F468611

General Info

Members Datasets Scaffolds Average Seq Length
606 378 1212 254

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_0214475|Ga0436365_0214475_229_1119
Length 296
Sequence MSHTRWSRIRQEIEWFRHSVRRAVAGSIAPEDRGSPDVRQKEIQLADNKIAIVTGGSRGIGRSTVLALAKRGVRSIFTFHSNRTEAGAVIALAKEAGAPATALQLDTGNIASFAAFAGDVRTALRSMGAERFDYLVNNAGTSSNASLETITEAEMDALYNVHFKGVLFLTQKLVPLMNDGGRIVNVSSGLARFTSPGRIAYGSIKAGVETLTRYMAMELGPRRITANVIAPGAIATDFSGGMVRDNPHVNKMIAERTALGRVGLPDDVGPAIAALLSDELGWVNAQRIEVSGGIHI

Samples

Sample ID Description Type Environment
1 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
6 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
14 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
15 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
16 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
17 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
18 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
19 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
20 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
21 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
22 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
23 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
24 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
25 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
26 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
27 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
28 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
29 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
30 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
31 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
32 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
33 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
34 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
35 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
36 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
37 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
38 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
39 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
40 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
41 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
44 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
45 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
81 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
102 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
103 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
106 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
107 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
108 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
110 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
111 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
113 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
114 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
117 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
118 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
119 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
121 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
123 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
124 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
125 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
168 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
173 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
174 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
175 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
176 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
177 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
178 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
179 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
180 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
181 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
182 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
183 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
184 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
185 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
186 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
187 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
188 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
189 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
190 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
191 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
192 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
193 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
194 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
195 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
196 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
197 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
198 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
199 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
200 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
201 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
202 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
203 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
204 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
205 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
206 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
207 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
208 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
209 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
210 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
211 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
212 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
213 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
214 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
215 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
216 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
217 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
218 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
219 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
220 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
221 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
222 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
223 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
224 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
225 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
226 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
227 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
228 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
229 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
230 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
231 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
232 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
233 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
234 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
235 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
236 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
237 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
238 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
239 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
240 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
241 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
242 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
243 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
244 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
245 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
246 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
247 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
248 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
249 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
250 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
251 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
252 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
253 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
254 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
