F468627
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 606 | 309 | 1212 | 259 |
Family's Representative Sequence
| Representative Sequence | 3300047320|Ga0495672_0008048|Ga0495672_0008048_374_1225 |
| Length | 283 |
| Sequence | MQLRTAPLRYTGQREILKAIIMAHTLSVGDPGAPSRTVRLDSDAVMQARVELAACFQLAAQRGYEEGVCNHFSAVVPGHDDLFLVNPYGYAFSEITASRLLVCDFEGHVIAGDGKPEATAFYIHARLHRLKPRLKAAFHTHMPNATALCLLEGPPLLWLGQTALKFYGRTAVDEHYNGLALDESEGDRIAAAMGDADVLFLKNHGVMVAGASIAEVWDDLYYLERAAEVQLKAMASNQPLKPIPHEVAQRTYEQMRLGDAQSARAHLDSALRILRSHGIRFEE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 6 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 7 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 8 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 9 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 10 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 11 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 12 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 13 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 14 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 15 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 16 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 17 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 18 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 19 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 20 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 22 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 23 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 29 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 30 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 31 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 32 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 46 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 47 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 48 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 49 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 51 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 52 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 53 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 54 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 55 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 56 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 57 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 58 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 59 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 60 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 61 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 65 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 67 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 69 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 87 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 90 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 91 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 92 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 93 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 94 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 95 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 96 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 97 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 98 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 99 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 100 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 101 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 102 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 103 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 104 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 105 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 106 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 107 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 108 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 109 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 110 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 111 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 112 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 113 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 114 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 115 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 116 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 117 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 118 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 119 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 120 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 121 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 122 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 123 