300014968 Unclassified 730
261 Ga0157376_10837947 3300014969 Bacteria 934
262 Ga0157376_11576434 3300014969 Unclassified 691
263 Ga0157376_12442420 3300014969 Unclassified 562
264 Ga0163161_10027348 3300017792 Bacteria 4045
265 Ga0213876_10011380 3300021384 Bacteria 4753
266 Ga0207653_10264880 3300025885 Unclassified 661
267 Ga0207647_10187619 3300025904 Unclassified 1199
268 Ga0207647_10674500 3300025904 Unclassified 565
269 Ga0207699_10433006 3300025906 Bacteria 941
270 Ga0207645_10048066 3300025907 Bacteria 2724
271 Ga0207645_10193942 3300025907 Bacteria 1335
272 Ga0207643_10008187 3300025908 Bacteria 5612
273 Ga0207705_10105891 3300025909 Bacteria 2073
274 Ga0207705_10719275 3300025909 Bacteria 776
275 Ga0207707_10052987 3300025912 Bacteria 3531
276 Ga0207707_10221836 3300025912 Bacteria 1645
277 Ga0207707_10302611 3300025912 Bacteria 1383
278 Ga0207695_11054179 3300025913 Bacteria 693
279 Ga0207693_10421973 3300025915 Unclassified 1043
280 Ga0207663_10060632 3300025916 Bacteria 2398
281 Ga0207660_10014459 3300025917 Bacteria 5192
282 Ga0207660_10582418 3300025917 Bacteria 911
283 Ga0207660_10787496 3300025917 Unclassified 776
284 Ga0207662_10029921 3300025918 Bacteria 3158
285 Ga0207662_10539580 3300025918 Bacteria 807
286 Ga0207657_10202019 3300025919 Bacteria 1598
287 Ga0207657_10390524 3300025919 Bacteria 1095
288 Ga0207652_10020027 3300025921 Bacteria 5509
289 Ga0207652_10120133 3300025921 Bacteria 2337
290 Ga0207652_10710859 3300025921 Unclassified 896
291 Ga0207681_10047593 3300025923 Bacteria 2890
292 Ga0207681_10116324 3300025923 Unclassified 1953
293 Ga0207681_10229098 3300025923 Bacteria 1441
294 Ga0207681_10230012 3300025923 Bacteria 1439
295 Ga0207681_10332064 3300025923 Bacteria 1212
296 Ga0207681_11391569 3300025923 Bacteria 589
297 Ga0207650_10021955 3300025925 Bacteria 4516
298 Ga0207650_10149413 3300025925 Bacteria 1843
299 Ga0207650_10446851 3300025925 Bacteria 1075
300 Ga0207659_10011626 3300025926 Bacteria 5569
301 Ga0207659_10415225 3300025926 Bacteria 1128
302 Ga0207659_10808469 3300025926 Bacteria 805
303 Ga0207659_11135206 3300025926 Bacteria 672
304 Ga0207700_10996986 3300025928 Unclassified 750
305 Ga0207644_10337651 3300025931 Unclassified 1221
306 Ga0207644_10602001 3300025931 Unclassified 913
307 Ga0207644_11580914 3300025931 Unclassified 550
308 Ga0207706_10002739 3300025933 Bacteria 17125
309 Ga0207706_10015720 3300025933 Bacteria 6840
310 Ga0207706_10172696 3300025933 Bacteria 1899
311 Ga0207706_10245888 3300025933 Bacteria 1563
312 Ga0207706_10558181 3300025933 Bacteria 985
313 Ga0207686_10006213 3300025934 Bacteria 6424
314 Ga0207709_10181077 3300025935 Unclassified 1488
315 Ga0207709_10632736 3300025935 Unclassified 850
316 Ga0207670_10151758 3300025936 Bacteria 1720
317 Ga0207669_10046372 3300025937 Bacteria 2568
318 Ga0207704_10039631 3300025938 Bacteria 2745
319 Ga0207704_10286093 3300025938 Bacteria 1255
320 Ga0207691_10012012 3300025940 Bacteria 8306
321 Ga0207691_10012294 3300025940 Bacteria 8205
322 Ga0207691_10018324 3300025940 Bacteria 6632
323 Ga0207691_10048075 3300025940 Bacteria 3912
324 Ga0207691_10112084 3300025940 Bacteria 2425
325 Ga0207691_10636614 3300025940 Bacteria 901
326 Ga0207691_11217423 3300025940 Bacteria 624
327 Ga0207711_10655631 3300025941 Unclassified 979
328 Ga0207711_11335734 3300025941 Bacteria 659
329 Ga0207661_10125877 3300025944 Bacteria 2188
330 Ga0207661_10307591 3300025944 Bacteria 1422
331 Ga0207661_10465319 3300025944 Bacteria 1153
332 Ga0207661_10475564 3300025944 Bacteria 1140
333 Ga0207661_10669919 3300025944 Unclassified 954
334 Ga0207661_10958988 3300025944 Bacteria 788
335 Ga0207661_11024676 3300025944 Bacteria 760
336 Ga0207679_10007283 3300025945 Bacteria 7011
337 Ga0207679_10047614 3300025945 Bacteria 3116
338 Ga0207679_10074566 3300025945 Bacteria 2571
339 Ga0207679_10381648 3300025945 Bacteria 1236
340 Ga0207667_10058177 3300025949 Bacteria 4056
341 Ga0207651_10356226 3300025960 Bacteria 1234
342 Ga0207651_10990364 3300025960 Bacteria 751
343 Ga0207651_11678102 3300025960 Bacteria 572
344 Ga0207712_10003339 3300025961 Bacteria 10165
345 Ga0207712_10180477 3300025961 Unclassified 1658