255 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
256 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
257 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
258 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
259 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
260 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
261 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
262 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
263 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
264 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
265 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
266 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
267 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
268 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
269 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
270 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
271 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
272 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
273 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
274 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
275 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
276 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
277 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
278 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
279 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
280 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
281 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
282 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
283 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
284 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
285 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
286 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
287 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
288 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
289 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
290 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
291 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
292 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
299 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
300 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
301 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
302 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
303 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
306 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
307 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
308 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
309 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
310 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
311 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
312 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
313 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
314 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
315 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
316 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
317 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
318 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
319 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
320 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
321 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
322 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
323 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
324 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
325 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
326 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
327 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
328 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
329 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
330 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
331 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
332 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
333 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
334 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
335 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
336 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
337 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
338 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
339 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
340 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
341 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
342 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
343 2734482264 Dyella sp. AD052 Isolate Unclassified
344 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
345 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
346 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
347 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
348 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
349 2738543009 Luteibacter sp. OK325 Isolate Unclassified
350 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
351 2739367700 Dyella sp. YR388 Isolate Unclassified
352 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
353 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
354 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
355 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
356 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
357 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
358 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
359 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
360 2855730933 Achromobacter sp. HZ28 Isolate Nodule
361 2855767633 Achromobacter sp. HZ34 Isolate Nodule
362 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
363 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
364 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
365 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
366 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
367 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
368 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
369 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
370 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
371 2941471342 Luteibacter sp. 621 Isolate Unclassified
372 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
373 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
374 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
375 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
376 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
377 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
378 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.76
Metatranscriptomes 0
Isolates 9.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.73
Nodule 1.16
Rhizoplane 1.49
Rhizosphere 72.94
Stem 0
Stem Tuber 0
Unclassified 0.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436365_0214475 3300039437 Bacteria 1271
2 JGI24740J21852_10000693 3300001979 Bacteria 14599
3 JGI24739J22299_10001046 3300001989 Bacteria 10272
4 JGI24738J21930_10000691 3300002075 Bacteria 9709
5 JGI25152J39213_1003013 3300002773 Bacteria 5955
6 JGI25152J39213_1004554 3300002773 Bacteria 4328
7 JGI25159J45721_1003111 3300002987 Bacteria 5988
8 JGI25151J46595_10033277 3300003187 Bacteria 1987
9 JGI25153J46596_10003507 3300003215 Bacteria 8755
10 JGI25153J46596_10010019 3300003215 Bacteria 4328
11 rootH1_10035169 3300003316 Bacteria 59849
12 rootH2_10038272 3300003320 Bacteria 20840
13 rootH2_10169690 3300003320 Bacteria 1355
14 rootL2_10009353 3300003322 Bacteria 5999
15 rootL2_10046952 3300003322 Bacteria 10020
16 rootH1_10012599 3300003323 Bacteria 111210
17 rootH1_10074328 3300003323 Bacteria 3186
18 JGI25160J50197_1026237 3300003354 Bacteria 1611
19 JGI25161J50226_1000121 3300003374 Bacteria 56946
20 Ga0055539_1005125 3300003752 Bacteria 1713
21 Ga0055526_1001233 3300003771 Bacteria 18375
22 Ga0055526_1001525 3300003771 Bacteria 16383
23 Ga0055537_1000027 3300003773 Bacteria 102244
24 Ga0055537_1000451 3300003773 Bacteria 26082
25 Ga0055524_1002341 3300003775 Bacteria 9852
26 Ga0055524_1007749 3300003775 Bacteria 4529
27 Ga0055534_1000019 3300003784 Bacteria 137920