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 124 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 125 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 126 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 127 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 128 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 129 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 130 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 131 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 216 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 217 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 218 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 219 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 220 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 221 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 222 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 223 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 224 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 225 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 226 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 227 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 228 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 229 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 230 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 231 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 232 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 233 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 234 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 235 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 236 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 237 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 238 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 239 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 240 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 241 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 244 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 245 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 246 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 247 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 248 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 249 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 250 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 251 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 252 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 253 | 2508501125 | Burkholderia sp. WSM2232 | Isolate | Nodule |
| 254 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 255 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 256 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 257 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 258 | 2513237151 | Burkholderia sp. WSM2230 | Isolate | Nodule |
| 259 | 2513237166 | Paraburkholderia azotifigens UYPR1.413 | Isolate | Nodule |
| 260 | 2526164713 | Paraburkholderia phenoliruptrix JPY366 | Isolate | Nodule |
| 261 | 2562617112 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 262 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 263 | 2600254954 | Pseudomonas sp. NFACC19-2 | Isolate | Rhizoplane |
| 264 | 2600255067 | Paraburkholderia kururiensis thiooxydans NBRC 107107 | Isolate | Unclassified |
| 265 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 266 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 267 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 268 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 269 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 270 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 271 | 2738541296 | Paraburkholderia sp. GV073 | Isolate | Unclassified |
| 272 | 2738541298 | Paraburkholderia sp. GV068 | Isolate | Unclassified |
| 273 | 2738541306 | Paraburkholderia sp. GV052 | Isolate | Unclassified |
| 274 | 2738543002 | Paraburkholderia sp. GV072 | Isolate | Unclassified |
| 275 | 2738543008 | Paraburkholderia sp. GV060 | Isolate | Unclassified |
| 276 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 277 | 2751185846 | Paraburkholderia ribeironis STM 7296 | Isolate | Unclassified |
| 278 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 279 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 280 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 281 | 2808606384 | Burkholderia sp. SJZ089 | Isolate | Rhizosphere |
| 282 | 2808606390 | Burkholderia sp. SJZ115 | Isolate | Rhizosphere |
| 283 | 2808606391 | Burkholderia sp. SJZ091 | Isolate | Rhizosphere |
| 284 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 285 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 286 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 287 | 2904483920 | Paraburkholderia caledonica 575 | Isolate | Unclassified |