346 Ga0207712_11372214 3300025961 Bacteria 632
347 Ga0207712_11773347 3300025961 Bacteria 553
348 Ga0207668_10238502 3300025972 Bacteria 1470
349 Ga0207668_10367908 3300025972 Unclassified 1206
350 Ga0207668_10790521 3300025972 Unclassified 839
351 Ga0207668_11287978 3300025972 Bacteria 658
352 Ga0207668_11526770 3300025972 Bacteria 603
353 Ga0207640_10252063 3300025981 Unclassified 1371
354 Ga0207640_10573880 3300025981 Unclassified 951
355 Ga0207658_10274754 3300025986 Bacteria 1442
356 Ga0207658_10687969 3300025986 Unclassified 924
357 Ga0207677_11257933 3300026023 Bacteria 679
358 Ga0207677_12124878 3300026023 Bacteria 522
359 Ga0207703_11226202 3300026035 Unclassified 721
360 Ga0207639_10002216 3300026041 Bacteria 13089
361 Ga0207639_10168191 3300026041 Bacteria 1854
362 Ga0207678_10008984 3300026067 Bacteria 8795
363 Ga0207678_10383521 3300026067 Bacteria 1215
364 Ga0207708_10083375 3300026075 Unclassified 2457
365 Ga0207708_10123088 3300026075 Bacteria 2022
366 Ga0207708_10225468 3300026075 Bacteria 1503
367 Ga0207708_11034515 3300026075 Unclassified 714
368 Ga0207641_11029751 3300026088 Bacteria 821
369 Ga0207648_10040491 3300026089 Bacteria 4094
370 Ga0207648_10285268 3300026089 Bacteria 1477
371 Ga0207648_10657656 3300026089 Unclassified 969
372 Ga0207676_10308175 3300026095 Unclassified 1448
373 Ga0207676_11864870 3300026095 Unclassified 600
374 Ga0207674_10000768 3300026116 Bacteria 41933
375 Ga0207674_10019584 3300026116 Bacteria 7328
376 Ga0207675_100026584 3300026118 Bacteria 5388
377 Ga0207675_100048854 3300026118 Bacteria 3949
378 Ga0207675_100321801 3300026118 Bacteria 1510
379 Ga0207675_101266789 3300026118 Bacteria 758
380 Ga0207683_11119994 3300026121 Bacteria 730
381 Ga0207698_10225165 3300026142 Unclassified 1698
382 Ga0207698_11613274 3300026142 Unclassified 664
383 Ga0207698_12467490 3300026142 Unclassified 530
384 Ga0209813_10123395 3300027866 Bacteria 904
385 Ga0209974_10060742 3300027876 Unclassified 1279
386 Ga0207428_10713238 3300027907 Bacteria 717
387 Ga0268266_10229510 3300028379 Bacteria 1709
388 Ga0268266_10419065 3300028379 Bacteria 1269
389 Ga0268265_10001676 3300028380 Bacteria 18075
390 Ga0268265_10712672 3300028380 Unclassified 970
391 Ga0268264_10062101 3300028381 Bacteria 3136
392 Ga0268264_10160999 3300028381 Bacteria 2022
393 Ga0268264_10799489 3300028381 Bacteria 942
394 Ga0265324_10005274 3300029957 Bacteria 5619
395 Ga0265330_10307033 3300031235 Bacteria 669
396 Ga0265332_10262386 3300031238 Unclassified 714
397 Ga0265328_10000731 3300031239 Bacteria 15223
398 Ga0265328_10017036 3300031239 Bacteria 2819
399 Ga0265320_10001365 3300031240 Bacteria 17784
400 Ga0265320_10025627 3300031240 Bacteria 3098
401 Ga0265329_10024630 3300031242 Bacteria 1996
402 Ga0265340_10170112 3300031247 Bacteria 987
403 Ga0265339_10133035 3300031249 Unclassified 1270
404 Ga0265331_10000260 3300031250 Bacteria 60870
405 Ga0265331_10184512 3300031250 Bacteria 942
406 Ga0265316_10448970 3300031344 Bacteria 925
407 Ga0307408_100009714 3300031548 Bacteria 6340
408 Ga0307408_100029552 3300031548 Bacteria 3798
409 Ga0307408_100601697 3300031548 Bacteria 977
410 Ga0307408_100650458 3300031548 Bacteria 942
411 Ga0316575_10520538 3300031665 Unclassified 517
412 Ga0316579_10026758 3300031691 Bacteria 2614
413 Ga0316579_10090171 3300031691 Unclassified 1464
414 Ga0316579_10240435 3300031691 Unclassified 876
415 Ga0316579_10559809 3300031691 Unclassified 553
416 Ga0265314_10001347 3300031711 Bacteria 27747
417 Ga0265314_10003352 3300031711 Bacteria 15591
418 Ga0265342_10000522 3300031712 Bacteria 40887
419 Ga0265342_10009407 3300031712 Bacteria 6894
420 Ga0316576_10004729 3300031727 Bacteria 8220
421 Ga0316576_10005367 3300031727 Bacteria 7817
422 Ga0316576_10029153 3300031727 Bacteria 3898
423 Ga0316576_10076718 3300031727 Bacteria 2473
424 Ga0316576_10702348 3300031727 Bacteria 733
425 Ga0316578_10075480 3300031728 Bacteria 2000
426 Ga0316578_10107445 3300031728 Unclassified 1675
427 Ga0316578_10252433 3300031728 Unclassified 1058
428 Ga0307405_10000136 3300031731 Bacteria 28495
429 Ga0307405_10333957 3300031731 Bacteria 1163
