F468627

General Info

Members Datasets Scaffolds Average Seq Length
606 309 1212 259

Family's Representative Sequence

Representative Sequence 3300047320|Ga0495672_0008048|Ga0495672_0008048_374_1225
Length 283
Sequence MQLRTAPLRYTGQREILKAIIMAHTLSVGDPGAPSRTVRLDSDAVMQARVELAACFQLAAQRGYEEGVCNHFSAVVPGHDDLFLVNPYGYAFSEITASRLLVCDFEGHVIAGDGKPEATAFYIHARLHRLKPRLKAAFHTHMPNATALCLLEGPPLLWLGQTALKFYGRTAVDEHYNGLALDESEGDRIAAAMGDADVLFLKNHGVMVAGASIAEVWDDLYYLERAAEVQLKAMASNQPLKPIPHEVAQRTYEQMRLGDAQSARAHLDSALRILRSHGIRFEE

Samples

Sample ID Description Type Environment
1 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
11 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
12 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
13 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
14 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
15 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
16 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
17 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
18 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
19 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
20 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
21 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
22 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
23 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
29 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
30 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
31 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
32 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
33 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
34 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
38 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
39 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
40 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
41 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
42 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
43 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
46 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
47 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
48 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
49 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
50 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
51 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
56 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
58 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
61 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
62 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
64 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
65 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
70 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
87 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
90 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
91 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
92 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
93 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
94 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
95 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
96 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
97 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
98 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
99 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
100 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
101 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
102 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
103 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
104 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
105 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
106 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
107 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
108 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
109 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
110 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
111 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
112 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
113 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
114 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
115 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
116 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
117 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
118 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
119 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
120 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
121 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
122 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
123 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
124 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
125 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
126 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
127 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
128 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
129 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
130 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
131 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
132 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
133 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
134 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
135 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
136 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
137 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
138 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
139 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
140 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
141 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
142 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
143 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
144 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
145 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
146 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
147 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
148 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
149 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
150 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
151 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
152 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
153 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
154 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
155 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
156 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
157 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
158 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
159 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
160 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
161 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
162 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
163 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
164 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
165 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
166 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
167 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
168 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