| 288 | 2904615490 | Paraburkholderia franconis CNPSo 3157 | Isolate | Unclassified |
| 289 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 290 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 291 | 2919527303 | Paraburkholderia strydomiana 3827 | Isolate | Unclassified |
| 292 | 2929199973 | Roseomonas sp. R-73070 Hybrid assembly | Isolate | Unclassified |
| 293 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 294 | 2937843397 | Mesorhizobium xinjiangense lm94 | Isolate | Rhizosphere |
| 295 | 2945934425 | Paraburkholderia graminis W1I13 | Isolate | Rhizosphere |
| 296 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 297 | 2990703756 | Paraburkholderia graminis SLBN-33 | Isolate | Rhizosphere |
| 298 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 299 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 300 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 301 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 302 | 641736151 | Paraburkholderia graminis C4D1M | Isolate | Rhizoplane |
| 303 | 642555112 | Paraburkholderia phymatum STM815 | Isolate | Nodule |
| 304 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 305 | 8055266321 | Paraburkholderia rhynchosiae LMG 27174 | Isolate | Nodule |
| 306 | 8055301274 | Paraburkholderia kirstenboschensis LMG 28727 | Isolate | Nodule |
| 307 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 308 | 8055909800 | Plastoroseomonas hellenica LMG 31523 | Isolate | Unclassified |
| 309 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.59 |
| Metatranscriptomes | 0 |
| Isolates | 9.41 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.09 |
| Nodule | 2.15 |
| Rhizoplane | 7.1 |
| Rhizosphere | 67.82 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495672_0008048 | 3300047320 | Bacteria | 7840 |
| 2 | JGI24740J21852_10001480 | 3300001979 | Bacteria | 10784 |
| 3 | JGI24739J22299_10010995 | 3300001989 | Bacteria | 3347 |
| 4 | JGI24735J21928_10011185 | 3300002067 | Bacteria | 2849 |
| 5 | JGI24735J21928_10025010 | 3300002067 | Bacteria | 1803 |
| 6 | JGI24738J21930_10002369 | 3300002075 | Bacteria | 4957 |
| 7 | JGI25156J39149_1000573 | 3300002705 | Bacteria | 21022 |
| 8 | JGI25165J46597_1000691 | 3300003214 | Bacteria | 27005 |
| 9 | rootL2_10093322 | 3300003322 | Bacteria | 1765 |
| 10 | JGI25160J50197_1000029 | 3300003354 | Bacteria | 179129 |
| 11 | Ga0055533_1000323 | 3300003756 | Bacteria | 21690 |
| 12 | Ga0055532_1000026 | 3300003758 | Bacteria | 238584 |
| 13 | Ga0055525_1005247 | 3300003759 | Bacteria | 1101 |
| 14 | Ga0055527_1000018 | 3300003760 | Bacteria | 238584 |
| 15 | Ga0055535_1000020 | 3300003761 | Bacteria | 238584 |
| 16 | Ga0055542_1000031 | 3300003762 | Bacteria | 238584 |
| 17 | Ga0055529_1000036 | 3300003763 | Bacteria | 238584 |
| 18 | Ga0055536_1000067 | 3300003781 | Bacteria | 96849 |
| 19 | Ga0055530_10000877 | 3300003791 | Bacteria | 24722 |
| 20 | Ga0055540_1000163 | 3300003792 | Bacteria | 66649 |
| 21 | Ga0055531_10000789 | 3300003794 | Bacteria | 26298 |
| 22 | Ga0058692_1036553 | 3300003856 | Bacteria | 888 |
| 23 | Ga0065165_1000040 | 3300005262 | Bacteria | 205767 |
| 24 | Ga0065714_10139917 | 3300005288 | Bacteria | 1180 |
| 25 | Ga0070663_100375876 | 3300005455 | Bacteria | 1156 |
| 26 | Ga0070678_100032990 | 3300005456 | Bacteria | 3590 |
| 27 | Ga0070672_100644025 | 3300005543 | Bacteria | 925 |
| 28 | Ga0070665_100354747 | 3300005548 | Bacteria | 1472 |
| 29 | Ga0068851_10000280 | 3300005834 | Bacteria | 23501 |
| 30 | Ga0075366_10235345 | 3300006195 | Bacteria | 1116 |
| 31 | Ga0075370_10040043 | 3300006353 | Bacteria | 2642 |
| 32 | Ga0079104_1049726 | 3300006946 | Bacteria | 938 |
| 33 | Ga0105251_10006206 | 3300009011 | Bacteria | 7670 |
| 34 | Ga0105251_10010371 | 3300009011 | Bacteria | 5411 |
| 35 | Ga0105251_10015118 | 3300009011 | Bacteria | 4230 |
| 36 | Ga0105251_10058078 | 3300009011 | Bacteria | 1828 |
| 37 | Ga0105251_10058108 | 3300009011 | Bacteria | 1827 |
| 38 | Ga0105251_10069487 | 3300009011 | Bacteria | 1642 |
| 39 | Ga0105244_10019231 | 3300009036 | Bacteria | 3820 |
| 40 | Ga0105244_10020161 | 3300009036 | Bacteria | 3706 |
| 41 | Ga0105244_10021745 | 3300009036 | Bacteria | 3542 |
| 42 | Ga0105244_10033536 | 3300009036 | Bacteria | 2706 |
| 43 | Ga0105250_10001714 | 3300009092 | Bacteria | 11578 |
| 44 | Ga0105250_10084431 | 3300009092 | Bacteria | 1289 |
| 45 | Ga0105250_10085973 | 3300009092 | Bacteria | 1277 |
| 46 | Ga0105240_10172846 | 3300009093 | Bacteria | 2557 |
| 47 | Ga0105240_10200780 | 3300009093 | Bacteria | 2337 |
| 48 | Ga0105240_10634710 | 3300009093 | Bacteria | 1172 |
| 49 | Ga0105248_10015603 | 3300009177 | Bacteria | 8374 |