430 Ga0316577_10007270 3300031733 Bacteria 5905
431 Ga0316577_10618365 3300031733 Unclassified 616
432 Ga0316577_10753424 3300031733 Unclassified 553
433 Ga0307413_10457238 3300031824 Bacteria 1015
434 Ga0307413_10938094 3300031824 Unclassified 738
435 Ga0307413_10941642 3300031824 Bacteria 736
436 Ga0307410_10000242 3300031852 Bacteria 20597
437 Ga0307410_10065908 3300031852 Bacteria 2493
438 Ga0307410_10193760 3300031852 Bacteria 1547
439 Ga0307410_10444518 3300031852 Bacteria 1056
440 Ga0307410_10483813 3300031852 Unclassified 1016
441 Ga0307410_10509387 3300031852 Bacteria 991
442 Ga0307410_10990168 3300031852 Bacteria 724
443 Ga0307406_10000861 3300031901 Bacteria 17085
444 Ga0307406_10004129 3300031901 Bacteria 7905
445 Ga0307406_10575857 3300031901 Unclassified 925
446 Ga0307406_11800954 3300031901 Bacteria 544
447 Ga0307407_10014521 3300031903 Bacteria 3860
448 Ga0307407_10186234 3300031903 Bacteria 1380
449 Ga0307407_10426291 3300031903 Bacteria 957
450 Ga0307412_10022681 3300031911 Bacteria 3853
451 Ga0307412_10223590 3300031911 Bacteria 1445
452 Ga0307412_10305321 3300031911 Bacteria 1260
453 Ga0307412_11000217 3300031911 Archaea 739
454 Ga0307409_100006425 3300031995 Bacteria 6906
455 Ga0307409_100164208 3300031995 Bacteria 1946
456 Ga0307409_100203170 3300031995 Bacteria 1775
457 Ga0307409_100605596 3300031995 Bacteria 1083
458 Ga0307409_100872506 3300031995 Unclassified 912
459 Ga0307409_100911194 3300031995 Unclassified 893
460 Ga0307409_100983518 3300031995 Bacteria 861
461 Ga0307416_100063113 3300032002 Bacteria 3032
462 Ga0307416_100227506 3300032002 Bacteria 1795
463 Ga0307416_100599475 3300032002 Bacteria 1181
464 Ga0307416_100876138 3300032002 Unclassified 997
465 Ga0307414_10170308 3300032004 Bacteria 1740
466 Ga0307414_10228113 3300032004 Bacteria 1534
467 Ga0307414_10389884 3300032004 Archaea 1207
468 Ga0307414_10692188 3300032004 Bacteria 922
469 Ga0307411_10000133 3300032005 Bacteria 23452
470 Ga0307411_10459627 3300032005 Unclassified 1067
471 Ga0307411_10795873 3300032005 Bacteria 832
472 Ga0307411_10939243 3300032005 Bacteria 771
473 Ga0307415_100000504 3300032126 Bacteria 16964
474 Ga0307415_100906681 3300032126 Bacteria 813
475 Ga0307415_101180093 3300032126 Bacteria 720
476 Ga0316593_10012642 3300032168 Bacteria 2481
477 Ga0316593_10017945 3300032168 Bacteria 2166
478 Ga0316593_10034903 3300032168 Bacteria 1652
479 Ga0316593_10174755 3300032168 Bacteria 788
480 Ga0316592_1116791 3300033524 Unclassified 618
481 Ga0316596_1048188 3300033541 Unclassified 1126
482 Ga0373951_0023711 3300035091 Unclassified 1418
483 Ga0373953_0117717 3300035117 Unclassified 1127
484 Ga0373954_0031390 3300035118 Bacteria 2453
485 Ga0373956_0076650 3300035119 Bacteria 1530
486 Ga0316574_0027455 3300035398 Bacteria 3430
487 Ga0316574_0027782 3300035398 Bacteria 3409
488 Ga0316574_0339412 3300035398 Unclassified 952
489 Ga0373933_0008844 3300035724 Bacteria 5490
490 Ga0373933_0023512 3300035724 Bacteria 3521
491 Ga0373937_0002240 3300036401 Bacteria 16157
492 Ga0373937_0301640 3300036401 Bacteria 1514
493 Ga0316584_0007185 3300036712 Bacteria 7593
494 Ga0316584_0012452 3300036712 Bacteria 5999
495 Ga0316584_0022818 3300036712 Unclassified 4567
496 Ga0316584_0166803 3300036712 Unclassified 1635
497 Ga0316584_0323591 3300036712 Unclassified 1112
498 Ga0316584_0481674 3300036712 Unclassified 874
499 Ga0316584_0778652 3300036712 Unclassified 651
500 Ga0316584_0833468 3300036712 Bacteria 625
501 Ga0395900_0706092 3300037418 Unclassified 942
502 Ga0395905_0375108 3300037471 Bacteria 1316
503 Ga0400483_013467 3300039062 Bacteria 1287
504 Ga0400489_08506 3300039093 Bacteria 1247
505 Ga0436365_0583175 3300039437 Bacteria 5406
506 Ga0451802_0461600 3300041460 Bacteria 2159
507 Ga0439443_085889 3300042003 Bacteria 589
508 Ga0450923_132918 3300042125 Unclassified 593
509 Ga0450896_033414 3300042133 Unclassified 785
510 Ga0450896_099422 3300042133 Unclassified 502
511 Ga0450906_008376 3300042145 Bacteria 2003
512 Ga0439459_0205690 3300042438 Unclassified 539
513 Ga0451577_0000005 3300042876 Bacteria 712599
514 Ga0451577_0467452 3300042876 Unclassified 1145