169 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
170 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
171 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
172 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
173 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
174 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
175 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
176 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
177 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
178 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
179 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
180 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
181 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
182 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
183 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
184 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
185 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
186 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
187 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
188 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
189 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
190 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
191 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
192 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
193 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
194 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
195 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
196 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
197 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
198 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
199 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
200 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
201 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
202 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
203 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
204 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
205 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
206 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
207 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
208 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
209 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
210 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
211 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
212 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
213 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
214 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
215 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
216 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
217 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
218 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
219 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
220 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
221 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
222 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
223 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
224 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
225 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
226 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
227 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
228 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
229 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
230 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
231 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
232 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
233 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
234 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
235 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
236 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
237 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
238 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
239 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
240 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
241 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
242 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
243 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
244 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
245 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
246 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
247 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
248 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
249 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
250 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
251 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
252 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
253 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
254 2511231010 Pseudomonas sp. GM25 Isolate Nodule
255 2511231018 Pseudomonas sp. GM60 Isolate Nodule
256 2511231019 Pseudomonas sp. GM67 Isolate Nodule
257 2511231031 Pseudomonas sp. GM16 Isolate Nodule
258 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
259 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
260 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
261 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
262 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
263 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
264 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
265 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
266 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
267 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
268 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
269 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
270 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
271 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
272 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
273 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
274 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
275 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
276 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
277 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
278 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
279 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
280 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
281 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
282 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
283 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
284 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
285 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
286 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
287 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
288 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
289 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
290 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
291 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
292 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
293 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
294 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
295 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
296 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