| 50 | Ga0105248_10184734 | 3300009177 | Bacteria | 2349 |
| 51 | Ga0105238_10162443 | 3300009551 | Bacteria | 2209 |
| 52 | Ga0157373_10000409 | 3300013100 | Bacteria | 34480 |
| 53 | Ga0157371_10000396 | 3300013102 | Bacteria | 54666 |
| 54 | Ga0157371_10002173 | 3300013102 | Bacteria | 19080 |
| 55 | Ga0157371_10043169 | 3300013102 | Bacteria | 3213 |
| 56 | Ga0157370_10038781 | 3300013104 | Bacteria | 4608 |
| 57 | Ga0157370_10073949 | 3300013104 | Bacteria | 3215 |
| 58 | Ga0157370_10194793 | 3300013104 | Bacteria | 1881 |
| 59 | Ga0157370_10214844 | 3300013104 | Bacteria | 1782 |
| 60 | Ga0157369_10000544 | 3300013105 | Bacteria | 49880 |
| 61 | Ga0157369_10003144 | 3300013105 | Bacteria | 19716 |
| 62 | Ga0157369_10051031 | 3300013105 | Bacteria | 4478 |
| 63 | Ga0157369_10056620 | 3300013105 | Bacteria | 4230 |
| 64 | Ga0157369_10064728 | 3300013105 | Bacteria | 3937 |
| 65 | Ga0157369_10078768 | 3300013105 | Bacteria | 3530 |
| 66 | Ga0157369_10115383 | 3300013105 | Bacteria | 2852 |
| 67 | Ga0157369_10116327 | 3300013105 | Bacteria | 2839 |
| 68 | Ga0157374_10031635 | 3300013296 | Bacteria | 4811 |
| 69 | Ga0163162_10086721 | 3300013306 | Bacteria | 3208 |
| 70 | Ga0163162_10117312 | 3300013306 | Bacteria | 2763 |
| 71 | Ga0157375_10000100 | 3300013308 | Bacteria | 87522 |
| 72 | Ga0157375_10017981 | 3300013308 | Bacteria | 6401 |
| 73 | Ga0182008_10001767 | 3300014497 | Bacteria | 14171 |
| 74 | Ga0182008_10002290 | 3300014497 | Bacteria | 12074 |
| 75 | Ga0182008_10059241 | 3300014497 | Bacteria | 1889 |
| 76 | Ga0182008_10101889 | 3300014497 | Bacteria | 1419 |
| 77 | Ga0182006_1001771 | 3300015261 | Bacteria | 12514 |
| 78 | Ga0182006_1014140 | 3300015261 | Bacteria | 3445 |
| 79 | Ga0182006_1046679 | 3300015261 | Bacteria | 1682 |
| 80 | Ga0182005_1049749 | 3300015265 | Bacteria | 1139 |
| 81 | Ga0183361_10004 | 3300016635 | Bacteria | 484183 |
| 82 | Ga0163161_10000121 | 3300017792 | Bacteria | 73471 |
| 83 | Ga0163161_10015315 | 3300017792 | Bacteria | 5346 |
| 84 | Ga0209435_106481 | 3300025206 | Bacteria | 1302 |
| 85 | Ga0209674_100020 | 3300025226 | Bacteria | 672397 |
| 86 | Ga0209674_108755 | 3300025226 | Bacteria | 1175 |
| 87 | Ga0209672_100013 | 3300025228 | Bacteria | 740693 |
| 88 | Ga0209147_100013 | 3300025229 | Bacteria | 660057 |
| 89 | Ga0209563_101128 | 3300025230 | Bacteria | 7552 |
| 90 | Ga0207427_101007 | 3300025231 | Bacteria | 11806 |
| 91 | Ga0209258_100016 | 3300025242 | Bacteria | 668622 |
| 92 | Ga0209646_1020829 | 3300025246 | Bacteria | 946 |
| 93 | Ga0209677_113973 | 3300025253 | Bacteria | 1117 |
| 94 | Ga0209148_1000020 | 3300025254 | Bacteria | 740693 |
| 95 | Ga0209759_1000010 | 3300025256 | Bacteria | 430463 |
| 96 | Ga0209759_1000083 | 3300025256 | Bacteria | 169561 |
| 97 | Ga0209759_1010869 | 3300025256 | Bacteria | 2632 |
| 98 | Ga0209233_1000153 | 3300025261 | Bacteria | 169839 |
| 99 | Ga0209455_1000017 | 3300025272 | Bacteria | 740693 |
| 100 | Ga0209130_1003104 | 3300025284 | Bacteria | 7409 |
| 101 | Ga0209675_1004121 | 3300025291 | Bacteria | 6605 |
| 102 | Ga0209675_1009812 | 3300025291 | Bacteria | 3342 |
| 103 | Ga0209676_1000002 | 3300025292 | Bacteria | 1732948 |
| 104 | Ga0209676_1000166 | 3300025292 | Bacteria | 156596 |
| 105 | Ga0209564_1004023 | 3300025295 | Bacteria | 9301 |
| 106 | Ga0209050_1000275 | 3300025298 | Bacteria | 110235 |
| 107 | Ga0209256_1011944 | 3300025299 | Bacteria | 3402 |
| 108 | Ga0207426_1000004 | 3300025302 | Bacteria | 1047900 |
| 109 | Ga0209051_1000001 | 3300025303 | Bacteria | 1732974 |
| 110 | Ga0209257_1000181 | 3300025304 | Bacteria | 158039 |
| 111 | Ga0207656_10000271 | 3300025321 | Bacteria | 17964 |
| 112 | Ga0207696_1000739 | 3300025711 | Bacteria | 21838 |
| 113 | Ga0207696_1053612 | 3300025711 | Bacteria | 1147 |
| 114 | Ga0207655_1018380 | 3300025728 | Bacteria | 3710 |
| 115 | Ga0207655_1023188 | 3300025728 | Bacteria | 3087 |
| 116 | Ga0207655_1025122 | 3300025728 | Bacteria | 2900 |
| 117 | Ga0207713_1000231 | 3300025735 | Bacteria | 74756 |
| 118 | Ga0207713_1000424 | 3300025735 | Bacteria | 44809 |
| 119 | Ga0207713_1003169 | 3300025735 | Bacteria | 11388 |
| 120 | Ga0207713_1005816 | 3300025735 | Bacteria | 7632 |
| 121 | Ga0207713_1040234 | 3300025735 | Bacteria | 1964 |
| 122 | Ga0207713_1050334 | 3300025735 | Bacteria | 1664 |
| 123 | Ga0207647_10024595 | 3300025904 | Bacteria | 3970 |
| 124 | Ga0207647_10028744 | 3300025904 | Bacteria | 3607 |
| 125 | Ga0207647_10063328 | 3300025904 | Bacteria | 2249 |
| 126 | Ga0207695_10117470 | 3300025913 | Bacteria | 2632 |
| 127 | Ga0207681_10005361 | 3300025923 | Bacteria | 7877 |
| 128 | Ga0207659_10283679 | 3300025926 | Bacteria | 1355 |
| 129 | Ga0207709_10000045 | 3300025935 | Bacteria | 240671 |
| 130 | Ga0207691_10413665 | 3300025940 | Bacteria | 1149 |