515 Ga0451577_0677853 3300042876 Unclassified 934
516 Ga0453684_0026370 3300044712 Bacteria 8399
517 Ga0453684_0052871 3300044712 Bacteria 5307
518 Ga0453684_0220339 3300044712 Unclassified 2198
519 Ga0453684_0756679 3300044712 Unclassified 1051
520 Ga0453684_0847434 3300044712 Bacteria 982
521 Ga0453684_1315805 3300044712 Bacteria 753
522 Ga0451576_0050284 3300045051 Bacteria 4371
523 Ga0451576_0244741 3300045051 Unclassified 1874
524 Ga0451576_1291562 3300045051 Bacteria 761
525 Ga0495638_0285293 3300046460 Unclassified 895
526 Ga0495651_0631876 3300046462 Bacteria 673
527 Ga0495580_0079047 3300046472 Bacteria 2294
528 Ga0495665_0189508 3300046531 Bacteria 1067
529 Ga0495667_0063235 3300046559 Bacteria 2423
530 Ga0495667_0084139 3300046559 Bacteria 2066
531 Ga0495635_0764138 3300046663 Unclassified 624
532 Ga0495647_0587929 3300046681 Unclassified 522
533 Ga0495669_0226234 3300046684 Unclassified 897
534 Ga0495613_0157938 3300046689 Bacteria 1615
535 Ga0495670_0202763 3300046691 Unclassified 1051
536 Ga0495600_0336077 3300046809 Bacteria 948
537 Ga0495600_0853320 3300046809 Bacteria 540
538 Ga0495581_0735038 3300047315 Bacteria 568
539 Ga0495604_0038929 3300047317 Bacteria 3739
540 Ga0495636_0000750 3300047318 Bacteria 11940
541 Ga0495636_0100018 3300047318 Unclassified 1267
542 Ga0495674_0804349 3300047319 Bacteria 731
543 Ga0495680_0811561 3300047322 Bacteria 610
544 Ga0495675_0083086 3300047444 Bacteria 2016
545 Ga0495615_0050065 3300048090 Bacteria 1072
546 Ga0496100_0371677 3300048903 Bacteria 1084
547 Ga0496101_1151964 3300048904 Unclassified 608
548 Ga0496104_0984041 3300048907 Bacteria 748
549 Ga0496108_0074530 3300048911 Bacteria 2866
550 Ga0496109_0072439 3300048912 Bacteria 3165
551 Ga0496109_1882016 3300048912 Bacteria 531
552 Ga0496110_0979867 3300048913 Bacteria 753
553 Ga0496113_1519501 3300048916 Bacteria 517
554 Ga0496125_0191105 3300048928 Bacteria 1352
555 Ga0501290_019653 3300049513 Bacteria 918
556 Ga0501292_106213 3300049515 Bacteria 561
557 Ga0501032_0137760 3300049569 Bacteria 1608
558 Ga0501034_0202068 3300049571 Bacteria 1945
559 Ga0501034_0783531 3300049571 Unclassified 847
560 Ga0501067_0398277 3300049583 Bacteria 768
561 Ga0501073_0084749 3300049589 Bacteria 2205
562 Ga0501217_010285 3300049661 Bacteria 2046
563 Ga0501247_004583 3300049677 Bacteria 1516
564 Ga0501225_0130460 3300049705 Unclassified 753
565 Ga0501276_033784 3300049773 Bacteria 545
566 Ga0501279_082221 3300049775 Bacteria 557
567 nmdc:mga0k408_343629_c1 3300050493 Bacteria 890
568 nmdc:mga04h51_470445_c1 3300050495 Bacteria 534
569 nmdc:mga07m45_471300_c1 3300050496 Unclassified 728
570 nmdc:mga05p37_195297_c1 3300050507 Bacteria 2454
571 nmdc:mga05p37_208957_c1 3300050507 Bacteria 2360
572 nmdc:mga09592_102865_c1 3300050508 Bacteria 2447
573 nmdc:mga09592_22167_c1 3300050508 Bacteria 5241
574 nmdc:mga09592_411751_c1 3300050508 Bacteria 1168
575 nmdc:mga0qj67_203344_c1 3300050509 Unclassified 1609
576 nmdc:mga0qj67_27754_c1 3300050509 Bacteria 4390
577 nmdc:mga0qj67_33069_c1 3300050509 Bacteria 4035
578 nmdc:mga0qj67_5808_c1 3300050509 Bacteria 9030
579 nmdc:mga0qj67_6381_c1 3300050509 Bacteria 8663
580 nmdc:mga06r32_1085631_c1 3300050510 Unclassified 750
581 nmdc:mga06r32_1181100_c1 3300050510 Bacteria 712
582 nmdc:mga06r32_241974_c1 3300050510 Bacteria 1792
583 nmdc:mga06r32_33291_c1 3300050510 Bacteria 4854
584 nmdc:mga06r32_338719_c1 3300050510 Unclassified 1489
585 nmdc:mga06r32_3882_c1 3300050510 Bacteria 13384
586 nmdc:mga06r32_40405_c1 3300050510 Unclassified 4428
587 nmdc:mga06r32_424574_c1 3300050510 Bacteria 1310
588 nmdc:mga06r32_80040_c1 3300050510 Bacteria 3179
589 nmdc:mga08y16_249332_c1 3300050511 Bacteria 1835
590 nmdc:mga08y16_34120_c1 3300050511 Bacteria 5345
591 nmdc:mga08y16_66484_c1 3300050511 Bacteria 3762
592 nmdc:mga0n895_11032_c1 3300050512 Bacteria 8034
593 nmdc:mga0n895_372045_c1 3300050512 Bacteria 1446
594 nmdc:mga0n895_5211_c1 3300050512 Bacteria 10824
595 nmdc:mga0rr50_308372_c1 3300050513 Bacteria 1325
596 nmdc:mga0rr50_588618_c1 3300050513 Bacteria 948
597 nmdc:mga0a205_166078_c1 3300050515 Bacteria 2103