297 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
298 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
299 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
300 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
301 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
302 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
303 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
304 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
305 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
306 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule
307 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
308 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified
309 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.59
Metatranscriptomes 0
Isolates 9.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.09
Nodule 2.15
Rhizoplane 7.1
Rhizosphere 67.82
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495672_0008048 3300047320 Bacteria 7840
2 JGI24740J21852_10001480 3300001979 Bacteria 10784
3 JGI24739J22299_10010995 3300001989 Bacteria 3347
4 JGI24735J21928_10011185 3300002067 Bacteria 2849
5 JGI24735J21928_10025010 3300002067 Bacteria 1803
6 JGI24738J21930_10002369 3300002075 Bacteria 4957
7 JGI25156J39149_1000573 3300002705 Bacteria 21022
8 JGI25165J46597_1000691 3300003214 Bacteria 27005
9 rootL2_10093322 3300003322 Bacteria 1765
10 JGI25160J50197_1000029 3300003354 Bacteria 179129
11 Ga0055533_1000323 3300003756 Bacteria 21690
12 Ga0055532_1000026 3300003758 Bacteria 238584
13 Ga0055525_1005247 3300003759 Bacteria 1101
14 Ga0055527_1000018 3300003760 Bacteria 238584
15 Ga0055535_1000020 3300003761 Bacteria 238584
16 Ga0055542_1000031 3300003762 Bacteria 238584
17 Ga0055529_1000036 3300003763 Bacteria 238584
18 Ga0055536_1000067 3300003781 Bacteria 96849
19 Ga0055530_10000877 3300003791 Bacteria 24722
20 Ga0055540_1000163 3300003792 Bacteria 66649
21 Ga0055531_10000789 3300003794 Bacteria 26298
22 Ga0058692_1036553 3300003856 Bacteria 888
23 Ga0065165_1000040 3300005262 Bacteria 205767
24 Ga0065714_10139917 3300005288 Bacteria 1180
25 Ga0070663_100375876 3300005455 Bacteria 1156
26 Ga0070678_100032990 3300005456 Bacteria 3590
27 Ga0070672_100644025 3300005543 Bacteria 925
28 Ga0070665_100354747 3300005548 Bacteria 1472
29 Ga0068851_10000280 3300005834 Bacteria 23501
30 Ga0075366_10235345 3300006195 Bacteria 1116
31 Ga0075370_10040043 3300006353 Bacteria 2642
32 Ga0079104_1049726 3300006946 Bacteria 938
33 Ga0105251_10006206 3300009011 Bacteria 7670
34 Ga0105251_10010371 3300009011 Bacteria 5411
35 Ga0105251_10015118 3300009011 Bacteria 4230
36 Ga0105251_10058078 3300009011 Bacteria 1828
37 Ga0105251_10058108 3300009011 Bacteria 1827
38 Ga0105251_10069487 3300009011 Bacteria 1642
39 Ga0105244_10019231 3300009036 Bacteria 3820
40 Ga0105244_10020161 3300009036 Bacteria 3706
41 Ga0105244_10021745 3300009036 Bacteria 3542
42 Ga0105244_10033536 3300009036 Bacteria 2706
43 Ga0105250_10001714 3300009092 Bacteria 11578
44 Ga0105250_10084431 3300009092 Bacteria 1289
45 Ga0105250_10085973 3300009092 Bacteria 1277
46 Ga0105240_10172846 3300009093 Bacteria 2557
47 Ga0105240_10200780 3300009093 Bacteria 2337
48 Ga0105240_10634710 3300009093 Bacteria 1172
49 Ga0105248_10015603 3300009177 Bacteria 8374
50 Ga0105248_10184734 3300009177 Bacteria 2349
51 Ga0105238_10162443 3300009551 Bacteria 2209
52 Ga0157373_10000409 3300013100 Bacteria 34480
53 Ga0157371_10000396 3300013102 Bacteria 54666
54 Ga0157371_10002173 3300013102 Bacteria 19080
55 Ga0157371_10043169 3300013102 Bacteria 3213
56 Ga0157370_10038781 3300013104 Bacteria 4608
57 Ga0157370_10073949 3300013104 Bacteria 3215
58 Ga0157370_10194793 3300013104 Bacteria 1881
59 Ga0157370_10214844 3300013104 Bacteria 1782
60 Ga0157369_10000544 3300013105 Bacteria 49880
61 Ga0157369_10003144 3300013105 Bacteria 19716
62 Ga0157369_10051031 3300013105 Bacteria 4478
63 Ga0157369_10056620 3300013105 Bacteria 4230
64 Ga0157369_10064728 3300013105 Bacteria 3937
65 Ga0157369_10078768 3300013105 Bacteria 3530
66 Ga0157369_10115383 3300013105 Bacteria 2852
67 Ga0157369_10116327 3300013105 Bacteria 2839
68 Ga0157374_10031635 3300013296 Bacteria 4811
69 Ga0163162_10086721 3300013306 Bacteria 3208
70 Ga0163162_10117312 3300013306 Bacteria 2763
71 Ga0157375_10000100 3300013308 Bacteria 87522
72 Ga0157375_10017981 3300013308 Bacteria 6401
73 Ga0182008_10001767 3300014497 Bacteria 14171
74 Ga0182008_10002290 3300014497 Bacteria 12074
75 Ga0182008_10059241 3300014497 Bacteria 1889
76 Ga0182008_10101889 3300014497 Bacteria 1419
77 Ga0182006_1001771 3300015261 Bacteria 12514
78 Ga0182006_1014140 3300015261 Bacteria 3445
79 Ga0182006_1046679 3300015261 Bacteria 1682
80 Ga0182005_1049749 3300015265 Bacteria 1139
81 Ga0183361_10004 3300016635 Bacteria 484183
82 Ga0163161_10000121 3300017792 Bacteria 73471
83 Ga0163161_10015315 3300017792 Bacteria 5346
84 Ga0209435_106481 3300025206 Bacteria 1302
85 Ga0209674_100020 3300025226 Bacteria 672397
86 Ga0209674_108755 3300025226 Bacteria 1175
87 Ga0209672_100013 3300025228 Bacteria 740693
88 Ga0209147_100013 3300025229 Bacteria 660057
89 Ga0209563_101128 3300025230 Bacteria 7552
90 Ga0207427_101007 3300025231 Bacteria 11806
91 Ga0209258_100016 3300025242 Bacteria 668622
92 Ga0209646_1020829 3300025246 Bacteria 946
93 Ga0209677_113973 3300025253 Bacteria 1117
94 Ga0209148_1000020 3300025254 Bacteria 740693
95 Ga0209759_1000010 3300025256 Bacteria 430463
96 Ga0209759_1000083 3300025256 Bacteria 169561
97 Ga0209759_1010869 3300025256 Bacteria 2632
98 Ga0209233_1000153 3300025261 Bacteria 169839
99 Ga0209455_1000017 3300025272 Bacteria 740693
100 Ga0209130_1003104 3300025284 Bacteria 7409
101 Ga0209675_1004121 3300025291 Bacteria 6605
102 Ga0209675_1009812 3300025291 Bacteria 3342
103 Ga0209676_1000002 3300025292 Bacteria 1732948
104 Ga0209676_1000166 3300025292 Bacteria 156596
105 Ga0209564_1004023 3300025295 Bacteria 9301
106 Ga0209050_1000275 3300025298 Bacteria 110235
107 Ga0209256_1011944 3300025299 Bacteria 3402
108 Ga0207426_1000004 3300025302 Bacteria 1047900
109 Ga0209051_1000001 3300025303 Bacteria 1732974
110 Ga0209257_1000181 3300025304 Bacteria 158039
111 Ga0207656_10000271 3300025321 Bacteria 17964
112 Ga0207696_1000739 3300025711 Bacteria 21838
113 Ga0207696_1053612 3300025711 Bacteria 1147
114 Ga0207655_1018380 3300025728 Bacteria 3710
115 Ga0207655_1023188 3300025728 Bacteria 3087
116 Ga0207655_1025122 3300025728 Bacteria 2900
117 Ga0207713_1000231 3300025735 Bacteria 74756
118 Ga0207713_1000424 3300025735 Bacteria 44809
119 Ga0207713_1003169 3300025735 Bacteria 11388
120 Ga0207713_1005816 3300025735 Bacteria 7632
121 Ga0207713_1040234 3300025735 Bacteria 1964
122 Ga0207713_1050334 3300025735 Bacteria 1664
123 Ga0207647_10024595 3300025904 Bacteria 3970
124 Ga0207647_10028744 3300025904 Bacteria 3607
125 Ga0207647_10063328 3300025904 Bacteria 2249
126 Ga0207695_10117470 3300025913 Bacteria 2632
127 Ga0207681_10005361 3300025923 Bacteria 7877
128 Ga0207659_10283679 3300025926 Bacteria 1355
129 Ga0207709_10000045 3300025935 Bacteria 240671
130 Ga0207691_10413665 3300025940 Bacteria 1149
131 Ga0207711_10008507 3300025941 Bacteria 8585
132 Ga0207711_10047821 3300025941 Bacteria 3659
133 Ga0207711_10417315 3300025941 Bacteria 1248
134 Ga0207639_10084477 3300026041 Bacteria 2522
135 Ga0207678_10107204 3300026067 Bacteria 2383
136 Ga0207683_10048363 3300026121 Bacteria 3724
137 Ga0209281_1013398 3300027111 Bacteria 1772