| 131 | Ga0207711_10008507 | 3300025941 | Bacteria | 8585 |
| 132 | Ga0207711_10047821 | 3300025941 | Bacteria | 3659 |
| 133 | Ga0207711_10417315 | 3300025941 | Bacteria | 1248 |
| 134 | Ga0207639_10084477 | 3300026041 | Bacteria | 2522 |
| 135 | Ga0207678_10107204 | 3300026067 | Bacteria | 2383 |
| 136 | Ga0207683_10048363 | 3300026121 | Bacteria | 3724 |
| 137 | Ga0209281_1013398 | 3300027111 | Bacteria | 1772 |
| 138 | Ga0209371_1015917 | 3300027312 | Bacteria | 2001 |
| 139 | Ga0268266_10006646 | 3300028379 | Bacteria | 10550 |
| 140 | Ga0307517_10001042 | 3300028786 | Bacteria | 47053 |
| 141 | Ga0307517_10052668 | 3300028786 | Bacteria | 4072 |
| 142 | Ga0307517_10168599 | 3300028786 | Bacteria | 1446 |
| 143 | Ga0307515_10000463 | 3300028794 | Bacteria | 97084 |
| 144 | Ga0307515_10001074 | 3300028794 | Bacteria | 62572 |
| 145 | Ga0307515_10033059 | 3300028794 | Bacteria | 8534 |
| 146 | Ga0307515_10245030 | 3300028794 | Bacteria | 1555 |
| 147 | Ga0265338_10000325 | 3300028800 | Bacteria | 86856 |
| 148 | Ga0268256_1009825 | 3300030500 | Bacteria | 3138 |
| 149 | Ga0307512_10065951 | 3300030522 | Bacteria | 2739 |
| 150 | Ga0316179_1107741 | 3300030734 | Bacteria | 1609 |
| 151 | Ga0316178_1056695 | 3300030735 | Bacteria | 9009 |
| 152 | Ga0307513_10009671 | 3300031456 | Bacteria | 12179 |
| 153 | Ga0307513_10134735 | 3300031456 | Bacteria | 2407 |
| 154 | Ga0307408_100034109 | 3300031548 | Bacteria | 3561 |
| 155 | Ga0307508_10000040 | 3300031616 | Bacteria | 149333 |
| 156 | Ga0307508_10177392 | 3300031616 | Bacteria | 1733 |
| 157 | Ga0307516_10004086 | 3300031730 | Bacteria | 18245 |
| 158 | Ga0307405_10182639 | 3300031731 | Bacteria | 1507 |
| 159 | Ga0307407_10015706 | 3300031903 | Bacteria | 3752 |
| 160 | Ga0307412_10000002 | 3300031911 | Bacteria | 743446 |
| 161 | Ga0307412_10015215 | 3300031911 | Bacteria | 4554 |
| 162 | Ga0307412_10506008 | 3300031911 | Bacteria | 1006 |
| 163 | Ga0307409_100003301 | 3300031995 | Bacteria | 8720 |
| 164 | Ga0307416_100422634 | 3300032002 | Bacteria | 1377 |
| 165 | Ga0307414_10583565 | 3300032004 | Bacteria | 1000 |
| 166 | Ga0307411_10005502 | 3300032005 | Bacteria | 6231 |
| 167 | Ga0307510_10000104 | 3300033180 | Bacteria | 66463 |
| 168 | Ga0395905_0000035 | 3300037471 | Bacteria | 272014 |
| 169 | Ga0395905_0122335 | 3300037471 | Bacteria | 2447 |
| 170 | Ga0436364_0137883 | 3300037853 | Bacteria | 9798 |
| 171 | Ga0436361_0750749 | 3300039447 | Bacteria | 2889 |
| 172 | Ga0439438_001468 | 3300041405 | Bacteria | 10382 |
| 173 | Ga0439438_002602 | 3300041405 | Bacteria | 7622 |
| 174 | Ga0439447_023581 | 3300041407 | Bacteria | 1601 |
| 175 | Ga0439447_065812 | 3300041407 | Bacteria | 847 |
| 176 | Ga0451807_1085242 | 3300041486 | Bacteria | 1197 |
| 177 | Ga0451849_0390853 | 3300041505 | Bacteria | 898 |
| 178 | Ga0451853_1186014 | 3300041512 | Bacteria | 1143 |
| 179 | Ga0439431_0017194 | 3300041997 | Bacteria | 1698 |
| 180 | Ga0439445_0013598 | 3300042004 | Bacteria | 1972 |
| 181 | Ga0439432_005086 | 3300042006 | Bacteria | 4757 |
| 182 | Ga0439451_003552 | 3300042009 | Bacteria | 3161 |
| 183 | Ga0439452_000060 | 3300042010 | Bacteria | 101512 |
| 184 | Ga0439456_000387 | 3300042013 | Bacteria | 9887 |
| 185 | Ga0439463_006629 | 3300042016 | Bacteria | 2867 |
| 186 | Ga0450911_000044 | 3300042115 | Bacteria | 53211 |
| 187 | Ga0450900_003549 | 3300042136 | Bacteria | 1738 |
| 188 | Ga0450902_001708 | 3300042137 | Bacteria | 3024 |
| 189 | Ga0450906_000249 | 3300042145 | Bacteria | 10368 |
| 190 | Ga0450908_021926 | 3300042184 | Bacteria | 1120 |
| 191 | Ga0450918_006939 | 3300042531 | Bacteria | 2013 |
| 192 | Ga0466960_0037283 | 3300044901 | Bacteria | 2280 |
| 193 | Ga0466967_0171226 | 3300045976 | Bacteria | 2043 |
| 194 | Ga0495617_002990 | 3300046452 | Bacteria | 6459 |
| 195 | Ga0495617_005056 | 3300046452 | Bacteria | 4726 |
| 196 | Ga0495627_000417 | 3300046453 | Bacteria | 37602 |
| 197 | Ga0495627_000714 | 3300046453 | Bacteria | 25277 |
| 198 | Ga0495627_011856 | 3300046453 | Bacteria | 3111 |
| 199 | Ga0495592_0021809 | 3300046454 | Bacteria | 4873 |
| 200 | Ga0495603_0002996 | 3300046455 | Bacteria | 10000 |
| 201 | Ga0495603_0006907 | 3300046455 | Bacteria | 6812 |
| 202 | Ga0495590_0001222 | 3300046457 | Bacteria | 11216 |
| 203 | Ga0495590_0011316 | 3300046457 | Bacteria | 3338 |
| 204 | Ga0495590_0024367 | 3300046457 | Bacteria | 2132 |
| 205 | Ga0495591_001927 | 3300046458 | Bacteria | 12168 |
| 206 | Ga0495591_015342 | 3300046458 | Bacteria | 2711 |
| 207 | Ga0495591_018494 | 3300046458 | Bacteria | 2361 |
| 208 | Ga0495629_0002042 | 3300046459 | Bacteria | 15684 |
| 209 | Ga0495629_0002913 | 3300046459 | Bacteria | 13050 |
| 210 | Ga0495638_0000755 | 3300046460 | Bacteria | 34450 |