28 Ga0055528_1000048 3300003790 Bacteria 95179
29 Ga0055528_1006534 3300003790 Bacteria 5281
30 Ga0058692_1004357 3300003856 Bacteria 4207
31 Ga0058692_1013222 3300003856 Bacteria 1929
32 Ga0055543_1000176 3300004625 Bacteria 53419
33 Ga0065165_1005757 3300005262 Bacteria 6800
34 Ga0065714_10134458 3300005288 Bacteria 1221
35 Ga0065712_10074544 3300005290 Bacteria 4069
36 Ga0065715_10097412 3300005293 Bacteria 3709
37 Ga0070676_10094966 3300005328 Bacteria 1833
38 Ga0070676_10188620 3300005328 Bacteria 1345
39 Ga0070690_100001305 3300005330 Bacteria 12949
40 Ga0070670_100000133 3300005331 Bacteria 69691
41 Ga0070670_100021796 3300005331 Bacteria 5510
42 Ga0068869_100005387 3300005334 Bacteria 8039
43 Ga0070666_10001004 3300005335 Bacteria 17255
44 Ga0070666_10007647 3300005335 Bacteria 6671
45 Ga0070666_10131368 3300005335 Bacteria 1740
46 Ga0068868_100126369 3300005338 Bacteria 2089
47 Ga0070689_100003506 3300005340 Bacteria 10433
48 Ga0070691_10040529 3300005341 Bacteria 2201
49 Ga0070687_100002238 3300005343 Bacteria 7175
50 Ga0070661_100125675 3300005344 Bacteria 1924
51 Ga0070661_100425268 3300005344 Bacteria 1053
52 Ga0070668_100023659 3300005347 Bacteria 4649
53 Ga0070669_100008171 3300005353 Bacteria 7473
54 Ga0070675_100000236 3300005354 Bacteria 35636
55 Ga0070671_100029861 3300005355 Bacteria 4497
56 Ga0070673_100018756 3300005364 Bacteria 4953
57 Ga0070673_100645355 3300005364 Bacteria 968
58 Ga0070667_100052891 3300005367 Bacteria 3427
59 Ga0070667_100217479 3300005367 Bacteria 1700
60 Ga0070705_100014853 3300005440 Bacteria 4016
61 Ga0070694_100041879 3300005444 Bacteria 3057
62 Ga0070708_100051939 3300005445 Bacteria 3633
63 Ga0070708_100068795 3300005445 Bacteria 3183
64 Ga0070708_100504256 3300005445 Bacteria 1142
65 Ga0070662_100000839 3300005457 Bacteria 18896
66 Ga0070681_10060774 3300005458 Bacteria 3755
67 Ga0070681_10309551 3300005458 Bacteria 1489
68 Ga0068867_100003350 3300005459 Bacteria 11286
69 Ga0068867_100329663 3300005459 Bacteria 1267
70 Ga0070706_100155852 3300005467 Bacteria 2132
71 Ga0070699_100343507 3300005518 Bacteria 1343
72 Ga0070684_100036141 3300005535 Bacteria 4232
73 Ga0068853_100064952 3300005539 Bacteria 3166
74 Ga0068853_100122745 3300005539 Bacteria 2319
75 Ga0068853_100260813 3300005539 Bacteria 1593
76 Ga0070672_100068583 3300005543 Bacteria 2813
77 Ga0070686_100002094 3300005544 Bacteria 11005
78 Ga0070665_100073478 3300005548 Bacteria 3425
79 Ga0070665_100116078 3300005548 Bacteria 2680
80 Ga0070665_100382258 3300005548 Bacteria 1415
81 Ga0070704_100068113 3300005549 Bacteria 2573
82 Ga0068855_100289722 3300005563 Bacteria 1815
83 Ga0068855_100424344 3300005563 Bacteria 1454
84 Ga0070664_100003665 3300005564 Bacteria 12371
85 Ga0068857_100114768 3300005577 Bacteria 2422
86 Ga0068857_100137039 3300005577 Unclassified 2210
87 Ga0068857_100617898 3300005577 Bacteria 1025
88 Ga0068856_100005379 3300005614 Bacteria 12620
89 Ga0068856_100260019 3300005614 Unclassified 1751
90 Ga0070702_100017244 3300005615 Bacteria 3722
91 Ga0068852_100018063 3300005616 Bacteria 5549
92 Ga0068852_100571719 3300005616 Bacteria 1132
93 Ga0068852_100647654 3300005616 Bacteria 1064
94 Ga0068859_100003877 3300005617 Bacteria 15277
95 Ga0068864_100009414 3300005618 Bacteria 8059
96 Ga0068864_100354347 3300005618 Bacteria 1385
97 Ga0068864_100937957 3300005618 Bacteria 856
98 Ga0068861_100010322 3300005719 Bacteria 6479
99 Ga0068870_10017259 3300005840 Bacteria 3465
100 Ga0068863_100013640 3300005841 Bacteria 7839
101 Ga0068858_100043347 3300005842 Bacteria 4172
102 Ga0068860_100102174 3300005843 Bacteria 2735
103 Ga0068862_100000384 3300005844 Bacteria 47655
104 Ga0068862_100000566 3300005844 Bacteria 38602
105 Ga0070717_10330736 3300006028 Bacteria 1359
106 Ga0075366_10054707 3300006195 Bacteria 2370
107 Ga0097621_100071486 3300006237 Bacteria 2867
108 Ga0097621_100343219 3300006237 Bacteria 1326
109 Ga0068871_100155150 3300006358 Bacteria 1955
110 Ga0075430_100054834 3300006846 Bacteria 3353
111 Ga0075431_100138666 3300006847 Bacteria 2507
112 Ga0075431_100517429 3300006847 Bacteria 1183
113 Ga0075429_100014751 3300006880 Bacteria 6772
114 Ga0068865_100331420 3300006881 Bacteria 1227
115 Ga0068865_100567742 3300006881 Bacteria 955
116 Ga0097620_100003879 3300006931 Bacteria 15277
117 Ga0079104_1000036 3300006946 Bacteria 194741
118 Ga0105251_10133278 3300009011 Bacteria 1126
119 Ga0105240_10000723 3300009093 Bacteria 60353
120 Ga0105240_10320154 3300009093 Bacteria 1768
121 Ga0105240_10851404 3300009093 Bacteria 984
122 Ga0105245_10001203 3300009098 Bacteria 23428
123 Ga0105245_10181788 3300009098 Bacteria 2010
124 Ga0105245_10384965 3300009098 Bacteria 1398
125 Ga0114129_10177291 3300009147 Bacteria 2902
126 Ga0105241_10000516 3300009174 Bacteria 29076
127 Ga0105248_10006352 3300009177 Bacteria 12965
128 Ga0105248_10076098 3300009177 Bacteria 3772
129 Ga0105237_10001366 3300009545 Bacteria 32234
130 Ga0105237_10004109 3300009545 Bacteria 16975
131 Ga0105237_10067444 3300009545 Bacteria 3571
132 Ga0105237_10330439 3300009545 Bacteria 1529
133 Ga0105238_10000678 3300009551 Bacteria 35832
134 Ga0105238_10031362 3300009551 Bacteria 5410
135 Ga0105238_10132092 3300009551 Bacteria 2475
136 Ga0105249_10005262 3300009553 Bacteria 11170
137 Ga0105249_10343094 3300009553 Bacteria 1511
138 Ga0105249_10607599 3300009553 Bacteria 1149
139 Ga0105239_10050687 3300010375 Bacteria 4552
140 Ga0105239_10405333 3300010375 Bacteria 1543
141 Ga0105246_10094436 3300011119 Bacteria 2163
142 Ga0157371_10038484 3300013102 Bacteria 3421
143 Ga0157369_10001160 3300013105 Bacteria 32867
144 Ga0157369_10004776 3300013105 Bacteria 15927
145 Ga0163162_10165638 3300013306 Bacteria 2334
146 Ga0163162_10636805 3300013306 Bacteria 1191
147 Ga0157372_10000358 3300013307 Bacteria 50206
148 Ga0157372_10007957 3300013307 Bacteria 11270
149 Ga0163163_10230991 3300014325 Bacteria 1899
150 Ga0157380_10434523 3300014326 Bacteria 1256
151 Ga0182008_10009391 3300014497 Bacteria 5281
152 Ga0182008_10012070 3300014497 Bacteria 4570
153 Ga0157377_10022903 3300014745 Bacteria 3304
154 Ga0157376_10003459 3300014969 Bacteria 10880
155 Ga0182006_1000005 3300015261 Bacteria 621201
156 Ga0182006_1000355 3300015261 Bacteria 38520
157 Ga0182007_10059316 3300015262 Bacteria 1255
158 Ga0183361_10007 3300016635 Bacteria 339575
159 Ga0163161_10532936 3300017792 Bacteria 960
160 Ga0213872_10000013 3300021361 Bacteria 182866
161 Ga0213872_10000282 3300021361 Bacteria 43374
162 Ga0213872_10135481 3300021361 Bacteria 1083
163 Ga0213876_10008842 3300021384 Bacteria 5435
164 Ga0209436_100002 3300025208 Bacteria 222172
165 Ga0209672_100695 3300025228 Bacteria 16861
166 Ga0207427_104033 3300025231 Bacteria 2674
167 Ga0209646_1003510 3300025246 Bacteria 3079
168 Ga0209677_104977 3300025253 Bacteria 3618
169 Ga0209129_1000019 3300025258 Bacteria 460802
170 Ga0209129_1001405 3300025258 Bacteria 13470
171 Ga0209129_1001452 3300025258 Bacteria 13222
172 Ga0209129_1003522 3300025258 Bacteria 6760
173 Ga0209233_1000437 3300025261 Bacteria 29382
174 Ga0209565_1000017 3300025263 Bacteria 462438
175 Ga0209455_1003981 3300025272 Bacteria 5010
176 Ga0209673_1000007 3300025273 Bacteria 634477
177 Ga0209673_1004206 3300025273 Bacteria 7855
178 Ga0209130_1000015 3300025284 Bacteria 409631
179 Ga0209675_1000009 3300025291 Bacteria 562872
180 Ga0209676_1000812 3300025292 Bacteria 40825
181 Ga0209025_1000648 3300025294 Bacteria 60937
182 Ga0209025_1013340 3300025294 Bacteria 5176
183 Ga0209564_1000021 3300025295 Bacteria 571316
184 Ga0209564_1000036 3300025295 Bacteria 423455
185 Ga0209564_1001407 3300025295 Bacteria 24859
186 Ga0209564_1001647 3300025295 Bacteria 21535
187 Ga0209758_1000148 3300025297 Bacteria 166232
188 Ga0209758_1000467 3300025297 Bacteria 66705
189 Ga0209758_1006875 3300025297 Bacteria 7952
190 Ga0209758_1048283 3300025297 Bacteria 1514
191 Ga0209758_1062474 3300025297 Bacteria 1219
192 Ga0209256_1000091 3300025299 Bacteria 210945
193 Ga0209256_1003221 3300025299 Bacteria 11777
194 Ga0207426_1000122 3300025302 Bacteria 218307
195 Ga0207426_1023152 3300025302 Bacteria 2123
196 Ga0209051_1012790 3300025303 Bacteria 4038
197 Ga0207680_10093320 3300025903 Bacteria 1920