138 Ga0209371_1015917 3300027312 Bacteria 2001
139 Ga0268266_10006646 3300028379 Bacteria 10550
140 Ga0307517_10001042 3300028786 Bacteria 47053
141 Ga0307517_10052668 3300028786 Bacteria 4072
142 Ga0307517_10168599 3300028786 Bacteria 1446
143 Ga0307515_10000463 3300028794 Bacteria 97084
144 Ga0307515_10001074 3300028794 Bacteria 62572
145 Ga0307515_10033059 3300028794 Bacteria 8534
146 Ga0307515_10245030 3300028794 Bacteria 1555
147 Ga0265338_10000325 3300028800 Bacteria 86856
148 Ga0268256_1009825 3300030500 Bacteria 3138
149 Ga0307512_10065951 3300030522 Bacteria 2739
150 Ga0316179_1107741 3300030734 Bacteria 1609
151 Ga0316178_1056695 3300030735 Bacteria 9009
152 Ga0307513_10009671 3300031456 Bacteria 12179
153 Ga0307513_10134735 3300031456 Bacteria 2407
154 Ga0307408_100034109 3300031548 Bacteria 3561
155 Ga0307508_10000040 3300031616 Bacteria 149333
156 Ga0307508_10177392 3300031616 Bacteria 1733
157 Ga0307516_10004086 3300031730 Bacteria 18245
158 Ga0307405_10182639 3300031731 Bacteria 1507
159 Ga0307407_10015706 3300031903 Bacteria 3752
160 Ga0307412_10000002 3300031911 Bacteria 743446
161 Ga0307412_10015215 3300031911 Bacteria 4554
162 Ga0307412_10506008 3300031911 Bacteria 1006
163 Ga0307409_100003301 3300031995 Bacteria 8720
164 Ga0307416_100422634 3300032002 Bacteria 1377
165 Ga0307414_10583565 3300032004 Bacteria 1000
166 Ga0307411_10005502 3300032005 Bacteria 6231
167 Ga0307510_10000104 3300033180 Bacteria 66463
168 Ga0395905_0000035 3300037471 Bacteria 272014
169 Ga0395905_0122335 3300037471 Bacteria 2447
170 Ga0436364_0137883 3300037853 Bacteria 9798
171 Ga0436361_0750749 3300039447 Bacteria 2889
172 Ga0439438_001468 3300041405 Bacteria 10382
173 Ga0439438_002602 3300041405 Bacteria 7622
174 Ga0439447_023581 3300041407 Bacteria 1601
175 Ga0439447_065812 3300041407 Bacteria 847
176 Ga0451807_1085242 3300041486 Bacteria 1197
177 Ga0451849_0390853 3300041505 Bacteria 898
178 Ga0451853_1186014 3300041512 Bacteria 1143
179 Ga0439431_0017194 3300041997 Bacteria 1698
180 Ga0439445_0013598 3300042004 Bacteria 1972
181 Ga0439432_005086 3300042006 Bacteria 4757
182 Ga0439451_003552 3300042009 Bacteria 3161
183 Ga0439452_000060 3300042010 Bacteria 101512
184 Ga0439456_000387 3300042013 Bacteria 9887
185 Ga0439463_006629 3300042016 Bacteria 2867
186 Ga0450911_000044 3300042115 Bacteria 53211
187 Ga0450900_003549 3300042136 Bacteria 1738
188 Ga0450902_001708 3300042137 Bacteria 3024
189 Ga0450906_000249 3300042145 Bacteria 10368
190 Ga0450908_021926 3300042184 Bacteria 1120
191 Ga0450918_006939 3300042531 Bacteria 2013
192 Ga0466960_0037283 3300044901 Bacteria 2280
193 Ga0466967_0171226 3300045976 Bacteria 2043
194 Ga0495617_002990 3300046452 Bacteria 6459
195 Ga0495617_005056 3300046452 Bacteria 4726
196 Ga0495627_000417 3300046453 Bacteria 37602
197 Ga0495627_000714 3300046453 Bacteria 25277
198 Ga0495627_011856 3300046453 Bacteria 3111
199 Ga0495592_0021809 3300046454 Bacteria 4873
200 Ga0495603_0002996 3300046455 Bacteria 10000
201 Ga0495603_0006907 3300046455 Bacteria 6812
202 Ga0495590_0001222 3300046457 Bacteria 11216
203 Ga0495590_0011316 3300046457 Bacteria 3338
204 Ga0495590_0024367 3300046457 Bacteria 2132
205 Ga0495591_001927 3300046458 Bacteria 12168
206 Ga0495591_015342 3300046458 Bacteria 2711
207 Ga0495591_018494 3300046458 Bacteria 2361
208 Ga0495629_0002042 3300046459 Bacteria 15684
209 Ga0495629_0002913 3300046459 Bacteria 13050
210 Ga0495638_0000755 3300046460 Bacteria 34450
211 Ga0495638_0003223 3300046460 Bacteria 12903
212 Ga0495638_0023587 3300046460 Bacteria 4021
213 Ga0495653_0013480 3300046463 Bacteria 6660
214 Ga0495653_0021391 3300046463 Bacteria 5241
215 Ga0495653_0075585 3300046463 Bacteria 2506
216 Ga0495650_0000309 3300046471 Bacteria 88068
217 Ga0495650_0000785 3300046471 Bacteria 38956
218 Ga0495650_0003731 3300046471 Bacteria 10895
219 Ga0495650_0006224 3300046471 Bacteria 7481
220 Ga0495650_0041808 3300046471 Bacteria 1957
221 Ga0495580_0002321 3300046472 Bacteria 16595
222 Ga0495580_0002852 3300046472 Bacteria 14877
223 Ga0495582_0014513 3300046473 Bacteria 4328
224 Ga0495605_0000032 3300046474 Bacteria 210550
225 Ga0495605_0001063 3300046474 Bacteria 18326
226 Ga0495605_0002965 3300046474 Bacteria 10273
227 Ga0495605_0012808 3300046474 Bacteria 4641
228 Ga0495605_0013969 3300046474 Bacteria 4410
229 Ga0495662_0015690 3300046476 Bacteria 3677
230 Ga0495662_0051284 3300046476 Bacteria 1992
231 Ga0495664_0004932 3300046477 Bacteria 7304
232 Ga0495664_0019491 3300046477 Bacteria 3900
233 Ga0495664_0051934 3300046477 Bacteria 2434
234 Ga0495584_0000156 3300046491 Bacteria 47644
235 Ga0495584_0003314 3300046491 Bacteria 8919
236 Ga0495584_0022262 3300046491 Bacteria 3216
237 Ga0495584_0083073 3300046491 Bacteria 1613
238 Ga0495584_0086286 3300046491 Bacteria 1581
239 Ga0495584_0189388 3300046491 Bacteria 1045
240 Ga0495585_0007037 3300046492 Bacteria 6922
241 Ga0495585_0240122 3300046492 Bacteria 907
242 Ga0495594_0051975 3300046499 Bacteria 2255
243 Ga0495596_0011835 3300046500 Bacteria 3746
244 Ga0495596_0044308 3300046500 Bacteria 1751
245 Ga0495596_0059576 3300046500 Bacteria 1488
246 Ga0495607_0001453 3300046501 Bacteria 21093
247 Ga0495607_0001488 3300046501 Bacteria 20800
248 Ga0495607_0063236 3300046501 Bacteria 2094
249 Ga0495583_0000052 3300046506 Bacteria 211902
250 Ga0495583_0000086 3300046506 Bacteria 165176
251 Ga0495583_0002895 3300046506 Bacteria 13876
252 Ga0495583_0012557 3300046506 Bacteria 4783
253 Ga0495583_0015799 3300046506 Bacteria 4087
254 Ga0495606_0001056 3300046507 Bacteria 39812
255 Ga0495606_0001874 3300046507 Bacteria 26367
256 Ga0495606_0017452 3300046507 Bacteria 5426
257 Ga0495606_0028197 3300046507 Bacteria 3965
258 Ga0495606_0040642 3300046507 Bacteria 3125
259 Ga0495606_0102782 3300046507 Bacteria 1737
260 Ga0495608_0035872 3300046511 Bacteria 3341
261 Ga0495610_0000194 3300046512 Bacteria 67667
262 Ga0495610_0002775 3300046512 Bacteria 14357
263 Ga0495610_0005243 3300046512 Bacteria 9274
264 Ga0495610_0008718 3300046512 Bacteria 6521
265 Ga0495610_0022154 3300046512 Bacteria 3480
266 Ga0495610_0036386 3300046512 Bacteria 2516
267 Ga0495616_0002599 3300046513 Bacteria 11881
268 Ga0495616_0007212 3300046513 Bacteria 6664
269 Ga0495616_0112674 3300046513 Bacteria 1262
270 Ga0495618_0011579 3300046514 Bacteria 5352
271 Ga0495620_0000082 3300046515 Bacteria 78939
272 Ga0495620_0000324 3300046515 Bacteria 33602
273 Ga0495620_0001531 3300046515 Bacteria 13739
274 Ga0495620_0003136 3300046515 Bacteria 9499
275 Ga0495620_0017133 3300046515 Bacteria 3619
276 Ga0495620_0023584 3300046515 Bacteria 2939
277 Ga0495628_0013074 3300046516 Bacteria 6990
278 Ga0495628_0052095 3300046516 Bacteria 3233
279 Ga0495628_0085406 3300046516 Bacteria 2448
280 Ga0495628_0143999 3300046516 Bacteria 1817
281 Ga0495630_0136150 3300046517 Bacteria 1866
282 Ga0495630_0174262 3300046517 Bacteria 1639
283 Ga0495631_0000169 3300046518 Bacteria 44458
284 Ga0495631_0004313 3300046518 Bacteria 7585
285 Ga0495631_0045156 3300046518 Bacteria 1940
286 Ga0495632_0000191 3300046519 Bacteria 61820
287 Ga0495632_0010056 3300046519 Bacteria 5637
288 Ga0495632_0034537 3300046519 Bacteria 2587
289 Ga0495632_0194849 3300046519 Bacteria 924
290 Ga0495637_0000164 3300046520 Bacteria 50855
291 Ga0495637_0003717 3300046520 Bacteria 8061
292 Ga0495643_0003883 3300046522 Bacteria 10737
293 Ga0495643_0010891 3300046522 Bacteria 5570