| 211 | Ga0495638_0003223 | 3300046460 | Bacteria | 12903 |
| 212 | Ga0495638_0023587 | 3300046460 | Bacteria | 4021 |
| 213 | Ga0495653_0013480 | 3300046463 | Bacteria | 6660 |
| 214 | Ga0495653_0021391 | 3300046463 | Bacteria | 5241 |
| 215 | Ga0495653_0075585 | 3300046463 | Bacteria | 2506 |
| 216 | Ga0495650_0000309 | 3300046471 | Bacteria | 88068 |
| 217 | Ga0495650_0000785 | 3300046471 | Bacteria | 38956 |
| 218 | Ga0495650_0003731 | 3300046471 | Bacteria | 10895 |
| 219 | Ga0495650_0006224 | 3300046471 | Bacteria | 7481 |
| 220 | Ga0495650_0041808 | 3300046471 | Bacteria | 1957 |
| 221 | Ga0495580_0002321 | 3300046472 | Bacteria | 16595 |
| 222 | Ga0495580_0002852 | 3300046472 | Bacteria | 14877 |
| 223 | Ga0495582_0014513 | 3300046473 | Bacteria | 4328 |
| 224 | Ga0495605_0000032 | 3300046474 | Bacteria | 210550 |
| 225 | Ga0495605_0001063 | 3300046474 | Bacteria | 18326 |
| 226 | Ga0495605_0002965 | 3300046474 | Bacteria | 10273 |
| 227 | Ga0495605_0012808 | 3300046474 | Bacteria | 4641 |
| 228 | Ga0495605_0013969 | 3300046474 | Bacteria | 4410 |
| 229 | Ga0495662_0015690 | 3300046476 | Bacteria | 3677 |
| 230 | Ga0495662_0051284 | 3300046476 | Bacteria | 1992 |
| 231 | Ga0495664_0004932 | 3300046477 | Bacteria | 7304 |
| 232 | Ga0495664_0019491 | 3300046477 | Bacteria | 3900 |
| 233 | Ga0495664_0051934 | 3300046477 | Bacteria | 2434 |
| 234 | Ga0495584_0000156 | 3300046491 | Bacteria | 47644 |
| 235 | Ga0495584_0003314 | 3300046491 | Bacteria | 8919 |
| 236 | Ga0495584_0022262 | 3300046491 | Bacteria | 3216 |
| 237 | Ga0495584_0083073 | 3300046491 | Bacteria | 1613 |
| 238 | Ga0495584_0086286 | 3300046491 | Bacteria | 1581 |
| 239 | Ga0495584_0189388 | 3300046491 | Bacteria | 1045 |
| 240 | Ga0495585_0007037 | 3300046492 | Bacteria | 6922 |
| 241 | Ga0495585_0240122 | 3300046492 | Bacteria | 907 |
| 242 | Ga0495594_0051975 | 3300046499 | Bacteria | 2255 |
| 243 | Ga0495596_0011835 | 3300046500 | Bacteria | 3746 |
| 244 | Ga0495596_0044308 | 3300046500 | Bacteria | 1751 |
| 245 | Ga0495596_0059576 | 3300046500 | Bacteria | 1488 |
| 246 | Ga0495607_0001453 | 3300046501 | Bacteria | 21093 |
| 247 | Ga0495607_0001488 | 3300046501 | Bacteria | 20800 |
| 248 | Ga0495607_0063236 | 3300046501 | Bacteria | 2094 |
| 249 | Ga0495583_0000052 | 3300046506 | Bacteria | 211902 |
| 250 | Ga0495583_0000086 | 3300046506 | Bacteria | 165176 |
| 251 | Ga0495583_0002895 | 3300046506 | Bacteria | 13876 |
| 252 | Ga0495583_0012557 | 3300046506 | Bacteria | 4783 |
| 253 | Ga0495583_0015799 | 3300046506 | Bacteria | 4087 |
| 254 | Ga0495606_0001056 | 3300046507 | Bacteria | 39812 |
| 255 | Ga0495606_0001874 | 3300046507 | Bacteria | 26367 |
| 256 | Ga0495606_0017452 | 3300046507 | Bacteria | 5426 |
| 257 | Ga0495606_0028197 | 3300046507 | Bacteria | 3965 |
| 258 | Ga0495606_0040642 | 3300046507 | Bacteria | 3125 |
| 259 | Ga0495606_0102782 | 3300046507 | Bacteria | 1737 |
| 260 | Ga0495608_0035872 | 3300046511 | Bacteria | 3341 |
| 261 | Ga0495610_0000194 | 3300046512 | Bacteria | 67667 |
| 262 | Ga0495610_0002775 | 3300046512 | Bacteria | 14357 |
| 263 | Ga0495610_0005243 | 3300046512 | Bacteria | 9274 |
| 264 | Ga0495610_0008718 | 3300046512 | Bacteria | 6521 |
| 265 | Ga0495610_0022154 | 3300046512 | Bacteria | 3480 |
| 266 | Ga0495610_0036386 | 3300046512 | Bacteria | 2516 |
| 267 | Ga0495616_0002599 | 3300046513 | Bacteria | 11881 |
| 268 | Ga0495616_0007212 | 3300046513 | Bacteria | 6664 |
| 269 | Ga0495616_0112674 | 3300046513 | Bacteria | 1262 |
| 270 | Ga0495618_0011579 | 3300046514 | Bacteria | 5352 |
| 271 | Ga0495620_0000082 | 3300046515 | Bacteria | 78939 |
| 272 | Ga0495620_0000324 | 3300046515 | Bacteria | 33602 |
| 273 | Ga0495620_0001531 | 3300046515 | Bacteria | 13739 |
| 274 | Ga0495620_0003136 | 3300046515 | Bacteria | 9499 |
| 275 | Ga0495620_0017133 | 3300046515 | Bacteria | 3619 |
| 276 | Ga0495620_0023584 | 3300046515 | Bacteria | 2939 |
| 277 | Ga0495628_0013074 | 3300046516 | Bacteria | 6990 |
| 278 | Ga0495628_0052095 | 3300046516 | Bacteria | 3233 |
| 279 | Ga0495628_0085406 | 3300046516 | Bacteria | 2448 |
| 280 | Ga0495628_0143999 | 3300046516 | Bacteria | 1817 |
| 281 | Ga0495630_0136150 | 3300046517 | Bacteria | 1866 |
| 282 | Ga0495630_0174262 | 3300046517 | Bacteria | 1639 |
| 283 | Ga0495631_0000169 | 3300046518 | Bacteria | 44458 |
| 284 | Ga0495631_0004313 | 3300046518 | Bacteria | 7585 |
| 285 | Ga0495631_0045156 | 3300046518 | Bacteria | 1940 |
| 286 | Ga0495632_0000191 | 3300046519 | Bacteria | 61820 |
| 287 | Ga0495632_0010056 | 3300046519 | Bacteria | 5637 |
| 288 | Ga0495632_0034537 | 3300046519 | Bacteria | 2587 |
| 289 | Ga0495632_0194849 | 3300046519 | Bacteria | 924 |
| 290 | Ga0495637_0000164 | 3300046520 | Bacteria | 50855 |