198 Ga0207680_10123434 3300025903 Bacteria 1697
199 Ga0207647_10000006 3300025904 Bacteria 214791
200 Ga0207647_10011418 3300025904 Bacteria 6231
201 Ga0207645_10266012 3300025907 Bacteria 1136
202 Ga0207643_10019027 3300025908 Bacteria 3762
203 Ga0207684_10501209 3300025910 Bacteria 1041
204 Ga0207654_10003830 3300025911 Bacteria 7584
205 Ga0207695_10000648 3300025913 Bacteria 69088
206 Ga0207671_10000215 3300025914 Bacteria 87204
207 Ga0207671_10187050 3300025914 Bacteria 1614
208 Ga0207660_10434875 3300025917 Bacteria 1060
209 Ga0207662_10003084 3300025918 Bacteria 8503
210 Ga0207657_10056538 3300025919 Bacteria 3385
211 Ga0207649_10153606 3300025920 Bacteria 1588
212 Ga0207649_10202374 3300025920 Bacteria 1403
213 Ga0207652_10188736 3300025921 Bacteria 1853
214 Ga0207652_10372521 3300025921 Bacteria 1289
215 Ga0207681_10004231 3300025923 Bacteria 8863
216 Ga0207681_10179044 3300025923 Bacteria 1613
217 Ga0207694_10011304 3300025924 Bacteria 6739
218 Ga0207694_10036791 3300025924 Bacteria 3757
219 Ga0207650_10000532 3300025925 Bacteria 31166
220 Ga0207650_10064715 3300025925 Bacteria 2738
221 Ga0207644_10030880 3300025931 Bacteria 3730
222 Ga0207706_10004708 3300025933 Bacteria 12779
223 Ga0207670_10008905 3300025936 Bacteria 5691
224 Ga0207670_10044829 3300025936 Bacteria 2928
225 Ga0207704_10195441 3300025938 Bacteria 1475
226 Ga0207691_10015438 3300025940 Bacteria 7263
227 Ga0207711_10008386 3300025941 Bacteria 8647
228 Ga0207711_10051695 3300025941 Bacteria 3520
229 Ga0207711_10496385 3300025941 Bacteria 1137
230 Ga0207679_10006942 3300025945 Bacteria 7175
231 Ga0207667_10075582 3300025949 Bacteria 3497
232 Ga0207651_10034680 3300025960 Bacteria 3271
233 Ga0207712_10004437 3300025961 Bacteria 8864
234 Ga0207668_10179971 3300025972 Bacteria 1666
235 Ga0207640_10038382 3300025981 Bacteria 3022
236 Ga0207658_10639071 3300025986 Bacteria 958
237 Ga0207677_10033090 3300026023 Bacteria 3331
238 Ga0207677_10330704 3300026023 Bacteria 1270
239 Ga0207703_10137477 3300026035 Bacteria 2117
240 Ga0207639_10046499 3300026041 Bacteria 3275
241 Ga0207639_10050824 3300026041 Bacteria 3150
242 Ga0207639_10248750 3300026041 Bacteria 1549
243 Ga0207678_10000697 3300026067 Bacteria 30609
244 Ga0207678_10003997 3300026067 Bacteria 13264
245 Ga0207678_10090668 3300026067 Bacteria 2613
246 Ga0207678_10191745 3300026067 Bacteria 1747
247 Ga0207678_10436886 3300026067 Bacteria 1136
248 Ga0207678_10446561 3300026067 Bacteria 1124
249 Ga0207708_10028275 3300026075 Bacteria 4246
250 Ga0207702_10028255 3300026078 Bacteria 4661
251 Ga0207702_10219077 3300026078 Bacteria 1773
252 Ga0207641_10133031 3300026088 Bacteria 2235
253 Ga0207648_10009062 3300026089 Bacteria 9572
254 Ga0207676_10007647 3300026095 Bacteria 7670
255 Ga0207676_10803637 3300026095 Bacteria 918
256 Ga0207674_10382625 3300026116 Bacteria 1360
257 Ga0207675_100007722 3300026118 Bacteria 10151
258 Ga0207675_100084526 3300026118 Bacteria 2978
259 Ga0207698_10257126 3300026142 Bacteria 1602
260 Ga0209281_1000080 3300027111 Bacteria 261394
261 Ga0209371_1000029 3300027312 Bacteria 424797
262 Ga0209371_1017347 3300027312 Bacteria 1867
263 Ga0268266_10000255 3300028379 Bacteria 89930
264 Ga0268266_10007060 3300028379 Bacteria 10198
265 Ga0268266_10050832 3300028379 Bacteria 3557
266 Ga0268266_10079545 3300028379 Bacteria 2854
267 Ga0268265_10001478 3300028380 Bacteria 19705
268 Ga0268265_10001770 3300028380 Bacteria 17326
269 Ga0268265_10553976 3300028380 Bacteria 1092
270 Ga0268264_10026436 3300028381 Bacteria 4743
271 Ga0265338_10019103 3300028800 Bacteria 7293
272 Ga0265338_10167188 3300028800 Bacteria 1692
273 Ga0268256_1000032 3300030500 Bacteria 424603
274 Ga0268256_1015296 3300030500 Bacteria 2245
275 Ga0268256_1035958 3300030500 Bacteria 1146
276 Ga0265314_10095289 3300031711 Bacteria 1927
277 Ga0307516_10096376 3300031730 Bacteria 2779
278 Ga0307405_10253241 3300031731 Bacteria 1311
279 Ga0307410_10084328 3300031852 Bacteria 2240
280 Ga0307410_10454322 3300031852 Bacteria 1046
281 Ga0307406_10258351 3300031901 Bacteria 1316
282 Ga0307412_10000005 3300031911 Bacteria 526194
283 Ga0307412_10000954 3300031911 Bacteria 16544
284 Ga0307412_10135257 3300031911 Bacteria 1797
285 Ga0307416_100057652 3300032002 Bacteria 3144
286 Ga0307416_100471428 3300032002 Bacteria 1313
287 Ga0307414_10060547 3300032004 Bacteria 2678
288 Ga0307415_100014235 3300032126 Bacteria 4669
289 Ga0395898_0495080 3300037466 Bacteria 1163
290 Ga0395905_0015859 3300037471 Bacteria 7158
291 Ga0436364_1317855 3300037853 Bacteria 2249
292 Ga0395901_0120117 3300038443 Bacteria 2762
293 Ga0436365_0173869 3300039437 Bacteria 89108
294 Ga0436365_0423225 3300039437 Bacteria 1461
295 Ga0436361_0027396 3300039447 Bacteria 3390
296 Ga0436361_0347557 3300039447 Bacteria 3242
297 Ga0436361_0743645 3300039447 Bacteria 72606
298 Ga0436361_1136913 3300039447 Bacteria 10109
299 Ga0436362_0676981 3300039453 Unclassified 3270
300 Ga0439436_0000001 3300041404 Bacteria 299341
301 Ga0439465_0001647 3300041413 Bacteria 7281
302 Ga0439452_000012 3300042010 Bacteria 412478
303 Ga0466969_0073818 3300044656 Bacteria 1637
304 Ga0466972_0000464 3300044658 Bacteria 20631
305 Ga0466972_0004636 3300044658 Bacteria 6883
306 Ga0466972_0029329 3300044658 Bacteria 2708
307 Ga0466972_0099209 3300044658 Unclassified 1378
308 Ga0466982_0000002 3300044672 Bacteria 454900
309 Ga0466965_0028276 3300044683 Bacteria 2723
310 Ga0466966_0001538 3300044684 Bacteria 14786
311 Ga0466961_0013450 3300044693 Bacteria 5242
312 Ga0466964_0012746 3300044706 Bacteria 3183
313 Ga0466971_0016238 3300044719 Bacteria 3282
314 Ga0466970_0019714 3300044765 Bacteria 3498
315 Ga0466957_0522992 3300044842 Bacteria 824
316 Ga0466959_0145316 3300045049 Bacteria 1674
317 Ga0466967_0034275 3300045976 Bacteria 4308
318 Ga0495617_000183 3300046452 Bacteria 39626
319 Ga0495617_000639 3300046452 Bacteria 17588
320 Ga0495627_001483 3300046453 Bacteria 13607
321 Ga0495592_0032166 3300046454 Bacteria 3961
322 Ga0495592_0175335 3300046454 Bacteria 1465
323 Ga0495591_001076 3300046458 Bacteria 18246
324 Ga0495629_0016155 3300046459 Bacteria 5358
325 Ga0495629_0162786 3300046459 Bacteria 1549
326 Ga0495638_0000034 3300046460 Bacteria 282038
327 Ga0495653_0005525 3300046463 Bacteria 10301
328 Ga0495650_0000380 3300046471 Bacteria 76955
329 Ga0495650_0005291 3300046471 Bacteria 8445
330 Ga0495650_0020882 3300046471 Bacteria 3181
331 Ga0495650_0053886 3300046471 Bacteria 1644
332 Ga0495580_0056319 3300046472 Bacteria 2769
333 Ga0495582_0026924 3300046473 Bacteria 3150
334 Ga0495605_0006772 3300046474 Bacteria 6549
335 Ga0495605_0033803 3300046474 Bacteria 2593
336 Ga0495605_0071284 3300046474 Bacteria 1641
337 Ga0495584_0002094 3300046491 Bacteria 11446
338 Ga0495584_0006501 3300046491 Bacteria 6114
339 Ga0495585_0000001 3300046492 Bacteria 609804
340 Ga0495585_0005476 3300046492 Bacteria 7992
341 Ga0495596_0016626 3300046500 Bacteria 3053
342 Ga0495607_0000010 3300046501 Bacteria 206525
343 Ga0495607_0000705 3300046501 Bacteria 32214
344 Ga0495607_0016052 3300046501 Plasmid 4839
345 Ga0495607_0155965 3300046501 Bacteria 1164
346 Ga0495583_0009454 3300046506 Bacteria 5819
347 Ga0495583_0018706 3300046506 Bacteria 3640
348 Ga0495606_0000150 3300046507 Bacteria 119726
349 Ga0495606_0000154 3300046507 Bacteria 119458
350 Ga0495606_0000469 3300046507 Bacteria 66319
351 Ga0495606_0002690 3300046507 Bacteria 20099
352 Ga0495606_0002890 3300046507 Bacteria 18971
353 Ga0495606_0008309 3300046507 Bacteria 9050
354 Ga0495606_0015946 3300046507 Bacteria 5759
355 Ga0495606_0015951 3300046507 Bacteria 5758
356 Ga0495606_0021515 3300046507 Bacteria 4724
357 Ga0495608_0032316 3300046511 Bacteria 3537
358 Ga0495610_0000282 3300046512 Bacteria 53033
359 Ga0495610_0002694 3300046512 Bacteria 14641
360 Ga0495610_0005914 3300046512 Bacteria 8570
361 Ga0495610_0010266 3300046512 Bacteria 5835
362 Ga0495610_0013453 3300046512 Bacteria 4863
363 Ga0495616_0000001 3300046513 Bacteria 780061
364 Ga0495618_0011486 3300046514 Bacteria 5371
365 Ga0495620_0000560 3300046515 Bacteria 23435
366 Ga0495620_0000588 3300046515 Bacteria 22750
367 Ga0495628_0011306 3300046516 Bacteria 7552
368 Ga0495628_0355333 3300046516 Bacteria 1076