598 nmdc:mga0a205_16686_c1 3300050515 Bacteria 6878
599 Ga0495601_0298507 3300053077 Bacteria 1050
600 Ga0500562_003420 3300053108 Unclassified 3973
601 Ga0500655_136164 3300053133 Bacteria 526
602 Ga0500604_0007804 3300053151 Bacteria 2836
603 Ga0500622_0000015 3300053156 Bacteria 346227
604 Ga0500622_0000022 3300053156 Bacteria 267246
605 Ga0500627_0215982 3300053158 Unclassified 857
606 Ga0590071_029588 3300059421 Unclassified 1302
607 Ga0307416_103746545
608 rootH2_10292872
609 rootL2_10074260
610 rootH1_10251148
611 Ga0065712_10771314
612 Ga0065715_10572832
613 Ga0065715_11180901
614 Ga0065707_10072404
615 Ga0070658_10188636
616 Ga0070658_10475561
617 Ga0070658_11070963
618 Ga0070658_11482348
619 Ga0070676_10571860
620 Ga0070676_10674642
621 Ga0070676_10695671
622 Ga0070683_100007411
623 Ga0070683_100013075
624 Ga0070683_100217453
625 Ga0070683_100559787
626 Ga0070683_100686074
627 Ga0070683_100986474
628 Ga0070683_100993324
629 Ga0070690_100503012
630 Ga0070670_100082189
631 Ga0070670_100299806
632 Ga0070670_101092804
633 Ga0070670_101597590
634 Ga0068869_100883708
635 Ga0068869_101375319
636 Ga0070666_11136126
637 Ga0070680_100007703
638 Ga0070680_100722727
639 Ga0070680_100867684
640 Ga0070682_101008853
641 Ga0068868_100620240
642 Ga0068868_101087051
643 Ga0068868_101220510
644 Ga0070660_100464398
645 Ga0070689_100013514
646 Ga0070691_10401215
647 Ga0070691_11066618
648 Ga0070661_100000731
649 Ga0070692_10008651
650 Ga0070692_10136343
651 Ga0070692_10708994
652 Ga0070668_100012928
653 Ga0070668_100026784
654 Ga0070668_100031211
655 Ga0070669_100000789
656 Ga0070669_100131466
657 Ga0070669_100151216
658 Ga0070669_100303253
659 Ga0070669_100362852
660 Ga0070675_100260509
661 Ga0070675_100483431
662 Ga0070675_101054637
663 Ga0070675_101816007
664 Ga0070671_100060271
665 Ga0070671_101225213
666 Ga0070674_100093742
667 Ga0070674_100100221
668 Ga0070674_100197507
669 Ga0070674_100280618
670 Ga0070673_100216362
671 Ga0070673_100601657
672 Ga0070673_100863867
673 Ga0070673_100955030
674 Ga0070673_101732134
675 Ga0070673_102313536
676 Ga0070688_100135393
677 Ga0070659_100048102
678 Ga0070659_100511031
679 Ga0070659_101131387
680 Ga0070667_100379697
681 Ga0070667_100445500
682 Ga0070667_100531278
683 Ga0070667_100799721
684 Ga0070703_10517484
685 Ga0070709_10165021
686 Ga0070709_10597427
687 Ga0070714_100238725
688 Ga0070701_11346752
689 Ga0070711_100047720
690 Ga0070711_101298162
691 Ga0070705_101515561
692 Ga0070700_100046453
693 Ga0070700_100171156
694 Ga0070700_100542890
695 Ga0070694_100130976
696 Ga0070663_100029438
697 Ga0070663_101350837
698 Ga0070678_101020757
699 Ga0070662_100033839
700 Ga0070662_100118250
701 Ga0070662_100173157
702 Ga0070662_100276015
703 Ga0070662_100334408
704 Ga0070662_100573555
705 Ga0070662_100910775
706 Ga0070662_101903750
707 Ga0070681_10004395
708 Ga0070681_10041447
709 Ga0070681_10068438
710 Ga0070681_11048312
711 Ga0068867_100067113
712 Ga0068867_100864784
713 Ga0070685_10900360
714 Ga0070706_101874507
715 Ga0070707_101133672
716 Ga0070707_102097866
717 Ga0070698_100186061
718 Ga0070679_100014713
719 Ga0070679_100067877
720 Ga0070679_100203233
721 Ga0070679_100237247
722 Ga0070679_100757961
723 Ga0070684_100001494
724 Ga0070684_100110356
725 Ga0070684_100139609
726 Ga0070684_100397708
727 Ga0070684_101345952
728 Ga0068853_100008804
729 Ga0070672_100022529
730 Ga0070672_100035476
731 Ga0070672_100066539
732 Ga0070672_100229945
733 Ga0070672_100263490
734 Ga0070672_101406550
735 Ga0070672_101527623
736 Ga0070696_100925865
737 Ga0070693_101512394
738 Ga0070665_100011325
739 Ga0070665_101649141
740 Ga0070704_100163772
741 Ga0070704_100394661
742 Ga0070704_101522947
743 Ga0068855_100481484
744 Ga0068855_100960374
745 Ga0070664_100025723
746 Ga0070664_100097859
747 Ga0070664_100112805
748 Ga0070664_100398063
749 Ga0068857_100118696
750 Ga0068854_100136057
751 Ga0068854_100281119
752 Ga0068852_100148278
753 Ga0068852_100268104
754 Ga0068852_100431413
755 Ga0068852_100924658
756 Ga0068859_100530634
757 Ga0068864_100089746
758 Ga0068864_100093951
759 Ga0068866_10138221
760 Ga0068861_100004971
761 Ga0068861_100006078
762 Ga0068861_100612384