| 291 | Ga0495637_0003717 | 3300046520 | Bacteria | 8061 |
| 292 | Ga0495643_0003883 | 3300046522 | Bacteria | 10737 |
| 293 | Ga0495643_0010891 | 3300046522 | Bacteria | 5570 |
| 294 | Ga0495643_0026744 | 3300046522 | Bacteria | 3250 |
| 295 | Ga0495643_0026787 | 3300046522 | Bacteria | 3247 |
| 296 | Ga0495644_0005953 | 3300046523 | Bacteria | 4754 |
| 297 | Ga0495648_0000827 | 3300046524 | Bacteria | 32671 |
| 298 | Ga0495648_0024840 | 3300046524 | Bacteria | 4069 |
| 299 | Ga0495648_0040350 | 3300046524 | Bacteria | 2960 |
| 300 | Ga0495666_0000333 | 3300046526 | Bacteria | 20663 |
| 301 | Ga0495642_0018772 | 3300046528 | Bacteria | 2707 |
| 302 | Ga0495642_0051422 | 3300046528 | Bacteria | 1695 |
| 303 | Ga0495642_0127905 | 3300046528 | Bacteria | 1093 |
| 304 | Ga0495652_0013004 | 3300046529 | Bacteria | 7502 |
| 305 | Ga0495652_0045262 | 3300046529 | Bacteria | 3785 |
| 306 | Ga0495652_0229598 | 3300046529 | Bacteria | 1389 |
| 307 | Ga0495654_0000244 | 3300046530 | Bacteria | 50838 |
| 308 | Ga0495654_0000802 | 3300046530 | Bacteria | 24130 |
| 309 | Ga0495654_0001781 | 3300046530 | Bacteria | 14357 |
| 310 | Ga0495654_0006649 | 3300046530 | Bacteria | 6543 |
| 311 | Ga0495654_0008051 | 3300046530 | Bacteria | 5849 |
| 312 | Ga0495654_0033717 | 3300046530 | Bacteria | 2589 |
| 313 | Ga0495654_0053503 | 3300046530 | Bacteria | 1961 |
| 314 | Ga0495665_0000006 | 3300046531 | Bacteria | 84294 |
| 315 | Ga0495665_0133915 | 3300046531 | Bacteria | 1297 |
| 316 | Ga0495586_0045500 | 3300046535 | Bacteria | 2365 |
| 317 | Ga0495586_0049975 | 3300046535 | Bacteria | 2262 |
| 318 | Ga0495609_0000032 | 3300046538 | Bacteria | 211021 |
| 319 | Ga0495609_0000145 | 3300046538 | Bacteria | 73765 |
| 320 | Ga0495609_0000770 | 3300046538 | Bacteria | 24025 |
| 321 | Ga0495609_0001931 | 3300046538 | Bacteria | 13183 |
| 322 | Ga0495609_0011601 | 3300046538 | Bacteria | 4194 |
| 323 | Ga0495609_0055853 | 3300046538 | Bacteria | 1751 |
| 324 | Ga0495597_0000992 | 3300046542 | Bacteria | 21815 |
| 325 | Ga0495597_0002309 | 3300046542 | Bacteria | 12368 |
| 326 | Ga0495597_0002611 | 3300046542 | Bacteria | 11211 |
| 327 | Ga0495597_0005030 | 3300046542 | Bacteria | 7080 |
| 328 | Ga0495597_0011882 | 3300046542 | Bacteria | 4214 |
| 329 | Ga0495597_0095069 | 3300046542 | Bacteria | 1261 |
| 330 | Ga0495597_0096355 | 3300046542 | Bacteria | 1251 |
| 331 | Ga0495645_0000208 | 3300046543 | Bacteria | 42020 |
| 332 | Ga0495622_0004276 | 3300046557 | Bacteria | 6646 |
| 333 | Ga0495622_0005006 | 3300046557 | Bacteria | 6140 |
| 334 | Ga0495633_0000615 | 3300046558 | Bacteria | 33796 |
| 335 | Ga0495633_0004982 | 3300046558 | Bacteria | 8286 |
| 336 | Ga0495667_0023723 | 3300046559 | Bacteria | 4133 |
| 337 | Ga0495667_0050816 | 3300046559 | Bacteria | 2736 |
| 338 | Ga0495656_0251201 | 3300046615 | Bacteria | 893 |
| 339 | Ga0495668_0099670 | 3300046616 | Bacteria | 1589 |
| 340 | Ga0495634_0002514 | 3300046642 | Bacteria | 15201 |
| 341 | Ga0495611_0000052 | 3300046648 | Bacteria | 83237 |
| 342 | Ga0495611_0010719 | 3300046648 | Bacteria | 3881 |
| 343 | Ga0495625_0003859 | 3300046660 | Bacteria | 14487 |
| 344 | Ga0495625_0004472 | 3300046660 | Bacteria | 13205 |
| 345 | Ga0495625_0005154 | 3300046660 | Bacteria | 12056 |
| 346 | Ga0495625_0007414 | 3300046660 | Bacteria | 9551 |
| 347 | Ga0495625_0055491 | 3300046660 | Bacteria | 2825 |
| 348 | Ga0495635_0014319 | 3300046663 | Bacteria | 5549 |
| 349 | Ga0495661_0000405 | 3300046665 | Bacteria | 45802 |
| 350 | Ga0495661_0053724 | 3300046665 | Bacteria | 2421 |
| 351 | Ga0495661_0075017 | 3300046665 | Bacteria | 1966 |
| 352 | Ga0495588_0030678 | 3300046674 | Bacteria | 2703 |
| 353 | Ga0495588_0035830 | 3300046674 | Bacteria | 2516 |
| 354 | Ga0495657_0161904 | 3300046675 | Bacteria | 1384 |
| 355 | Ga0495623_0047758 | 3300046679 | Bacteria | 2717 |
| 356 | Ga0495623_0080074 | 3300046679 | Bacteria | 2022 |
| 357 | Ga0495646_0003054 | 3300046680 | Bacteria | 10374 |
| 358 | Ga0495646_0018017 | 3300046680 | Bacteria | 4472 |
| 359 | Ga0495646_0170122 | 3300046680 | Bacteria | 1201 |
| 360 | Ga0495658_0016126 | 3300046683 | Bacteria | 3845 |
| 361 | Ga0495669_0014847 | 3300046684 | Bacteria | 3332 |
| 362 | Ga0495624_0000446 | 3300046690 | Bacteria | 32513 |
| 363 | Ga0495624_0000578 | 3300046690 | Bacteria | 28629 |
| 364 | Ga0495624_0088026 | 3300046690 | Bacteria | 1917 |
| 365 | Ga0495670_0000293 | 3300046691 | Bacteria | 23617 |
| 366 | Ga0495670_0029806 | 3300046691 | Bacteria | 2710 |
| 367 | Ga0495670_0398318 | 3300046691 | Bacteria | 743 |
| 368 | Ga0495671_0000435 | 3300046692 | Bacteria | 33185 |
| 369 | Ga0495671_0002560 | 3300046692 | Bacteria | 11432 |
| 370 | Ga0495671_0017195 | 3300046692 | Bacteria | 3849 |
| 371 | Ga0495671_0137063 | 3300046692 | Bacteria | 1193 |