369 Ga0495631_0000137 3300046518 Bacteria 49790
370 Ga0495631_0000966 3300046518 Bacteria 17897
371 Ga0495632_0004331 3300046519 Bacteria 9675
372 Ga0495632_0015610 3300046519 Bacteria 4248
373 Ga0495632_0130635 3300046519 Bacteria 1169
374 Ga0495632_0259075 3300046519 Bacteria 778
375 Ga0495637_0008462 3300046520 Bacteria 5051
376 Ga0495643_0083449 3300046522 Bacteria 1659
377 Ga0495643_0182955 3300046522 Bacteria 1017
378 Ga0495644_0004261 3300046523 Bacteria 5616
379 Ga0495648_0000559 3300046524 Bacteria 39811
380 Ga0495648_0004596 3300046524 Bacteria 11758
381 Ga0495648_0006600 3300046524 Bacteria 9426
382 Ga0495648_0008950 3300046524 Bacteria 7824
383 Ga0495648_0202975 3300046524 Bacteria 991
384 Ga0495666_0009610 3300046526 Bacteria 4835
385 Ga0495666_0009868 3300046526 Bacteria 4768
386 Ga0495642_0007496 3300046528 Bacteria 4179
387 Ga0495652_0127306 3300046529 Bacteria 2021
388 Ga0495654_0000183 3300046530 Bacteria 61398
389 Ga0495654_0173092 3300046530 Bacteria 940
390 Ga0495665_0002980 3300046531 Bacteria 9154
391 Ga0495640_0028066 3300046533 Bacteria 4054
392 Ga0495586_0098338 3300046535 Bacteria 1622
393 Ga0495586_0396980 3300046535 Bacteria 794
394 Ga0495645_0004978 3300046543 Bacteria 9099
395 Ga0495645_0202228 3300046543 Bacteria 1346
396 Ga0495622_0001709 3300046557 Bacteria 10849
397 Ga0495622_0038416 3300046557 Bacteria 2229
398 Ga0495633_0086656 3300046558 Bacteria 1456
399 Ga0495668_0000018 3300046616 Bacteria 417480
400 Ga0495634_0073344 3300046642 Bacteria 2250
401 Ga0495611_0000001 3300046648 Bacteria 2628469
402 Ga0495611_0000429 3300046648 Bacteria 26013
403 Ga0495611_0048557 3300046648 Bacteria 1908
404 Ga0495625_0000001 3300046660 Bacteria 1641829
405 Ga0495625_0003381 3300046660 Bacteria 15986
406 Ga0495625_0003390 3300046660 Bacteria 15963
407 Ga0495625_0052089 3300046660 Bacteria 2932
408 Ga0495625_0102228 3300046660 Bacteria 1967
409 Ga0495625_0117404 3300046660 Bacteria 1814
410 Ga0495635_0080551 3300046663 Bacteria 2228
411 Ga0495661_0001957 3300046665 Bacteria 16346
412 Ga0495661_0034817 3300046665 Bacteria 3166
413 Ga0495588_0000172 3300046674 Bacteria 81934
414 Ga0495657_0082035 3300046675 Bacteria 2084
415 Ga0495623_0012497 3300046679 Bacteria 5493
416 Ga0495623_0095492 3300046679 Bacteria 1817
417 Ga0495646_0040353 3300046680 Bacteria 2875
418 Ga0495646_0146573 3300046680 Bacteria 1316
419 Ga0495613_0215509 3300046689 Bacteria 1349
420 Ga0495624_0000846 3300046690 Bacteria 24268
421 Ga0495624_0055747 3300046690 Bacteria 2488
422 Ga0495670_0005484 3300046691 Bacteria 6225
423 Ga0495670_0010389 3300046691 Bacteria 4573
424 Ga0495670_0053741 3300046691 Bacteria 2017
425 Ga0495671_0000480 3300046692 Bacteria 31034
426 Ga0495671_0023009 3300046692 Bacteria 3259
427 Ga0495649_0007006 3300046694 Bacteria 6952
428 Ga0495649_0177817 3300046694 Bacteria 1111
429 Ga0495589_0000016 3300046794 Bacteria 209027
430 Ga0495660_0000058 3300046810 Bacteria 133170
431 Ga0495660_0000116 3300046810 Bacteria 85798
432 Ga0495660_0003525 3300046810 Bacteria 9645
433 Ga0495581_0014841 3300047315 Bacteria 4518
434 Ga0495581_0038543 3300047315 Bacteria 2765
435 Ga0495604_0000321 3300047317 Bacteria 43022
436 Ga0495672_0000106 3300047320 Bacteria 132815
437 Ga0495680_0034473 3300047322 Bacteria 4086
438 Ga0495683_0001193 3300047323 Bacteria 17728
439 Ga0495683_0006054 3300047323 Bacteria 6638
440 Ga0495683_0036657 3300047323 Bacteria 2489
441 Ga0495687_000634 3300047443 Bacteria 40217
442 Ga0495687_006747 3300047443 Bacteria 6946
443 Ga0495687_022771 3300047443 Bacteria 3003
444 Ga0495675_0070437 3300047444 Bacteria 2207
445 Ga0495679_000001 3300047446 Bacteria 1607568
446 Ga0495673_0000001 3300047469 Bacteria 1630730
447 Ga0495673_0000229 3300047469 Bacteria 82319
448 Ga0495673_0000371 3300047469 Bacteria 53983
449 Ga0495681_0000118 3300047470 Bacteria 69538
450 Ga0495686_0000085 3300047472 Bacteria 198128
451 Ga0495686_0000115 3300047472 Bacteria 166876
452 Ga0495686_0000407 3300047472 Bacteria 68110
453 Ga0495686_0001689 3300047472 Bacteria 22933
454 Ga0495686_0002146 3300047472 Bacteria 19287
455 Ga0495686_0018004 3300047472 Bacteria 4750
456 Ga0495686_0018598 3300047472 Bacteria 4658
457 Ga0495686_0018953 3300047472 Bacteria 4605
458 Ga0495686_0201372 3300047472 Bacteria 1142
459 Ga0495602_0051575 3300048088 Bacteria 3662
460 Ga0495614_0047059 3300048089 Bacteria 1849
461 Ga0495626_0012426 3300048091 Bacteria 4464
462 Ga0495626_0036578 3300048091 Bacteria 2338
463 Ga0496106_0002982 3300048909 Bacteria 12606
464 Ga0496110_0344718 3300048913 Bacteria 1357
465 Ga0496111_0001880 3300048914 Bacteria 12413
466 Ga0496111_0138037 3300048914 Bacteria 1807
467 Ga0496112_0213875 3300048915 Bacteria 1885
468 Ga0496114_0649648 3300048917 Bacteria 928
469 Ga0496114_0744116 3300048917 Bacteria 857
470 Ga0496116_0042860 3300048919 Bacteria 3088
471 Ga0496116_0046319 3300048919 Bacteria 2935
472 Ga0496117_0002017 3300048920 Bacteria 26920
473 Ga0496117_0028424 3300048920 Bacteria 4330
474 Ga0496117_0043057 3300048920 Bacteria 3288
475 Ga0496117_0165213 3300048920 Bacteria 1291
476 Ga0496118_0001001 3300048921 Bacteria 44080
477 Ga0496118_0001737 3300048921 Bacteria 31652
478 Ga0496118_0006503 3300048921 Bacteria 12808
479 Ga0496118_0009257 3300048921 Bacteria 9992
480 Ga0496118_0027108 3300048921 Bacteria 4858
481 Ga0496118_0206475 3300048921 Bacteria 1157
482 Ga0496119_0000023 3300048922 Bacteria 259882
483 Ga0496119_0027600 3300048922 Bacteria 3897
484 Ga0496119_0056569 3300048922 Bacteria 2376
485 Ga0496120_0000578 3300048923 Bacteria 55746
486 Ga0496120_0026578 3300048923 Bacteria 3571
487 Ga0496121_0000129 3300048924 Bacteria 168148
488 Ga0496121_0000308 3300048924 Bacteria 101811
489 Ga0496121_0000905 3300048924 Bacteria 53422
490 Ga0496121_0001400 3300048924 Bacteria 40824
491 Ga0496121_0035264 3300048924 Bacteria 4487
492 Ga0496121_0132938 3300048924 Bacteria 1858
493 Ga0496121_0253953 3300048924 Bacteria 1217
494 Ga0496122_0006856 3300048925 Bacteria 12908
495 Ga0496122_0034164 3300048925 Bacteria 4167
496 Ga0496122_0113820 3300048925 Bacteria 1766
497 Ga0496122_0230818 3300048925 Bacteria 1052
498 Ga0496123_0004244 3300048926 Bacteria 15263
499 Ga0496123_0005671 3300048926 Bacteria 12463
500 Ga0496123_0023530 3300048926 Bacteria 4712
501 Ga0496123_0070752 3300048926 Bacteria 2181
502 Ga0496124_0000109 3300048927 Bacteria 166429
503 Ga0496124_0125030 3300048927 Bacteria 2050
504 Ga0496125_0006086 3300048928 Bacteria 13167
505 Ga0496125_0166138 3300048928 Bacteria 1491
506 Ga0496126_0002238 3300048929 Bacteria 26740
507 Ga0496126_0011136 3300048929 Bacteria 9338
508 Ga0496126_0023806 3300048929 Bacteria 5928
509 Ga0496126_0054809 3300048929 Bacteria 3609
510 Ga0496126_0358547 3300048929 Bacteria 1191
511 Ga0495678_000088 3300049459 Bacteria 115071
512 Ga0495678_000475 3300049459 Bacteria 39998
513 Ga0495682_0000033 3300049460 Bacteria 132733
514 Ga0495682_0000576 3300049460 Bacteria 24893
515 Ga0495682_0008745 3300049460 Bacteria 3982
516 Ga0501033_0096266 3300049570 Bacteria 2163
517 Ga0501037_0013831 3300049573 Bacteria 5947
518 Ga0501038_0120442 3300049574 Bacteria 2165
519 Ga0501039_0528511 3300049575 Bacteria 926
520 Ga0501046_0041425 3300049580 Bacteria 3675
521 Ga0501047_0134599 3300049581 Bacteria 2352
522 Ga0501068_0173853 3300049584 Bacteria 1360
523 Ga0501070_0090736 3300049586 Bacteria 2529
524 Ga0501070_0396602 3300049586 Bacteria 1116
525 Ga0501071_0022336 3300049587 Bacteria 4411
526 Ga0501075_0477084 3300049591 Bacteria 951
527 Ga0501080_0058675 3300049742 Bacteria 3582
528 Ga0501035_0069317 3300049822 Bacteria 3126
529 Ga0501044_0018799 3300049823 Bacteria 7403
530 Ga0501044_0450365 3300049823 Bacteria 1194
531 Ga0501045_0380560 3300049824 Bacteria 1051
532 nmdc:mga05p37_57566_c1 3300050507 Bacteria 4788
533 nmdc:mga09592_3952_c1 3300050508 Bacteria 11942
534 nmdc:mga0qj67_905_c1 3300050509 Bacteria 10950
535 nmdc:mga06r32_31454_c1 3300050510 Bacteria 4985
536 nmdc:mga08y16_17267_c1 3300050511 Bacteria 7597
537 nmdc:mga0n895_224768_c1 3300050512 Bacteria 1905
538 Ga0500578_0000042 3300053086 Bacteria 129410
539 Ga0500578_0048478 3300053086 Bacteria 2725
540 Ga0500643_000002 3300053087 Bacteria 1277657