294 Ga0495643_0026744 3300046522 Bacteria 3250
295 Ga0495643_0026787 3300046522 Bacteria 3247
296 Ga0495644_0005953 3300046523 Bacteria 4754
297 Ga0495648_0000827 3300046524 Bacteria 32671
298 Ga0495648_0024840 3300046524 Bacteria 4069
299 Ga0495648_0040350 3300046524 Bacteria 2960
300 Ga0495666_0000333 3300046526 Bacteria 20663
301 Ga0495642_0018772 3300046528 Bacteria 2707
302 Ga0495642_0051422 3300046528 Bacteria 1695
303 Ga0495642_0127905 3300046528 Bacteria 1093
304 Ga0495652_0013004 3300046529 Bacteria 7502
305 Ga0495652_0045262 3300046529 Bacteria 3785
306 Ga0495652_0229598 3300046529 Bacteria 1389
307 Ga0495654_0000244 3300046530 Bacteria 50838
308 Ga0495654_0000802 3300046530 Bacteria 24130
309 Ga0495654_0001781 3300046530 Bacteria 14357
310 Ga0495654_0006649 3300046530 Bacteria 6543
311 Ga0495654_0008051 3300046530 Bacteria 5849
312 Ga0495654_0033717 3300046530 Bacteria 2589
313 Ga0495654_0053503 3300046530 Bacteria 1961
314 Ga0495665_0000006 3300046531 Bacteria 84294
315 Ga0495665_0133915 3300046531 Bacteria 1297
316 Ga0495586_0045500 3300046535 Bacteria 2365
317 Ga0495586_0049975 3300046535 Bacteria 2262
318 Ga0495609_0000032 3300046538 Bacteria 211021
319 Ga0495609_0000145 3300046538 Bacteria 73765
320 Ga0495609_0000770 3300046538 Bacteria 24025
321 Ga0495609_0001931 3300046538 Bacteria 13183
322 Ga0495609_0011601 3300046538 Bacteria 4194
323 Ga0495609_0055853 3300046538 Bacteria 1751
324 Ga0495597_0000992 3300046542 Bacteria 21815
325 Ga0495597_0002309 3300046542 Bacteria 12368
326 Ga0495597_0002611 3300046542 Bacteria 11211
327 Ga0495597_0005030 3300046542 Bacteria 7080
328 Ga0495597_0011882 3300046542 Bacteria 4214
329 Ga0495597_0095069 3300046542 Bacteria 1261
330 Ga0495597_0096355 3300046542 Bacteria 1251
331 Ga0495645_0000208 3300046543 Bacteria 42020
332 Ga0495622_0004276 3300046557 Bacteria 6646
333 Ga0495622_0005006 3300046557 Bacteria 6140
334 Ga0495633_0000615 3300046558 Bacteria 33796
335 Ga0495633_0004982 3300046558 Bacteria 8286
336 Ga0495667_0023723 3300046559 Bacteria 4133
337 Ga0495667_0050816 3300046559 Bacteria 2736
338 Ga0495656_0251201 3300046615 Bacteria 893
339 Ga0495668_0099670 3300046616 Bacteria 1589
340 Ga0495634_0002514 3300046642 Bacteria 15201
341 Ga0495611_0000052 3300046648 Bacteria 83237
342 Ga0495611_0010719 3300046648 Bacteria 3881
343 Ga0495625_0003859 3300046660 Bacteria 14487
344 Ga0495625_0004472 3300046660 Bacteria 13205
345 Ga0495625_0005154 3300046660 Bacteria 12056
346 Ga0495625_0007414 3300046660 Bacteria 9551
347 Ga0495625_0055491 3300046660 Bacteria 2825
348 Ga0495635_0014319 3300046663 Bacteria 5549
349 Ga0495661_0000405 3300046665 Bacteria 45802
350 Ga0495661_0053724 3300046665 Bacteria 2421
351 Ga0495661_0075017 3300046665 Bacteria 1966
352 Ga0495588_0030678 3300046674 Bacteria 2703
353 Ga0495588_0035830 3300046674 Bacteria 2516
354 Ga0495657_0161904 3300046675 Bacteria 1384
355 Ga0495623_0047758 3300046679 Bacteria 2717
356 Ga0495623_0080074 3300046679 Bacteria 2022
357 Ga0495646_0003054 3300046680 Bacteria 10374
358 Ga0495646_0018017 3300046680 Bacteria 4472
359 Ga0495646_0170122 3300046680 Bacteria 1201
360 Ga0495658_0016126 3300046683 Bacteria 3845
361 Ga0495669_0014847 3300046684 Bacteria 3332
362 Ga0495624_0000446 3300046690 Bacteria 32513
363 Ga0495624_0000578 3300046690 Bacteria 28629
364 Ga0495624_0088026 3300046690 Bacteria 1917
365 Ga0495670_0000293 3300046691 Bacteria 23617
366 Ga0495670_0029806 3300046691 Bacteria 2710
367 Ga0495670_0398318 3300046691 Bacteria 743
368 Ga0495671_0000435 3300046692 Bacteria 33185
369 Ga0495671_0002560 3300046692 Bacteria 11432
370 Ga0495671_0017195 3300046692 Bacteria 3849
371 Ga0495671_0137063 3300046692 Bacteria 1193
372 Ga0495671_0233114 3300046692 Bacteria 890
373 Ga0495649_0002107 3300046694 Bacteria 14272
374 Ga0495649_0003440 3300046694 Bacteria 10680
375 Ga0495649_0015086 3300046694 Bacteria 4404
376 Ga0495649_0029602 3300046694 Bacteria 3028
377 Ga0495649_0048291 3300046694 Bacteria 2313
378 Ga0495649_0056276 3300046694 Bacteria 2124
379 Ga0495649_0072972 3300046694 Bacteria 1839
380 Ga0495649_0097484 3300046694 Bacteria 1564
381 Ga0495589_0000973 3300046794 Bacteria 17487
382 Ga0495589_0018376 3300046794 Bacteria 3585
383 Ga0495589_0229587 3300046794 Bacteria 870
384 Ga0495600_0302136 3300046809 Bacteria 1010
385 Ga0495660_0001786 3300046810 Bacteria 14206
386 Ga0495660_0002290 3300046810 Bacteria 12305
387 Ga0495660_0004174 3300046810 Bacteria 8785
388 Ga0495660_0023809 3300046810 Bacteria 3491
389 Ga0495660_0056130 3300046810 Bacteria 2129
390 Ga0495660_0087130 3300046810 Bacteria 1629
391 Ga0495660_0091447 3300046810 Bacteria 1580
392 Ga0495660_0128221 3300046810 Bacteria 1275
393 Ga0495581_0004076 3300047315 Bacteria 8416
394 Ga0495604_0015519 3300047317 Bacteria 6080
395 Ga0495604_0056812 3300047317 Bacteria 3010
396 Ga0495674_0002322 3300047319 Bacteria 18678
397 Ga0495674_0039597 3300047319 Bacteria 4223
398 Ga0495674_0307734 3300047319 Bacteria 1293
399 Ga0495672_0010087 3300047320 Bacteria 6761
400 Ga0495672_0018842 3300047320 Bacteria 4571
401 Ga0495672_0075001 3300047320 Bacteria 1903
402 Ga0495676_0000108 3300047321 Bacteria 62522
403 Ga0495680_0001268 3300047322 Bacteria 27528
404 Ga0495680_0014736 3300047322 Bacteria 6758
405 Ga0495683_0000011 3300047323 Bacteria 212053
406 Ga0495683_0000281 3300047323 Bacteria 44019
407 Ga0495683_0001451 3300047323 Bacteria 15557
408 Ga0495683_0106192 3300047323 Bacteria 1345
409 Ga0495687_012635 3300047443 Bacteria 4451
410 Ga0495687_025928 3300047443 Bacteria 2764
411 Ga0495687_036739 3300047443 Bacteria 2188
412 Ga0495675_0031931 3300047444 Bacteria 3362
413 Ga0495675_0062577 3300047444 Bacteria 2356
414 Ga0495675_0141431 3300047444 Bacteria 1491
415 Ga0495679_000297 3300047446 Bacteria 40193
416 Ga0495679_001697 3300047446 Bacteria 12200
417 Ga0495679_003845 3300047446 Bacteria 7108
418 Ga0495673_0000077 3300047469 Bacteria 204403
419 Ga0495673_0000198 3300047469 Bacteria 93985
420 Ga0495673_0000910 3300047469 Bacteria 27015
421 Ga0495673_0018339 3300047469 Bacteria 3530
422 Ga0495673_0021985 3300047469 Bacteria 3134
423 Ga0495673_0022336 3300047469 Bacteria 3103
424 Ga0495673_0024238 3300047469 Bacteria 2937
425 Ga0495681_0000598 3300047470 Bacteria 27518
426 Ga0495681_0004178 3300047470 Bacteria 9918
427 Ga0495681_0006267 3300047470 Bacteria 7835
428 Ga0495681_0008294 3300047470 Bacteria 6526
429 Ga0495681_0118349 3300047470 Bacteria 1139
430 Ga0495684_0135007 3300047471 Bacteria 1852
431 Ga0495686_0000044 3300047472 Bacteria 288079
432 Ga0495686_0001757 3300047472 Bacteria 22218
433 Ga0495686_0007379 3300047472 Bacteria 8248
434 Ga0495686_0063792 3300047472 Bacteria 2282
435 Ga0495686_0088809 3300047472 Bacteria 1879
436 Ga0495593_0000259 3300047673 Bacteria 28522
437 Ga0495593_0008948 3300047673 Bacteria 5812
438 Ga0495593_0018077 3300047673 Bacteria 3964
439 Ga0495593_0020591 3300047673 Bacteria 3693
440 Ga0495602_0001569 3300048088 Bacteria 22764
441 Ga0495602_0043455 3300048088 Bacteria 4085
442 Ga0495602_0059112 3300048088 Bacteria 3349
443 Ga0495602_0291699 3300048088 Bacteria 1197
444 Ga0495614_0006247 3300048089 Bacteria 5356
445 Ga0495614_0052701 3300048089 Bacteria 1744
446 Ga0495626_0000269 3300048091 Bacteria 57715
447 Ga0495626_0007346 3300048091 Bacteria 6139
448 Ga0495626_0040934 3300048091 Bacteria 2185
449 Ga0496100_0000178 3300048903 Bacteria 35414
450 Ga0496100_0002612 3300048903 Bacteria 9183