763 Ga0068861_101020580
764 Ga0068851_10065015
765 Ga0068851_10176317
766 Ga0068870_10005432
767 Ga0068863_100700772
768 Ga0068863_101076288
769 Ga0068858_100810396
770 Ga0068860_100132210
771 Ga0068860_100321274
772 Ga0068860_100515851
773 Ga0068862_100001053
774 Ga0068862_100255348
775 Ga0070717_10124335
776 Ga0070717_10242468
777 Ga0075368_10175929
778 Ga0075364_10786606
779 Ga0070712_100460928
780 Ga0075367_10015424
781 Ga0075366_10084683
782 Ga0075366_10226305
783 Ga0075370_10633230
784 Ga0068871_101485877
785 Ga0075428_100014735
786 Ga0075428_100587154
787 Ga0075428_101011399
788 Ga0075430_100001058
789 Ga0075430_100004042
790 Ga0075430_100027099
791 Ga0075430_100050865
792 Ga0075430_100236351
793 Ga0075431_100015377
794 Ga0075431_100018606
795 Ga0075431_100105102
796 Ga0075431_100117256
797 Ga0075431_100338421
798 Ga0075431_100375381
799 Ga0075431_100405948
800 Ga0075431_100494321
801 Ga0075431_100597695
802 Ga0075431_100985782
803 Ga0075433_10077052
804 Ga0075433_10110053
805 Ga0075433_10759670
806 Ga0075434_100005366
807 Ga0075434_100376721
808 Ga0075429_100088727
809 Ga0075429_100218640
810 Ga0075429_100360645
811 Ga0075429_101620135
812 Ga0068865_100010287
813 Ga0068865_100055486
814 Ga0097620_100530541
815 Ga0075435_100234282
816 Ga0075435_100469506
817 Ga0105250_10485297
818 Ga0105240_10961665
819 Ga0105240_11584942
820 Ga0111539_10016737
821 Ga0111539_10065157
822 Ga0111539_10466893
823 Ga0111539_11024999
824 Ga0105245_10146783
825 Ga0105245_11083163
826 Ga0105247_10376766
827 Ga0114129_10142241
828 Ga0114129_10205540
829 Ga0114129_11181351
830 Ga0105243_10209312
831 Ga0105243_10332328
832 Ga0105243_11887938
833 Ga0105242_10081608
834 Ga0105242_10252787
835 Ga0105248_10141956
836 Ga0105248_10219204
837 Ga0105248_10474159
838 Ga0105238_10623210
839 Ga0105238_11672881
840 Ga0105249_10002760
841 Ga0105249_10048458
842 Ga0105249_11079584
843 Ga0105249_11700231
844 Ga0105249_12286217
845 Ga0105249_12417455
846 Ga0105249_13081464
847 Ga0105239_10156016
848 Ga0157371_10560734
849 Ga0157374_10637501
850 Ga0157378_11383191
851 Ga0163162_10156665
852 Ga0157372_10598030
853 Ga0157372_11880026
854 Ga0157372_12876667
855 Ga0157375_10069899
856 Ga0157375_10283776
857 Ga0157375_10507728
858 Ga0157375_12272141
859 Ga0163163_10190635
860 Ga0163163_11439538
861 Ga0163163_12233221
862 Ga0157380_10003185
863 Ga0157380_10648226
864 Ga0157380_11408105
865 Ga0157379_10441923
866 Ga0157379_11200263
867 Ga0157376_10837947
868 Ga0157376_11576434
869 Ga0157376_12442420
870 Ga0163161_10027348
871 Ga0213876_10011380
872 Ga0207653_10264880
873 Ga0207647_10187619
874 Ga0207647_10674500
875 Ga0207699_10433006
876 Ga0207645_10048066
877 Ga0207645_10193942
878 Ga0207643_10008187
879 Ga0207705_10105891
880 Ga0207705_10719275
881 Ga0207707_10052987
882 Ga0207707_10221836
883 Ga0207707_10302611
884 Ga0207695_11054179
885 Ga0207693_10421973
886 Ga0207663_10060632
887 Ga0207660_10014459
888 Ga0207660_10582418
889 Ga0207660_10787496
890 Ga0207662_10029921
891 Ga0207662_10539580
892 Ga0207657_10202019
893 Ga0207657_10390524
894 Ga0207652_10020027
895 Ga0207652_10120133
896 Ga0207652_10710859
897 Ga0207681_10047593
898 Ga0207681_10116324
899 Ga0207681_10229098
900 Ga0207681_10230012
901 Ga0207681_10332064
902 Ga0207681_11391569
903 Ga0207650_10021955
904 Ga0207650_10149413
905 Ga0207650_10446851
906 Ga0207659_10011626
907 Ga0207659_10415225
908 Ga0207659_10808469
909 Ga0207659_11135206
910 Ga0207700_10996986
911 Ga0207644_10337651
912 Ga0207644_10602001
913 Ga0207644_11580914
914 Ga0207706_10002739
915 Ga0207706_10015720
916 Ga0207706_10172696
917 Ga0207706_10245888
918 Ga0207706_10558181
919 Ga0207686_10006213
920 Ga0207709_10181077
921 Ga0207709_10632736
922 Ga0207670_10151758
923 Ga0207669_10046372
924 Ga0207704_10039631
925 Ga0207704_10286093
926 Ga0207691_10012012
927 Ga0207691_10012294
928 Ga0207691_10018324
929 Ga0207691_10048075
930 Ga0207691_10112084
931 Ga0207691_10636614
932 Ga0207691_11217423
933 Ga0207711_10655631
934 Ga0207711_11335734
935 Ga0207661_10125877
936 Ga0207661_10307591
937 Ga0207661_10465319
938 Ga0207661_10475564
939 Ga0207661_10669919
940 Ga0207661_10958988