541 Ga0500555_000288 3300053103 Bacteria 21733
542 Ga0500618_000111 3300053125 Bacteria 65821
543 Ga0500621_000013 3300053126 Bacteria 132878
544 Ga0500603_003350 3300053150 Bacteria 3445
545 Ga0500616_0011692 3300053153 Bacteria 5169
546 Ga0500622_0000335 3300053156 Bacteria 46130
547 Ga0500622_0045354 3300053156 Bacteria 2276
548 Ga0500633_0090956 3300053160 Bacteria 1114
549 Ga0500645_001386 3300053730 Bacteria 12362
550 Ga0466962_0004762 3300061719 Bacteria 6523
551 2501073807 2501025501 Bacteria 7768574
552 2501079074 2501025502 Bacteria 9641094
553 2501407645 2501025504 Bacteria 8008976
554 2509129968 2508501125 Bacteria 7208311
555 2511093473 2510917013 Bacteria 9951648
556 2511097517 2510917014 Bacteria 8296963
557 2511105536 2510917015 Bacteria 7950052
558 2511200463 2510917030 Bacteria 7460662
559 2511380850 2511231025 Bacteria 5324661
560 2511434721 2511231035 Bacteria 5341610
561 2516022515 2515154189 Bacteria 9629850
562 2585230599 2582581299 Bacteria 6518058
563 2599722802 2599185236 Bacteria 6875203
564 2600203605 2599185354 Bacteria 4398675
565 2600811525 2600255067 Bacteria 6795583
566 2617346373 2617270735 Bacteria 9163226
567 2644240922 2643221643 Bacteria 5749658
568 2676481017 2675903059 Bacteria 8644972
569 2721027315 2718218334 Bacteria 4765486
570 2723877233 2721755763 Bacteria 4464185
571 2735837095 2734482264 Unclassified 5014763
572 2738823320 2738541296 Bacteria 7285013
573 2738835578 2738541298 Bacteria 7286732
574 2738877241 2738541306 Bacteria 7284992
575 2739188947 2738543002 Bacteria 7284546
576 2739223834 2738543008 Bacteria 7282815
577 2739226551 2738543009 Bacteria 4944499
578 2739351467 2738543031 Bacteria 5769731
579 2739731840 2739367700 Bacteria 4747630
580 2808970880 2808606384 Bacteria 8474373
581 2809005711 2808606390 Bacteria 8476311
582 2809012532 2808606391 Bacteria 8308166
583 2819563230 2818991440 Bacteria 4774720
584 2819685230 2818991461 Bacteria 7026071
585 2824774635 2824773399 Bacteria 8360218
586 2842455101 2842454564 Bacteria 8730687
587 2842919347 2842918807 Bacteria 4289178
588 2855732325 2855730933 Bacteria 7047938
589 2855769033 2855767633 Bacteria 7049357
590 2857358049 2857357740 Bacteria 9937880
591 2881413179 2881412998 Bacteria 6492157
592 2883089841 2883087390 Bacteria 9532701
593 2884339975 2884338543 Bacteria 4610696
594 2891050352 2891048133 Bacteria 4447501
595 2904463850 2904463128 Bacteria 4775606
596 2919100913 2919100787 Bacteria 7710546
597 2935628497 2935625433 Bacteria 5042964
598 2939620811 2939617950 Bacteria 4820956
599 2941472260 2941471342 Bacteria 5018624
600 2945936076 2945934425 Bacteria 7444609
601 2953998195 2953994433 Bacteria 4303959
602 2974435996 2974435778 Bacteria 4876478
603 2990710020 2990703756 Bacteria 7715990
604 3005446513 3005445848 Bacteria 6906074
605 3005453231 3005452660 Bacteria 5889319
606 8019507232 8019504834 Bacteria 4819156
607 Ga0436365_0214475
608 JGI24740J21852_10000693
609 JGI24739J22299_10001046
610 JGI24738J21930_10000691
611 JGI25152J39213_1003013
612 JGI25152J39213_1004554
613 JGI25159J45721_1003111
614 JGI25151J46595_10033277
615 JGI25153J46596_10003507
616 JGI25153J46596_10010019
617 rootH1_10035169
618 rootH2_10038272
619 rootH2_10169690
620 rootL2_10009353
621 rootL2_10046952
622 rootH1_10012599
623 rootH1_10074328
624 JGI25160J50197_1026237
625 JGI25161J50226_1000121
626 Ga0055539_1005125
627 Ga0055526_1001233
628 Ga0055526_1001525
629 Ga0055537_1000027
630 Ga0055537_1000451
631 Ga0055524_1002341
632 Ga0055524_1007749
633 Ga0055534_1000019
634 Ga0055528_1000048
635 Ga0055528_1006534
636 Ga0058692_1004357
637 Ga0058692_1013222
638 Ga0055543_1000176
639 Ga0065165_1005757
640 Ga0065714_10134458
641 Ga0065712_10074544
642 Ga0065715_10097412
643 Ga0070676_10094966
644 Ga0070676_10188620
645 Ga0070690_100001305
646 Ga0070670_100000133
647 Ga0070670_100021796
648 Ga0068869_100005387
649 Ga0070666_10001004
650 Ga0070666_10007647
651 Ga0070666_10131368
652 Ga0068868_100126369
653 Ga0070689_100003506
654 Ga0070691_10040529
655 Ga0070687_100002238
656 Ga0070661_100125675
657 Ga0070661_100425268
658 Ga0070668_100023659
659 Ga0070669_100008171
660 Ga0070675_100000236
661 Ga0070671_100029861
662 Ga0070673_100018756
663 Ga0070673_100645355
664 Ga0070667_100052891
665 Ga0070667_100217479
666 Ga0070705_100014853
667 Ga0070694_100041879
668 Ga0070708_100051939
669 Ga0070708_100068795
670 Ga0070708_100504256
671 Ga0070662_100000839
672 Ga0070681_10060774
673 Ga0070681_10309551
674 Ga0068867_100003350
675 Ga0068867_100329663
676 Ga0070706_100155852
677 Ga0070699_100343507
678 Ga0070684_100036141
679 Ga0068853_100064952
680 Ga0068853_100122745
681 Ga0068853_100260813
682 Ga0070672_100068583
683 Ga0070686_100002094
684 Ga0070665_100073478
685 Ga0070665_100116078
686 Ga0070665_100382258
687 Ga0070704_100068113
688 Ga0068855_100289722
689 Ga0068855_100424344
690 Ga0070664_100003665
691 Ga0068857_100114768
692 Ga0068857_100137039
693 Ga0068857_100617898
694 Ga0068856_100005379
695 Ga0068856_100260019
696 Ga0070702_100017244
697 Ga0068852_100018063
698 Ga0068852_100571719
699 Ga0068852_100647654
700 Ga0068859_100003877
701 Ga0068864_100009414
702 Ga0068864_100354347
703 Ga0068864_100937957
704 Ga0068861_100010322
705 Ga0068870_10017259
706 Ga0068863_100013640
707 Ga0068858_100043347
708 Ga0068860_100102174
709 Ga0068862_100000384
710 Ga0068862_100000566
711 Ga0070717_10330736
712 Ga0075366_10054707
713 Ga0097621_100071486
714 Ga0097621_100343219
715 Ga0068871_100155150
716 Ga0075430_100054834
717 Ga0075431_100138666
718 Ga0075431_100517429
719 Ga0075429_100014751
720 Ga0068865_100331420
721 Ga0068865_100567742
722 Ga0097620_100003879
723 Ga0079104_1000036
724 Ga0105251_10133278
725 Ga0105240_10000723
726 Ga0105240_10320154
727 Ga0105240_10851404
728 Ga0105245_10001203
729 Ga0105245_10181788
730 Ga0105245_10384965
731 Ga0114129_10177291
732 Ga0105241_10000516
733 Ga0105248_10006352
734 Ga0105248_10076098
735 Ga0105237_10001366
736 Ga0105237_10004109
737 Ga0105237_10067444
738 Ga0105237_10330439
739 Ga0105238_10000678
740 Ga0105238_10031362
741 Ga0105238_10132092
742 Ga0105249_10005262
743 Ga0105249_10343094
744 Ga0105249_10607599
745 Ga0105239_10050687
746 Ga0105239_10405333
747 Ga0105246_10094436
748 Ga0157371_10038484
749 Ga0157369_10001160
750 Ga0157369_10004776
751 Ga0163162_10165638
752 Ga0163162_10636805
753 Ga0157372_10000358
754 Ga0157372_10007957
755 Ga0163163_10230991
756 Ga0157380_10434523
757 Ga0182008_10009391
758 Ga0182008_10012070
759 Ga0157377_10022903
760 Ga0157376_10003459
761 Ga0182006_1000005
762 Ga0182006_1000355
763 Ga0182007_10059316
764 Ga0183361_10007
765 Ga0163161_10532936
766 Ga0213872_10000013
767 Ga0213872_10000282
768 Ga0213872_10135481
769 Ga0213876_10008842
770 Ga0209436_100002
771 Ga0209672_100695
772 Ga0207427_104033
773 Ga0209646_1003510
774 Ga0209677_104977
775 Ga0209129_1000019
776 Ga0209129_1001405
777 Ga0209129_1001452
778 Ga0209129_1003522
779 Ga0209233_1000437
780 Ga0209565_1000017
781 Ga0209455_1003981
782 Ga0209673_1000007
783 Ga0209673_1004206
784 Ga0209130_1000015
785 Ga0209675_1000009
786 Ga0209676_1000812
787 Ga0209025_1000648
788 Ga0209025_1013340
789 Ga0209564_1000021
790 Ga0209564_1000036
791 Ga0209564_1001407
792 Ga0209564_1001647
793 Ga0209758_1000148
794 Ga0209758_1000467
795 Ga0209758_1006875
796 Ga0209758_1048283
797 Ga0209758_1062474
798 Ga0209256_1000091
799 Ga0209256_1003221
800 Ga0207426_1000122
801 Ga0207426_1023152
802 Ga0209051_1012790
803 Ga0207680_10093320
804 Ga0207680_10123434
805 Ga0207647_10000006
806 Ga0207647_10011418
807 Ga0207645_10266012
808 Ga0207643_10019027
809 Ga0207684_10501209
810 Ga0207654_10003830
811 Ga0207695_10000648
812 Ga0207671_10000215
813 Ga0207671_10187050
814 Ga0207660_10434875
815 Ga0207662_10003084
816 Ga0207657_10056538
817 Ga0207649_10153606
818 Ga0207649_10202374
819 Ga0207652_10188736
820 Ga0207652_10372521
821 Ga0207681_10004231
822 Ga0207681_10179044
823 Ga0207694_10011304
824 Ga0207694_10036791
825 Ga0207650_10000532
826 Ga0207650_10064715
827 Ga0207644_10030880
828 Ga0207706_10004708
829 Ga0207670_10008905
830 Ga0207670_10044829
831 Ga0207704_10195441
832 Ga0207691_10015438
833 Ga0207711_10008386
834 Ga0207711_10051695
835 Ga0207711_10496385