451 Ga0496100_0067379 3300048903 Bacteria 2377
452 Ga0496100_0192481 3300048903 Bacteria 1481
453 Ga0496101_0013543 3300048904 Bacteria 5468
454 Ga0496101_0054912 3300048904 Bacteria 2875
455 Ga0496101_0161133 3300048904 Bacteria 1720
456 Ga0496102_0000812 3300048905 Bacteria 30387
457 Ga0496102_0007688 3300048905 Bacteria 9208
458 Ga0496102_0166928 3300048905 Bacteria 2071
459 Ga0496102_0184835 3300048905 Bacteria 1964
460 Ga0496102_0356841 3300048905 Bacteria 1376
461 Ga0496102_0618510 3300048905 Bacteria 1006
462 Ga0496103_0008246 3300048906 Bacteria 6185
463 Ga0496103_0065850 3300048906 Bacteria 2260
464 Ga0496104_0026116 3300048907 Bacteria 5388
465 Ga0496104_0047752 3300048907 Bacteria 4035
466 Ga0496104_0057282 3300048907 Bacteria 3687
467 Ga0496104_0159160 3300048907 Bacteria 2166
468 Ga0496105_0008151 3300048908 Bacteria 8145
469 Ga0496105_0012039 3300048908 Bacteria 6848
470 Ga0496105_0047987 3300048908 Bacteria 3524
471 Ga0496106_0005870 3300048909 Bacteria 9081
472 Ga0496106_0367314 3300048909 Bacteria 1156
473 Ga0496107_0010410 3300048910 Bacteria 6458
474 Ga0496107_0229919 3300048910 Bacteria 1380
475 Ga0496109_0107096 3300048912 Bacteria 2596
476 Ga0496110_0027645 3300048913 Bacteria 4863
477 Ga0496111_0078607 3300048914 Bacteria 2406
478 Ga0496112_0004958 3300048915 Bacteria 11405
479 Ga0496112_0025546 3300048915 Bacteria 5672
480 Ga0496113_0054618 3300048916 Bacteria 2990
481 Ga0496113_0127189 3300048916 Bacteria 1996
482 Ga0496113_0365612 3300048916 Bacteria 1158
483 Ga0496114_0000601 3300048917 Bacteria 26597
484 Ga0496115_0047386 3300048918 Bacteria 3437
485 Ga0496115_0062997 3300048918 Bacteria 2992
486 Ga0496116_0000402 3300048919 Bacteria 62213
487 Ga0496116_0000899 3300048919 Bacteria 36846
488 Ga0496116_0003126 3300048919 Bacteria 16629
489 Ga0496116_0018521 3300048919 Bacteria 5363
490 Ga0496117_0000697 3300048920 Bacteria 53296
491 Ga0496117_0002423 3300048920 Bacteria 23609
492 Ga0496117_0002759 3300048920 Bacteria 21513
493 Ga0496117_0005366 3300048920 Bacteria 13504
494 Ga0496117_0015678 3300048920 Bacteria 6438
495 Ga0496117_0040445 3300048920 Bacteria 3428
496 Ga0496117_0161562 3300048920 Bacteria 1312
497 Ga0496118_0000135 3300048921 Bacteria 130330
498 Ga0496118_0006187 3300048921 Bacteria 13263
499 Ga0496118_0006644 3300048921 Bacteria 12626
500 Ga0496118_0024029 3300048921 Bacteria 5274
501 Ga0496118_0061139 3300048921 Bacteria 2791
502 Ga0496118_0144336 3300048921 Bacteria 1502
503 Ga0496119_0003195 3300048922 Bacteria 17172
504 Ga0496119_0012721 3300048922 Bacteria 6800
505 Ga0496120_0008082 3300048923 Bacteria 7732
506 Ga0496120_0042537 3300048923 Bacteria 2652
507 Ga0496121_0000361 3300048924 Bacteria 93571
508 Ga0496121_0003581 3300048924 Bacteria 21934
509 Ga0496121_0037331 3300048924 Bacteria 4317
510 Ga0496121_0060071 3300048924 Bacteria 3130
511 Ga0496121_0085926 3300048924 Bacteria 2474
512 Ga0496122_0021326 3300048925 Bacteria 5804
513 Ga0496122_0024733 3300048925 Bacteria 5245
514 Ga0496122_0089098 3300048925 Bacteria 2111
515 Ga0496122_0137323 3300048925 Bacteria 1537
516 Ga0496122_0143392 3300048925 Bacteria 1489
517 Ga0496123_0004360 3300048926 Bacteria 14958
518 Ga0496123_0019747 3300048926 Bacteria 5299
519 Ga0496123_0029473 3300048926 Bacteria 4039
520 Ga0496123_0083106 3300048926 Bacteria 1938
521 Ga0496124_0006236 3300048927 Bacteria 13065
522 Ga0496124_0041254 3300048927 Bacteria 3984
523 Ga0496124_0140384 3300048927 Bacteria 1907
524 Ga0496124_0159908 3300048927 Bacteria 1757
525 Ga0496125_0014170 3300048928 Bacteria 7776
526 Ga0496125_0021611 3300048928 Bacteria 5997
527 Ga0496126_0000196 3300048929 Bacteria 134394
528 Ga0496126_0000398 3300048929 Bacteria 89253
529 Ga0496126_0053823 3300048929 Bacteria 3649
530 Ga0496126_0118569 3300048929 Bacteria 2297
531 Ga0496126_0439786 3300048929 Bacteria 1051
532 Ga0496126_0443455 3300048929 Bacteria 1046
533 Ga0495678_000033 3300049459 Bacteria 211804
534 Ga0495678_000129 3300049459 Bacteria 88910
535 Ga0495678_002800 3300049459 Bacteria 11344
536 Ga0495678_019669 3300049459 Bacteria 3006
537 Ga0495682_0089050 3300049460 Bacteria 1109
538 Ga0501240_004037 3300049673 Bacteria 1678
539 nmdc:mga0k408_147882_c1 3300050493 Bacteria 1399
540 nmdc:mga07m45_61468_c1 3300050496 Bacteria 2128
541 Ga0500578_0043289 3300053086 Bacteria 2890
542 Ga0500562_021166 3300053108 Bacteria 1691
543 Ga0500618_003025 3300053125 Bacteria 5977
544 Ga0500618_028790 3300053125 Bacteria 1313
545 Ga0500559_0063006 3300053136 Bacteria 1657
546 Ga0500616_0000522 3300053153 Bacteria 48622
547 Ga0500645_003708 3300053730 Bacteria 6089
548 Ga0500645_005673 3300053730 Bacteria 4560
549 Ga0500587_005781 3300053739 Bacteria 1655
550 2509127225 2508501125 Bacteria 7208311
551 2511290688 2511231010 Bacteria 6373152
552 2511338048 2511231018 Bacteria 6436256
553 2511342860 2511231019 Bacteria 6520662
554 2511414263 2511231031 Bacteria 6558529
555 2513961270 2513237151 Bacteria 6309801
556 2514047075 2513237166 Bacteria 10373764
557 2527076519 2526164713 Bacteria 6780608
558 2563060745 2562617112 Bacteria 10918404
559 2587759181 2585428062 Bacteria 6842168
560 2600446850 2600254954 Bacteria 5100516
561 2600812360 2600255067 Bacteria 6795583
562 2601797431 2600255318 Bacteria 6383414
563 2606075837 2603880185 Bacteria 6379190
564 2606130874 2603880199 Bacteria 6377649
565 2624481693 2623620443 Bacteria 6427864
566 2713480356 2711768613 Bacteria 11048459
567 2715758091 2713897149 Bacteria 6506249
568 2738820584 2738541296 Bacteria 7285013
569 2738833064 2738541298 Bacteria 7286732
570 2738874591 2738541306 Bacteria 7284992
571 2739186221 2738543002 Bacteria 7284546
572 2739221189 2738543008 Bacteria 7282815
573 2739313823 2738543025 Bacteria 6600348
574 2753568231 2751185846 Bacteria 7242164
575 2792838124 2791355137 Bacteria 9654227
576 2808949752 2808606381 Bacteria 6646461
577 2808960286 2808606382 Bacteria 6841132
578 2808967701 2808606384 Bacteria 8474373
579 2809002532 2808606390 Bacteria 8476311
580 2809009810 2808606391 Bacteria 8308166
581 2842837618 2842832357 Bacteria 5959113
582 2842844411 2842843487 Bacteria 6004777
583 2878033679 2878029506 Bacteria 6418441
584 2904488699 2904483920 Bacteria 7545285
585 2904616837 2904615490 Bacteria 10047340
586 2919069003 2919063839 Bacteria 6302690
587 2919387805 2919385768 Bacteria 5897293
588 2919529312 2919527303 Bacteria 7718827
589 2929205013 2929199973 Bacteria 7260745
590 2931394040 2931390751 Bacteria 6273349
591 2937847545 2937843397 Bacteria 5256375
592 2945938635 2945934425 Bacteria 7444609
593 2974290139 2974289157 Bacteria 6080362
594 2990708635 2990703756 Bacteria 7715990
595 2998143738 2998139840 Bacteria 6073514
596 3007513337 3007511990 Bacteria 6481491
597 3007861036 3007855910 Bacteria 5637581
598 3007861280 3007861166 Bacteria 6045338
599 642426370 641736151 Bacteria 7477263
600 642597550 642555112 Bacteria 8676562
601 8029997096 8029995093 Bacteria 5990776
602 8055272349 8055266321 Bacteria 7999742
603 8055303325 8055301274 Bacteria 8587385
604 8055821052 8055817908 Bacteria 6609162
605 8055913058 8055909800 Bacteria 7278581
606 8056167493 8056166840 Bacteria 5820959
607 Ga0495672_0008048
608 JGI24740J21852_10001480
609 JGI24739J22299_10010995
610 JGI24735J21928_10011185
611 JGI24735J21928_10025010
612 JGI24738J21930_10002369
613 JGI25156J39149_1000573
614 JGI25165J46597_1000691
615 rootL2_10093322
616 JGI25160J50197_1000029