941 Ga0207661_11024676
942 Ga0207679_10007283
943 Ga0207679_10047614
944 Ga0207679_10074566
945 Ga0207679_10381648
946 Ga0207667_10058177
947 Ga0207651_10356226
948 Ga0207651_10990364
949 Ga0207651_11678102
950 Ga0207712_10003339
951 Ga0207712_10180477
952 Ga0207712_11372214
953 Ga0207712_11773347
954 Ga0207668_10238502
955 Ga0207668_10367908
956 Ga0207668_10790521
957 Ga0207668_11287978
958 Ga0207668_11526770
959 Ga0207640_10252063
960 Ga0207640_10573880
961 Ga0207658_10274754
962 Ga0207658_10687969
963 Ga0207677_11257933
964 Ga0207677_12124878
965 Ga0207703_11226202
966 Ga0207639_10002216
967 Ga0207639_10168191
968 Ga0207678_10008984
969 Ga0207678_10383521
970 Ga0207708_10083375
971 Ga0207708_10123088
972 Ga0207708_10225468
973 Ga0207708_11034515
974 Ga0207641_11029751
975 Ga0207648_10040491
976 Ga0207648_10285268
977 Ga0207648_10657656
978 Ga0207676_10308175
979 Ga0207676_11864870
980 Ga0207674_10000768
981 Ga0207674_10019584
982 Ga0207675_100026584
983 Ga0207675_100048854
984 Ga0207675_100321801
985 Ga0207675_101266789
986 Ga0207683_11119994
987 Ga0207698_10225165
988 Ga0207698_11613274
989 Ga0207698_12467490
990 Ga0209813_10123395
991 Ga0209974_10060742
992 Ga0207428_10713238
993 Ga0268266_10229510
994 Ga0268266_10419065
995 Ga0268265_10001676
996 Ga0268265_10712672
997 Ga0268264_10062101
998 Ga0268264_10160999
999 Ga0268264_10799489
1000 Ga0265324_10005274
1001 Ga0265330_10307033
1002 Ga0265332_10262386
1003 Ga0265328_10000731
1004 Ga0265328_10017036
1005 Ga0265320_10001365
1006 Ga0265320_10025627
1007 Ga0265329_10024630
1008 Ga0265340_10170112
1009 Ga0265339_10133035
1010 Ga0265331_10000260
1011 Ga0265331_10184512
1012 Ga0265316_10448970
1013 Ga0307408_100009714
1014 Ga0307408_100029552
1015 Ga0307408_100601697
1016 Ga0307408_100650458
1017 Ga0316575_10520538
1018 Ga0316579_10026758
1019 Ga0316579_10090171
1020 Ga0316579_10240435
1021 Ga0316579_10559809
1022 Ga0265314_10001347
1023 Ga0265314_10003352
1024 Ga0265342_10000522
1025 Ga0265342_10009407
1026 Ga0316576_10004729
1027 Ga0316576_10005367
1028 Ga0316576_10029153
1029 Ga0316576_10076718
1030 Ga0316576_10702348
1031 Ga0316578_10075480
1032 Ga0316578_10107445
1033 Ga0316578_10252433
1034 Ga0307405_10000136
1035 Ga0307405_10333957
1036 Ga0316577_10007270
1037 Ga0316577_10618365
1038 Ga0316577_10753424
1039 Ga0307413_10457238
1040 Ga0307413_10938094
1041 Ga0307413_10941642
1042 Ga0307410_10000242
1043 Ga0307410_10065908
1044 Ga0307410_10193760
1045 Ga0307410_10444518
1046 Ga0307410_10483813
1047 Ga0307410_10509387
1048 Ga0307410_10990168
1049 Ga0307406_10000861
1050 Ga0307406_10004129
1051 Ga0307406_10575857
1052 Ga0307406_11800954
1053 Ga0307407_10014521
1054 Ga0307407_10186234
1055 Ga0307407_10426291
1056 Ga0307412_10022681
1057 Ga0307412_10223590
1058 Ga0307412_10305321
1059 Ga0307412_11000217
1060 Ga0307409_100006425
1061 Ga0307409_100164208
1062 Ga0307409_100203170
1063 Ga0307409_100605596
1064 Ga0307409_100872506
1065 Ga0307409_100911194
1066 Ga0307409_100983518
1067 Ga0307416_100063113
1068 Ga0307416_100227506
1069 Ga0307416_100599475
1070 Ga0307416_100876138
1071 Ga0307414_10170308
1072 Ga0307414_10228113
1073 Ga0307414_10389884
1074 Ga0307414_10692188
1075 Ga0307411_10000133
1076 Ga0307411_10459627
1077 Ga0307411_10795873
1078 Ga0307411_10939243
1079 Ga0307415_100000504
1080 Ga0307415_100906681
1081 Ga0307415_101180093
1082 Ga0316593_10012642
1083 Ga0316593_10017945
1084 Ga0316593_10034903
1085 Ga0316593_10174755
1086 Ga0316592_1116791
1087 Ga0316596_1048188
1088 Ga0373951_0023711
1089 Ga0373953_0117717
1090 Ga0373954_0031390
1091 Ga0373956_0076650
1092 Ga0316574_0027455
1093 Ga0316574_0027782
1094 Ga0316574_0339412
1095 Ga0373933_0008844
1096 Ga0373933_0023512
1097 Ga0373937_0002240
1098 Ga0373937_0301640
1099 Ga0316584_0007185
1100 Ga0316584_0012452
1101 Ga0316584_0022818
1102 Ga0316584_0166803
1103 Ga0316584_0323591
1104 Ga0316584_0481674
1105 Ga0316584_0778652
1106 Ga0316584_0833468
1107 Ga0395900_0706092
1108 Ga0395905_0375108
1109 Ga0400483_013467
1110 Ga0400489_08506
1111 Ga0436365_0583175
1112 Ga0451802_0461600
1113 Ga0439443_085889
1114 Ga0450923_132918
1115 Ga0450896_033414