836 Ga0207679_10006942
837 Ga0207667_10075582
838 Ga0207651_10034680
839 Ga0207712_10004437
840 Ga0207668_10179971
841 Ga0207640_10038382
842 Ga0207658_10639071
843 Ga0207677_10033090
844 Ga0207677_10330704
845 Ga0207703_10137477
846 Ga0207639_10046499
847 Ga0207639_10050824
848 Ga0207639_10248750
849 Ga0207678_10000697
850 Ga0207678_10003997
851 Ga0207678_10090668
852 Ga0207678_10191745
853 Ga0207678_10436886
854 Ga0207678_10446561
855 Ga0207708_10028275
856 Ga0207702_10028255
857 Ga0207702_10219077
858 Ga0207641_10133031
859 Ga0207648_10009062
860 Ga0207676_10007647
861 Ga0207676_10803637
862 Ga0207674_10382625
863 Ga0207675_100007722
864 Ga0207675_100084526
865 Ga0207698_10257126
866 Ga0209281_1000080
867 Ga0209371_1000029
868 Ga0209371_1017347
869 Ga0268266_10000255
870 Ga0268266_10007060
871 Ga0268266_10050832
872 Ga0268266_10079545
873 Ga0268265_10001478
874 Ga0268265_10001770
875 Ga0268265_10553976
876 Ga0268264_10026436
877 Ga0265338_10019103
878 Ga0265338_10167188
879 Ga0268256_1000032
880 Ga0268256_1015296
881 Ga0268256_1035958
882 Ga0265314_10095289
883 Ga0307516_10096376
884 Ga0307405_10253241
885 Ga0307410_10084328
886 Ga0307410_10454322
887 Ga0307406_10258351
888 Ga0307412_10000005
889 Ga0307412_10000954
890 Ga0307412_10135257
891 Ga0307416_100057652
892 Ga0307416_100471428
893 Ga0307414_10060547
894 Ga0307415_100014235
895 Ga0395898_0495080
896 Ga0395905_0015859
897 Ga0436364_1317855
898 Ga0395901_0120117
899 Ga0436365_0173869
900 Ga0436365_0423225
901 Ga0436361_0027396
902 Ga0436361_0347557
903 Ga0436361_0743645
904 Ga0436361_1136913
905 Ga0436362_0676981
906 Ga0439436_0000001
907 Ga0439465_0001647
908 Ga0439452_000012
909 Ga0466969_0073818
910 Ga0466972_0000464
911 Ga0466972_0004636
912 Ga0466972_0029329
913 Ga0466972_0099209
914 Ga0466982_0000002
915 Ga0466965_0028276
916 Ga0466966_0001538
917 Ga0466961_0013450
918 Ga0466964_0012746
919 Ga0466971_0016238
920 Ga0466970_0019714
921 Ga0466957_0522992
922 Ga0466959_0145316
923 Ga0466967_0034275
924 Ga0495617_000183
925 Ga0495617_000639
926 Ga0495627_001483
927 Ga0495592_0032166
928 Ga0495592_0175335
929 Ga0495591_001076
930 Ga0495629_0016155
931 Ga0495629_0162786
932 Ga0495638_0000034
933 Ga0495653_0005525
934 Ga0495650_0000380
935 Ga0495650_0005291
936 Ga0495650_0020882
937 Ga0495650_0053886
938 Ga0495580_0056319
939 Ga0495582_0026924
940 Ga0495605_0006772
941 Ga0495605_0033803
942 Ga0495605_0071284
943 Ga0495584_0002094
944 Ga0495584_0006501
945 Ga0495585_0000001
946 Ga0495585_0005476
947 Ga0495596_0016626
948 Ga0495607_0000010
949 Ga0495607_0000705
950 Ga0495607_0016052
951 Ga0495607_0155965
952 Ga0495583_0009454
953 Ga0495583_0018706
954 Ga0495606_0000150
955 Ga0495606_0000154
956 Ga0495606_0000469
957 Ga0495606_0002690
958 Ga0495606_0002890
959 Ga0495606_0008309
960 Ga0495606_0015946
961 Ga0495606_0015951
962 Ga0495606_0021515
963 Ga0495608_0032316
964 Ga0495610_0000282
965 Ga0495610_0002694
966 Ga0495610_0005914
967 Ga0495610_0010266
968 Ga0495610_0013453
969 Ga0495616_0000001
970 Ga0495618_0011486
971 Ga0495620_0000560
972 Ga0495620_0000588
973 Ga0495628_0011306
974 Ga0495628_0355333
975 Ga0495631_0000137
976 Ga0495631_0000966
977 Ga0495632_0004331
978 Ga0495632_0015610
979 Ga0495632_0130635
980 Ga0495632_0259075
981 Ga0495637_0008462
982 Ga0495643_0083449
983 Ga0495643_0182955
984 Ga0495644_0004261
985 Ga0495648_0000559
986 Ga0495648_0004596
987 Ga0495648_0006600
988 Ga0495648_0008950
989 Ga0495648_0202975
990 Ga0495666_0009610
991 Ga0495666_0009868
992 Ga0495642_0007496
993 Ga0495652_0127306
994 Ga0495654_0000183
995 Ga0495654_0173092
996 Ga0495665_0002980
997 Ga0495640_0028066
998 Ga0495586_0098338
999 Ga0495586_0396980
1000 Ga0495645_0004978
1001 Ga0495645_0202228
1002 Ga0495622_0001709
1003 Ga0495622_0038416
1004 Ga0495633_0086656
1005 Ga0495668_0000018
1006 Ga0495634_0073344
1007 Ga0495611_0000001
1008 Ga0495611_0000429
1009 Ga0495611_0048557
1010 Ga0495625_0000001
1011 Ga0495625_0003381
1012 Ga0495625_0003390
1013 Ga0495625_0052089
1014 Ga0495625_0102228
1015 Ga0495625_0117404
1016 Ga0495635_0080551
1017 Ga0495661_0001957
1018 Ga0495661_0034817
1019 Ga0495588_0000172
1020 Ga0495657_0082035
1021 Ga0495623_0012497
1022 Ga0495623_0095492
1023 Ga0495646_0040353
1024 Ga0495646_0146573
1025 Ga0495613_0215509
1026 Ga0495624_0000846
1027 Ga0495624_0055747
1028 Ga0495670_0005484
1029 Ga0495670_0010389
1030 Ga0495670_0053741
1031 Ga0495671_0000480
1032 Ga0495671_0023009
1033 Ga0495649_0007006
1034 Ga0495649_0177817
1035 Ga0495589_0000016
1036 Ga0495660_0000058
1037 Ga0495660_0000116
1038 Ga0495660_0003525
1039 Ga0495581_0014841
1040 Ga0495581_0038543
1041 Ga0495604_0000321
1042 Ga0495672_0000106
1043 Ga0495680_0034473
1044 Ga0495683_0001193
1045 Ga0495683_0006054
1046 Ga0495683_0036657
1047 Ga0495687_000634
1048 Ga0495687_006747
1049 Ga0495687_022771
1050 Ga0495675_0070437
1051 Ga0495679_000001
1052 Ga0495673_0000001
1053 Ga0495673_0000229
1054 Ga0495673_0000371
1055 Ga0495681_0000118
1056 Ga0495686_0000085
1057 Ga0495686_0000115
1058 Ga0495686_0000407
1059 Ga0495686_0001689
1060 Ga0495686_0002146
1061 Ga0495686_0018004
1062 Ga0495686_0018598
1063 Ga0495686_0018953
1064 Ga0495686_0201372
1065 Ga0495602_0051575
1066 Ga0495614_0047059
1067 Ga0495626_0012426
1068 Ga0495626_0036578
1069 Ga0496106_0002982
1070 Ga0496110_0344718
1071 Ga0496111_0001880
1072 Ga0496111_0138037
1073 Ga0496112_0213875
1074 Ga0496114_0649648
1075 Ga0496114_0744116
1076 Ga0496116_0042860
1077 Ga0496116_0046319
1078 Ga0496117_0002017
1079 Ga0496117_0028424
1080 Ga0496117_0043057
1081 Ga0496117_0165213
1082 Ga0496118_0001001
1083 Ga0496118_0001737
1084 Ga0496118_0006503
1085 Ga0496118_0009257
1086 Ga0496118_0027108
1087 Ga0496118_0206475
1088 Ga0496119_0000023
1089 Ga0496119_0027600
1090 Ga0496119_0056569
1091 Ga0496120_0000578
1092 Ga0496120_0026578
1093 Ga0496121_0000129
1094 Ga0496121_0000308
1095 Ga0496121_0000905
1096 Ga0496121_0001400
1097 Ga0496121_0035264
1098 Ga0496121_0132938
1099 Ga0496121_0253953
1100 Ga0496122_0006856
1101 Ga0496122_0034164
1102 Ga0496122_0113820
1103 Ga0496122_0230818
1104 Ga0496123_0004244
1105 Ga0496123_0005671
1106 Ga0496123_0023530
1107 Ga0496123_0070752
1108 Ga0496124_0000109
1109 Ga0496124_0125030
1110 Ga0496125_0006086
1111 Ga0496125_0166138
1112 Ga0496126_0002238
1113 Ga0496126_0011136
1114 Ga0496126_0023806
1115 Ga0496126_0054809
1116 Ga0496126_0358547
1117 Ga0495678_000088
1118 Ga0495678_000475
1119 Ga0495682_0000033
1120 Ga0495682_0000576
1121 Ga0495682_0008745
1122 Ga0501033_0096266
1123 Ga0501037_0013831
1124 Ga0501038_0120442
1125 Ga0501039_0528511
1126 Ga0501046_0041425
1127 Ga0501047_0134599
1128 Ga0501068_0173853
1129 Ga0501070_0090736
1130 Ga0501070_0396602
1131 Ga0501071_0022336
1132 Ga0501075_0477084
1133 Ga0501080_0058675
1134 Ga0501035_0069317
1135 Ga0501044_0018799
1136 Ga0501044_0450365
1137 Ga0501045_0380560
1138 nmdc:mga05p37_57566_c1
1139 nmdc:mga09592_3952_c1
1140 nmdc:mga0qj67_905_c1
1141 nmdc:mga06r32_31454_c1
1142 nmdc:mga08y16_17267_c1
1143 nmdc:mga0n895_224768_c1
1144 Ga0500578_0000042
1145 Ga0500578_0048478
1146 Ga0500643_000002
1147 Ga0500555_000288
1148 Ga0500618_000111
1149 Ga0500621_000013
1150 Ga0500603_003350
1151 Ga0500616_0011692
1152 Ga0500622_0000335
1153 Ga0500622_0045354
1154 Ga0500633_0090956
1155 Ga0500645_001386
1156 Ga0466962_0004762
1157 2501073807
1158 2501079074
1159 2501407645
1160 2509129968
1161 2511093473
1162 2511097517
1163 2511105536
1164 2511200463
1165 2511380850
1166 2511434721
1167 2516022515
1168 2585230599
1169 2599722802
1170 2600203605
1171 2600811525
1172 2617346373
1173 2644240922
1174 2676481017
1175 2721027315
1176 2723877233
1177 2735837095
1178 2738823320
1179 2738835578
1180 2738877241
1181 2739188947
1182 2739223834
1183 2739226551
1184 2739351467
1185 2739731840
1186 2808970880
1187 2809005711
1188 2809012532
1189 2819563230
1190 2819685230
1191 2824774635
1192 2842455101
1193 2842919347
1194 2855732325
1195 2855769033
1196 2857358049
1197 2881413179
1198 2883089841
1199 2884339975
1200 2891050352
1201 2904463850
1202 2919100913
1203 2935628497
1204 2939620811
1205 2941472260
1206 2945936076
1207 2953998195
1208 2974435996
1209 2990710020
1210 3005446513
1211 3005453231
1212 8019507232