617 Ga0055533_1000323
618 Ga0055532_1000026
619 Ga0055525_1005247
620 Ga0055527_1000018
621 Ga0055535_1000020
622 Ga0055542_1000031
623 Ga0055529_1000036
624 Ga0055536_1000067
625 Ga0055530_10000877
626 Ga0055540_1000163
627 Ga0055531_10000789
628 Ga0058692_1036553
629 Ga0065165_1000040
630 Ga0065714_10139917
631 Ga0070663_100375876
632 Ga0070678_100032990
633 Ga0070672_100644025
634 Ga0070665_100354747
635 Ga0068851_10000280
636 Ga0075366_10235345
637 Ga0075370_10040043
638 Ga0079104_1049726
639 Ga0105251_10006206
640 Ga0105251_10010371
641 Ga0105251_10015118
642 Ga0105251_10058078
643 Ga0105251_10058108
644 Ga0105251_10069487
645 Ga0105244_10019231
646 Ga0105244_10020161
647 Ga0105244_10021745
648 Ga0105244_10033536
649 Ga0105250_10001714
650 Ga0105250_10084431
651 Ga0105250_10085973
652 Ga0105240_10172846
653 Ga0105240_10200780
654 Ga0105240_10634710
655 Ga0105248_10015603
656 Ga0105248_10184734
657 Ga0105238_10162443
658 Ga0157373_10000409
659 Ga0157371_10000396
660 Ga0157371_10002173
661 Ga0157371_10043169
662 Ga0157370_10038781
663 Ga0157370_10073949
664 Ga0157370_10194793
665 Ga0157370_10214844
666 Ga0157369_10000544
667 Ga0157369_10003144
668 Ga0157369_10051031
669 Ga0157369_10056620
670 Ga0157369_10064728
671 Ga0157369_10078768
672 Ga0157369_10115383
673 Ga0157369_10116327
674 Ga0157374_10031635
675 Ga0163162_10086721
676 Ga0163162_10117312
677 Ga0157375_10000100
678 Ga0157375_10017981
679 Ga0182008_10001767
680 Ga0182008_10002290
681 Ga0182008_10059241
682 Ga0182008_10101889
683 Ga0182006_1001771
684 Ga0182006_1014140
685 Ga0182006_1046679
686 Ga0182005_1049749
687 Ga0183361_10004
688 Ga0163161_10000121
689 Ga0163161_10015315
690 Ga0209435_106481
691 Ga0209674_100020
692 Ga0209674_108755
693 Ga0209672_100013
694 Ga0209147_100013
695 Ga0209563_101128
696 Ga0207427_101007
697 Ga0209258_100016
698 Ga0209646_1020829
699 Ga0209677_113973
700 Ga0209148_1000020
701 Ga0209759_1000010
702 Ga0209759_1000083
703 Ga0209759_1010869
704 Ga0209233_1000153
705 Ga0209455_1000017
706 Ga0209130_1003104
707 Ga0209675_1004121
708 Ga0209675_1009812
709 Ga0209676_1000002
710 Ga0209676_1000166
711 Ga0209564_1004023
712 Ga0209050_1000275
713 Ga0209256_1011944
714 Ga0207426_1000004
715 Ga0209051_1000001
716 Ga0209257_1000181
717 Ga0207656_10000271
718 Ga0207696_1000739
719 Ga0207696_1053612
720 Ga0207655_1018380
721 Ga0207655_1023188
722 Ga0207655_1025122
723 Ga0207713_1000231
724 Ga0207713_1000424
725 Ga0207713_1003169
726 Ga0207713_1005816
727 Ga0207713_1040234
728 Ga0207713_1050334
729 Ga0207647_10024595
730 Ga0207647_10028744
731 Ga0207647_10063328
732 Ga0207695_10117470
733 Ga0207681_10005361
734 Ga0207659_10283679
735 Ga0207709_10000045
736 Ga0207691_10413665
737 Ga0207711_10008507
738 Ga0207711_10047821
739 Ga0207711_10417315
740 Ga0207639_10084477
741 Ga0207678_10107204
742 Ga0207683_10048363
743 Ga0209281_1013398
744 Ga0209371_1015917
745 Ga0268266_10006646
746 Ga0307517_10001042
747 Ga0307517_10052668
748 Ga0307517_10168599
749 Ga0307515_10000463
750 Ga0307515_10001074
751 Ga0307515_10033059
752 Ga0307515_10245030
753 Ga0265338_10000325
754 Ga0268256_1009825
755 Ga0307512_10065951
756 Ga0316179_1107741
757 Ga0316178_1056695
758 Ga0307513_10009671
759 Ga0307513_10134735
760 Ga0307408_100034109
761 Ga0307508_10000040
762 Ga0307508_10177392
763 Ga0307516_10004086
764 Ga0307405_10182639
765 Ga0307407_10015706
766 Ga0307412_10000002
767 Ga0307412_10015215
768 Ga0307412_10506008
769 Ga0307409_100003301
770 Ga0307416_100422634
771 Ga0307414_10583565
772 Ga0307411_10005502
773 Ga0307510_10000104
774 Ga0395905_0000035
775 Ga0395905_0122335
776 Ga0436364_0137883
777 Ga0436361_0750749
778 Ga0439438_001468
779 Ga0439438_002602
780 Ga0439447_023581
781 Ga0439447_065812
782 Ga0451807_1085242
783 Ga0451849_0390853
784 Ga0451853_1186014
785 Ga0439431_0017194
786 Ga0439445_0013598
787 Ga0439432_005086
788 Ga0439451_003552
789 Ga0439452_000060
790 Ga0439456_000387
791 Ga0439463_006629
792 Ga0450911_000044
793 Ga0450900_003549
794 Ga0450902_001708
795 Ga0450906_000249
796 Ga0450908_021926
797 Ga0450918_006939
798 Ga0466960_0037283
799 Ga0466967_0171226
800 Ga0495617_002990
801 Ga0495617_005056
802 Ga0495627_000417
803 Ga0495627_000714
804 Ga0495627_011856
805 Ga0495592_0021809
806 Ga0495603_0002996
807 Ga0495603_0006907
808 Ga0495590_0001222
809 Ga0495590_0011316
810 Ga0495590_0024367
811 Ga0495591_001927
812 Ga0495591_015342
813 Ga0495591_018494
814 Ga0495629_0002042
815 Ga0495629_0002913
816 Ga0495638_0000755
817 Ga0495638_0003223
818 Ga0495638_0023587
819 Ga0495653_0013480
820 Ga0495653_0021391
821 Ga0495653_0075585
822 Ga0495650_0000309
823 Ga0495650_0000785
824 Ga0495650_0003731
825 Ga0495650_0006224
826 Ga0495650_0041808
827 Ga0495580_0002321
828 Ga0495580_0002852
829 Ga0495582_0014513
830 Ga0495605_0000032
831 Ga0495605_0001063
832 Ga0495605_0002965
833 Ga0495605_0012808
834 Ga0495605_0013969
835 Ga0495662_0015690
836 Ga0495662_0051284
837 Ga0495664_0004932
838 Ga0495664_0019491
839 Ga0495664_0051934
840 Ga0495584_0000156
841 Ga0495584_0003314
842 Ga0495584_0022262
843 Ga0495584_0083073
844 Ga0495584_0086286
845 Ga0495584_0189388
846 Ga0495585_0007037
847 Ga0495585_0240122
848 Ga0495594_0051975
849 Ga0495596_0011835
850 Ga0495596_0044308
851 Ga0495596_0059576
852 Ga0495607_0001453
853 Ga0495607_0001488
854 Ga0495607_0063236
855 Ga0495583_0000052
856 Ga0495583_0000086
857 Ga0495583_0002895
858 Ga0495583_0012557
859 Ga0495583_0015799
860 Ga0495606_0001056
861 Ga0495606_0001874
862 Ga0495606_0017452
863 Ga0495606_0028197
864 Ga0495606_0040642
865 Ga0495606_0102782
866 Ga0495608_0035872
867 Ga0495610_0000194
868 Ga0495610_0002775
869 Ga0495610_0005243
870 Ga0495610_0008718
871 Ga0495610_0022154
872 Ga0495610_0036386
873 Ga0495616_0002599
874 Ga0495616_0007212
875 Ga0495616_0112674
876 Ga0495618_0011579
877 Ga0495620_0000082
878 Ga0495620_0000324
879 Ga0495620_0001531
880 Ga0495620_0003136
881 Ga0495620_0017133
882 Ga0495620_0023584
883 Ga0495628_0013074
884 Ga0495628_0052095
885 Ga0495628_0085406
886 Ga0495628_0143999
887 Ga0495630_0136150
888 Ga0495630_0174262
889 Ga0495631_0000169
890 Ga0495631_0004313
891 Ga0495631_0045156
892 Ga0495632_0000191
893 Ga0495632_0010056
894 Ga0495632_0034537
895 Ga0495632_0194849
896 Ga0495637_0000164
897 Ga0495637_0003717
898 Ga0495643_0003883
899 Ga0495643_0010891
900 Ga0495643_0026744
901 Ga0495643_0026787
902 Ga0495644_0005953
903 Ga0495648_0000827
904 Ga0495648_0024840
905 Ga0495648_0040350
906 Ga0495666_0000333
907 Ga0495642_0018772
908 Ga0495642_0051422
909 Ga0495642_0127905
910 Ga0495652_0013004
911 Ga0495652_0045262
912 Ga0495652_0229598
913 Ga0495654_0000244
914 Ga0495654_0000802
915 Ga0495654_0001781
916 Ga0495654_0006649
917 Ga0495654_0008051
918 Ga0495654_0033717
919 Ga0495654_0053503
920 Ga0495665_0000006
921 Ga0495665_0133915
922 Ga0495586_0045500
923 Ga0495586_0049975
924 Ga0495609_0000032
925 Ga0495609_0000145
926 Ga0495609_0000770
927 Ga0495609_0001931
928 Ga0495609_0011601
929 Ga0495609_0055853
930 Ga0495597_0000992
931 Ga0495597_0002309
932 Ga0495597_0002611
933 Ga0495597_0005030
934 Ga0495597_0011882
935 Ga0495597_0095069
936 Ga0495597_0096355
937 Ga0495645_0000208
938 Ga0495622_0004276
939 Ga0495622_0005006
940 Ga0495633_0000615
941 Ga0495633_0004982
942 Ga0495667_0023723
943 Ga0495667_0050816
944 Ga0495656_0251201
945 Ga0495668_0099670
946 Ga0495634_0002514
947 Ga0495611_0000052
948 Ga0495611_0010719
949 Ga0495625_0003859
950 Ga0495625_0004472