1116 Ga0450896_099422
1117 Ga0450906_008376
1118 Ga0439459_0205690
1119 Ga0451577_0000005
1120 Ga0451577_0467452
1121 Ga0451577_0677853
1122 Ga0453684_0026370
1123 Ga0453684_0052871
1124 Ga0453684_0220339
1125 Ga0453684_0756679
1126 Ga0453684_0847434
1127 Ga0453684_1315805
1128 Ga0451576_0050284
1129 Ga0451576_0244741
1130 Ga0451576_1291562
1131 Ga0495638_0285293
1132 Ga0495651_0631876
1133 Ga0495580_0079047
1134 Ga0495665_0189508
1135 Ga0495667_0063235
1136 Ga0495667_0084139
1137 Ga0495635_0764138
1138 Ga0495647_0587929
1139 Ga0495669_0226234
1140 Ga0495613_0157938
1141 Ga0495670_0202763
1142 Ga0495600_0336077
1143 Ga0495600_0853320
1144 Ga0495581_0735038
1145 Ga0495604_0038929
1146 Ga0495636_0000750
1147 Ga0495636_0100018
1148 Ga0495674_0804349
1149 Ga0495680_0811561
1150 Ga0495675_0083086
1151 Ga0495615_0050065
1152 Ga0496100_0371677
1153 Ga0496101_1151964
1154 Ga0496104_0984041
1155 Ga0496108_0074530
1156 Ga0496109_0072439
1157 Ga0496109_1882016
1158 Ga0496110_0979867
1159 Ga0496113_1519501
1160 Ga0496125_0191105
1161 Ga0501290_019653
1162 Ga0501292_106213
1163 Ga0501032_0137760
1164 Ga0501034_0202068
1165 Ga0501034_0783531
1166 Ga0501067_0398277
1167 Ga0501073_0084749
1168 Ga0501217_010285
1169 Ga0501247_004583
1170 Ga0501225_0130460
1171 Ga0501276_033784
1172 Ga0501279_082221
1173 nmdc:mga0k408_343629_c1
1174 nmdc:mga04h51_470445_c1
1175 nmdc:mga07m45_471300_c1
1176 nmdc:mga05p37_195297_c1
1177 nmdc:mga05p37_208957_c1
1178 nmdc:mga09592_102865_c1
1179 nmdc:mga09592_22167_c1
1180 nmdc:mga09592_411751_c1
1181 nmdc:mga0qj67_203344_c1
1182 nmdc:mga0qj67_27754_c1
1183 nmdc:mga0qj67_33069_c1
1184 nmdc:mga0qj67_5808_c1
1185 nmdc:mga0qj67_6381_c1
1186 nmdc:mga06r32_1085631_c1
1187 nmdc:mga06r32_1181100_c1
1188 nmdc:mga06r32_241974_c1
1189 nmdc:mga06r32_33291_c1
1190 nmdc:mga06r32_338719_c1
1191 nmdc:mga06r32_3882_c1
1192 nmdc:mga06r32_40405_c1
1193 nmdc:mga06r32_424574_c1
1194 nmdc:mga06r32_80040_c1
1195 nmdc:mga08y16_249332_c1
1196 nmdc:mga08y16_34120_c1
1197 nmdc:mga08y16_66484_c1
1198 nmdc:mga0n895_11032_c1
1199 nmdc:mga0n895_372045_c1
1200 nmdc:mga0n895_5211_c1
1201 nmdc:mga0rr50_308372_c1
1202 nmdc:mga0rr50_588618_c1
1203 nmdc:mga0a205_166078_c1
1204 nmdc:mga0a205_16686_c1
1205 Ga0495601_0298507
1206 Ga0500562_003420
1207 Ga0500655_136164
1208 Ga0500604_0007804
1209 Ga0500622_0000015
1210 Ga0500622_0000022
1211 Ga0500627_0215982
1212 Ga0590071_029588

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03992

ABM

Antibiotic biosynthesis monooxygenase

15

91

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2omo-assembly2.cif.gz_C putative antibiotic biosynthesis monooxygenase from nitrosomonas europaea 0.9874 2 96
2omo-assembly4.cif.gz_E putative antibiotic biosynthesis monooxygenase from nitrosomonas europaea 0.9848 1 95
3qmq-assembly2.cif.gz_B crystal structure of e. coli lsrg 0.9764 2 96
2omo-assembly4.cif.gz_E putative antibiotic biosynthesis monooxygenase from nitrosomonas europaea 0.9746 1 95
2gff-assembly1.cif.gz_A crystal structure of yersinia pestis lsrg 0.9695 1 97
ID Description Score Start End Superfamily
2omoE00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9794 3 95 3.30.70.100
3qmqB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9764 2 96 3.30.70.100
af_Q55CR9_1_97_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.975 2 94 3.30.70.100
2omoE00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9585 3 95 3.30.70.100
af_A3KQL1_329_418_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9581 4 93 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A7X8US31-F1-model_v4 Antibiotic biosynthesis monooxygenase 1.006 1 89 GO:0004497
GO:0005829
AF-A0A7S2PST2-F1-model_v4 ABM domain-containing protein 0.9994 2 96 GO:0005829
GO:0016491
AF-A0A4U1JBZ0-F1-model_v4 ABM domain-containing protein 0.9991 2 96 GO:0005829
GO:0016491
AF-A0A7S1TKK7-F1-model_v4 ABM domain-containing protein 0.9989 2 91 GO:0005829
GO:0016491
AF-A0A831UCJ1-F1-model_v4 7-cyano-7-deazaguanine synthase (EC 6.3.4.20) (7-cyano-7-carbaguanine synthase) (PreQ(0) synthase) (Queuosine biosynthesis protein QueC) 0.9986 2 101 GO:0005524
GO:0008270
GO:0008616
GO:0016879

Map