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

49

247

0.95

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

55

295

0.95

PF08659

KR

KR domain

50

230

0.89

PF23441

42

296

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
3icc-assembly1.cif.gz_A crystal structure of a putative 3-oxoacyl-(acyl carrier protein) reductase from bacillus anthracis at 1.87 a resolution 0.9621 5 252
4osp-assembly1.cif.gz_C the crystal structure of urdamycin c-6 ketoreductase domain urdmred with bound nadp and rabelomycin 0.9614 5 245
4osp-assembly1.cif.gz_D the crystal structure of urdamycin c-6 ketoreductase domain urdmred with bound nadp and rabelomycin 0.9604 5 249
4fgs-assembly1.cif.gz_D crystal structure of a probable dehydrogenase protein 0.9583 4 251
7nm7-assembly1.cif.gz_AAA the crystal structure of the antimycin pathway standalone ketoreductase, antm 0.9578 5 252
ID Description Score Start End Superfamily
4ospB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9531 5 249 3.40.50.720
4mowD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9475 5 250 3.40.50.720
3wtbC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9423 3 252 3.40.50.720
3v2gA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9414 3 249 3.40.50.720
4hsyA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9405 5 252 3.40.50.720
ID Description Score Start End GO Terms
AF-K8D0U4-F1-model_v4 deleted 0.996 4 184
AF-A0A542LX34-F1-model_v4 NAD(P)-dependent dehydrogenase (Short-subunit alcohol dehydrogenase family) 0.9926 4 252 GO:0016616
GO:0030497
AF-A0A0P8XBT2-F1-model_v4 Short chain dehydrogenase family protein 0.9922 4 245
AF-R9VI22-F1-model_v4 deleted 0.9915 2 252
AF-A0A497ZGF6-F1-model_v4 deleted 0.9908 3 252

Map