951 Ga0495625_0005154
952 Ga0495625_0007414
953 Ga0495625_0055491
954 Ga0495635_0014319
955 Ga0495661_0000405
956 Ga0495661_0053724
957 Ga0495661_0075017
958 Ga0495588_0030678
959 Ga0495588_0035830
960 Ga0495657_0161904
961 Ga0495623_0047758
962 Ga0495623_0080074
963 Ga0495646_0003054
964 Ga0495646_0018017
965 Ga0495646_0170122
966 Ga0495658_0016126
967 Ga0495669_0014847
968 Ga0495624_0000446
969 Ga0495624_0000578
970 Ga0495624_0088026
971 Ga0495670_0000293
972 Ga0495670_0029806
973 Ga0495670_0398318
974 Ga0495671_0000435
975 Ga0495671_0002560
976 Ga0495671_0017195
977 Ga0495671_0137063
978 Ga0495671_0233114
979 Ga0495649_0002107
980 Ga0495649_0003440
981 Ga0495649_0015086
982 Ga0495649_0029602
983 Ga0495649_0048291
984 Ga0495649_0056276
985 Ga0495649_0072972
986 Ga0495649_0097484
987 Ga0495589_0000973
988 Ga0495589_0018376
989 Ga0495589_0229587
990 Ga0495600_0302136
991 Ga0495660_0001786
992 Ga0495660_0002290
993 Ga0495660_0004174
994 Ga0495660_0023809
995 Ga0495660_0056130
996 Ga0495660_0087130
997 Ga0495660_0091447
998 Ga0495660_0128221
999 Ga0495581_0004076
1000 Ga0495604_0015519
1001 Ga0495604_0056812
1002 Ga0495674_0002322
1003 Ga0495674_0039597
1004 Ga0495674_0307734
1005 Ga0495672_0010087
1006 Ga0495672_0018842
1007 Ga0495672_0075001
1008 Ga0495676_0000108
1009 Ga0495680_0001268
1010 Ga0495680_0014736
1011 Ga0495683_0000011
1012 Ga0495683_0000281
1013 Ga0495683_0001451
1014 Ga0495683_0106192
1015 Ga0495687_012635
1016 Ga0495687_025928
1017 Ga0495687_036739
1018 Ga0495675_0031931
1019 Ga0495675_0062577
1020 Ga0495675_0141431
1021 Ga0495679_000297
1022 Ga0495679_001697
1023 Ga0495679_003845
1024 Ga0495673_0000077
1025 Ga0495673_0000198
1026 Ga0495673_0000910
1027 Ga0495673_0018339
1028 Ga0495673_0021985
1029 Ga0495673_0022336
1030 Ga0495673_0024238
1031 Ga0495681_0000598
1032 Ga0495681_0004178
1033 Ga0495681_0006267
1034 Ga0495681_0008294
1035 Ga0495681_0118349
1036 Ga0495684_0135007
1037 Ga0495686_0000044
1038 Ga0495686_0001757
1039 Ga0495686_0007379
1040 Ga0495686_0063792
1041 Ga0495686_0088809
1042 Ga0495593_0000259
1043 Ga0495593_0008948
1044 Ga0495593_0018077
1045 Ga0495593_0020591
1046 Ga0495602_0001569
1047 Ga0495602_0043455
1048 Ga0495602_0059112
1049 Ga0495602_0291699
1050 Ga0495614_0006247
1051 Ga0495614_0052701
1052 Ga0495626_0000269
1053 Ga0495626_0007346
1054 Ga0495626_0040934
1055 Ga0496100_0000178
1056 Ga0496100_0002612
1057 Ga0496100_0067379
1058 Ga0496100_0192481
1059 Ga0496101_0013543
1060 Ga0496101_0054912
1061 Ga0496101_0161133
1062 Ga0496102_0000812
1063 Ga0496102_0007688
1064 Ga0496102_0166928
1065 Ga0496102_0184835
1066 Ga0496102_0356841
1067 Ga0496102_0618510
1068 Ga0496103_0008246
1069 Ga0496103_0065850
1070 Ga0496104_0026116
1071 Ga0496104_0047752
1072 Ga0496104_0057282
1073 Ga0496104_0159160
1074 Ga0496105_0008151
1075 Ga0496105_0012039
1076 Ga0496105_0047987
1077 Ga0496106_0005870
1078 Ga0496106_0367314
1079 Ga0496107_0010410
1080 Ga0496107_0229919
1081 Ga0496109_0107096
1082 Ga0496110_0027645
1083 Ga0496111_0078607
1084 Ga0496112_0004958
1085 Ga0496112_0025546
1086 Ga0496113_0054618
1087 Ga0496113_0127189
1088 Ga0496113_0365612
1089 Ga0496114_0000601
1090 Ga0496115_0047386
1091 Ga0496115_0062997
1092 Ga0496116_0000402
1093 Ga0496116_0000899
1094 Ga0496116_0003126
1095 Ga0496116_0018521
1096 Ga0496117_0000697
1097 Ga0496117_0002423
1098 Ga0496117_0002759
1099 Ga0496117_0005366
1100 Ga0496117_0015678
1101 Ga0496117_0040445
1102 Ga0496117_0161562
1103 Ga0496118_0000135
1104 Ga0496118_0006187
1105 Ga0496118_0006644
1106 Ga0496118_0024029
1107 Ga0496118_0061139
1108 Ga0496118_0144336
1109 Ga0496119_0003195
1110 Ga0496119_0012721
1111 Ga0496120_0008082
1112 Ga0496120_0042537
1113 Ga0496121_0000361
1114 Ga0496121_0003581
1115 Ga0496121_0037331
1116 Ga0496121_0060071
1117 Ga0496121_0085926
1118 Ga0496122_0021326
1119 Ga0496122_0024733
1120 Ga0496122_0089098
1121 Ga0496122_0137323
1122 Ga0496122_0143392
1123 Ga0496123_0004360
1124 Ga0496123_0019747
1125 Ga0496123_0029473
1126 Ga0496123_0083106
1127 Ga0496124_0006236
1128 Ga0496124_0041254
1129 Ga0496124_0140384
1130 Ga0496124_0159908
1131 Ga0496125_0014170
1132 Ga0496125_0021611
1133 Ga0496126_0000196
1134 Ga0496126_0000398
1135 Ga0496126_0053823
1136 Ga0496126_0118569
1137 Ga0496126_0439786
1138 Ga0496126_0443455
1139 Ga0495678_000033
1140 Ga0495678_000129
1141 Ga0495678_002800
1142 Ga0495678_019669
1143 Ga0495682_0089050
1144 Ga0501240_004037
1145 nmdc:mga0k408_147882_c1
1146 nmdc:mga07m45_61468_c1
1147 Ga0500578_0043289
1148 Ga0500562_021166
1149 Ga0500618_003025
1150 Ga0500618_028790
1151 Ga0500559_0063006
1152 Ga0500616_0000522
1153 Ga0500645_003708
1154 Ga0500645_005673
1155 Ga0500587_005781
1156 2509127225
1157 2511290688
1158 2511338048
1159 2511342860
1160 2511414263
1161 2513961270
1162 2514047075
1163 2527076519
1164 2563060745
1165 2587759181
1166 2600446850
1167 2600812360
1168 2601797431
1169 2606075837
1170 2606130874
1171 2624481693
1172 2713480356
1173 2715758091
1174 2738820584
1175 2738833064
1176 2738874591
1177 2739186221
1178 2739221189
1179 2739313823
1180 2753568231
1181 2792838124
1182 2808949752
1183 2808960286
1184 2808967701
1185 2809002532
1186 2809009810
1187 2842837618
1188 2842844411
1189 2878033679
1190 2904488699
1191 2904616837
1192 2919069003
1193 2919387805
1194 2919529312
1195 2929205013
1196 2931394040
1197 2937847545
1198 2945938635
1199 2974290139
1200 2990708635
1201 2998143738
1202 3007513337
1203 3007861036
1204 3007861280
1205 642426370
1206 642597550
1207 8029997096
1208 8055272349
1209 8055303325
1210 8055821052
1211 8055913058
1212 8056167493

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00596

Aldolase_II

Class II Aldolase and Adducin N-terminal domain

50

231

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ocr-assembly2.cif.gz_B crystal structure of aldolase ii superfamily protein from pseudomonas syringae 0.9128 21 262
3ocr-assembly1.cif.gz_A crystal structure of aldolase ii superfamily protein from pseudomonas syringae 0.9065 16 262
3ocr-assembly1.cif.gz_A crystal structure of aldolase ii superfamily protein from pseudomonas syringae 0.8894 16 262
4xxf-assembly1.cif.gz_A l-fuculose 1-phosphate aldolase from glaciozyma antarctica pi12 0.8886 25 262
3ocr-assembly2.cif.gz_B crystal structure of aldolase ii superfamily protein from pseudomonas syringae 0.8849 21 262
ID Description Score Start End Superfamily
af_Q54T47_16_268_3.40.225.10 Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain 0.9185 21 262 3.40.225.10
af_Q20952_347_604_3.40.225.10 Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain 0.9144 21 257 3.40.225.10
3ocrB00 Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain 0.9116 21 262 3.40.225.10
af_Q9U9K0_112_366_3.40.225.10 Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain 0.8929 21 259 3.40.225.10
4xxfA00 Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain 0.8885 25 262 3.40.225.10
ID Description Score Start End GO Terms
AF-R4WS08-F1-model_v4 Putative adolase/adducin 0.9887 18 262 GO:0005856
GO:0051015
AF-A0A226WMR9-F1-model_v4 Ribulose-5-phosphate 4-epimerase 0.9871 26 262 GO:0005856
GO:0051015
AF-A0A158JAS6-F1-model_v4 Aldolase 0.9834 1 262 GO:0005856
GO:0051015
AF-B1G7Z7-F1-model_v4 Class II aldolase/adducin family protein 0.9828 1 262 GO:0005856
GO:0051015
AF-A0A1C7ZAK6-F1-model_v4 Class II aldolase/adducin N-terminal domain-containing protein 0.9804 1 262 GO:0005856
GO:0005996
GO:0051015

Map