| 372 | Ga0495671_0233114 | 3300046692 | Bacteria | 890 |
| 373 | Ga0495649_0002107 | 3300046694 | Bacteria | 14272 |
| 374 | Ga0495649_0003440 | 3300046694 | Bacteria | 10680 |
| 375 | Ga0495649_0015086 | 3300046694 | Bacteria | 4404 |
| 376 | Ga0495649_0029602 | 3300046694 | Bacteria | 3028 |
| 377 | Ga0495649_0048291 | 3300046694 | Bacteria | 2313 |
| 378 | Ga0495649_0056276 | 3300046694 | Bacteria | 2124 |
| 379 | Ga0495649_0072972 | 3300046694 | Bacteria | 1839 |
| 380 | Ga0495649_0097484 | 3300046694 | Bacteria | 1564 |
| 381 | Ga0495589_0000973 | 3300046794 | Bacteria | 17487 |
| 382 | Ga0495589_0018376 | 3300046794 | Bacteria | 3585 |
| 383 | Ga0495589_0229587 | 3300046794 | Bacteria | 870 |
| 384 | Ga0495600_0302136 | 3300046809 | Bacteria | 1010 |
| 385 | Ga0495660_0001786 | 3300046810 | Bacteria | 14206 |
| 386 | Ga0495660_0002290 | 3300046810 | Bacteria | 12305 |
| 387 | Ga0495660_0004174 | 3300046810 | Bacteria | 8785 |
| 388 | Ga0495660_0023809 | 3300046810 | Bacteria | 3491 |
| 389 | Ga0495660_0056130 | 3300046810 | Bacteria | 2129 |
| 390 | Ga0495660_0087130 | 3300046810 | Bacteria | 1629 |
| 391 | Ga0495660_0091447 | 3300046810 | Bacteria | 1580 |
| 392 | Ga0495660_0128221 | 3300046810 | Bacteria | 1275 |
| 393 | Ga0495581_0004076 | 3300047315 | Bacteria | 8416 |
| 394 | Ga0495604_0015519 | 3300047317 | Bacteria | 6080 |
| 395 | Ga0495604_0056812 | 3300047317 | Bacteria | 3010 |
| 396 | Ga0495674_0002322 | 3300047319 | Bacteria | 18678 |
| 397 | Ga0495674_0039597 | 3300047319 | Bacteria | 4223 |
| 398 | Ga0495674_0307734 | 3300047319 | Bacteria | 1293 |
| 399 | Ga0495672_0010087 | 3300047320 | Bacteria | 6761 |
| 400 | Ga0495672_0018842 | 3300047320 | Bacteria | 4571 |
| 401 | Ga0495672_0075001 | 3300047320 | Bacteria | 1903 |
| 402 | Ga0495676_0000108 | 3300047321 | Bacteria | 62522 |
| 403 | Ga0495680_0001268 | 3300047322 | Bacteria | 27528 |
| 404 | Ga0495680_0014736 | 3300047322 | Bacteria | 6758 |
| 405 | Ga0495683_0000011 | 3300047323 | Bacteria | 212053 |
| 406 | Ga0495683_0000281 | 3300047323 | Bacteria | 44019 |
| 407 | Ga0495683_0001451 | 3300047323 | Bacteria | 15557 |
| 408 | Ga0495683_0106192 | 3300047323 | Bacteria | 1345 |
| 409 | Ga0495687_012635 | 3300047443 | Bacteria | 4451 |
| 410 | Ga0495687_025928 | 3300047443 | Bacteria | 2764 |
| 411 | Ga0495687_036739 | 3300047443 | Bacteria | 2188 |
| 412 | Ga0495675_0031931 | 3300047444 | Bacteria | 3362 |
| 413 | Ga0495675_0062577 | 3300047444 | Bacteria | 2356 |
| 414 | Ga0495675_0141431 | 3300047444 | Bacteria | 1491 |
| 415 | Ga0495679_000297 | 3300047446 | Bacteria | 40193 |
| 416 | Ga0495679_001697 | 3300047446 | Bacteria | 12200 |
| 417 | Ga0495679_003845 | 3300047446 | Bacteria | 7108 |
| 418 | Ga0495673_0000077 | 3300047469 | Bacteria | 204403 |
| 419 | Ga0495673_0000198 | 3300047469 | Bacteria | 93985 |
| 420 | Ga0495673_0000910 | 3300047469 | Bacteria | 27015 |
| 421 | Ga0495673_0018339 | 3300047469 | Bacteria | 3530 |
| 422 | Ga0495673_0021985 | 3300047469 | Bacteria | 3134 |
| 423 | Ga0495673_0022336 | 3300047469 | Bacteria | 3103 |
| 424 | Ga0495673_0024238 | 3300047469 | Bacteria | 2937 |
| 425 | Ga0495681_0000598 | 3300047470 | Bacteria | 27518 |
| 426 | Ga0495681_0004178 | 3300047470 | Bacteria | 9918 |
| 427 | Ga0495681_0006267 | 3300047470 | Bacteria | 7835 |
| 428 | Ga0495681_0008294 | 3300047470 | Bacteria | 6526 |
| 429 | Ga0495681_0118349 | 3300047470 | Bacteria | 1139 |
| 430 | Ga0495684_0135007 | 3300047471 | Bacteria | 1852 |
| 431 | Ga0495686_0000044 | 3300047472 | Bacteria | 288079 |
| 432 | Ga0495686_0001757 | 3300047472 | Bacteria | 22218 |
| 433 | Ga0495686_0007379 | 3300047472 | Bacteria | 8248 |
| 434 | Ga0495686_0063792 | 3300047472 | Bacteria | 2282 |
| 435 | Ga0495686_0088809 | 3300047472 | Bacteria | 1879 |
| 436 | Ga0495593_0000259 | 3300047673 | Bacteria | 28522 |
| 437 | Ga0495593_0008948 | 3300047673 | Bacteria | 5812 |
| 438 | Ga0495593_0018077 | 3300047673 | Bacteria | 3964 |
| 439 | Ga0495593_0020591 | 3300047673 | Bacteria | 3693 |
| 440 | Ga0495602_0001569 | 3300048088 | Bacteria | 22764 |
| 441 | Ga0495602_0043455 | 3300048088 | Bacteria | 4085 |
| 442 | Ga0495602_0059112 | 3300048088 | Bacteria | 3349 |
| 443 | Ga0495602_0291699 | 3300048088 | Bacteria | 1197 |
| 444 | Ga0495614_0006247 | 3300048089 | Bacteria | 5356 |
| 445 | Ga0495614_0052701 | 3300048089 | Bacteria | 1744 |
| 446 | Ga0495626_0000269 | 3300048091 | Bacteria | 57715 |
| 447 | Ga0495626_0007346 | 3300048091 | Bacteria | 6139 |
| 448 | Ga0495626_0040934 | 3300048091 | Bacteria | 2185 |
| 449 | Ga0496100_0000178 | 3300048903 | Bacteria | 35414 |
| 450 | Ga0496100_0002612 | 3300048903 | Bacteria | 9183 |
| 451 | Ga0496100_0067379 | 3300048903 | Bacteria | 2377 |
| 452 | Ga0496100_0192481 | 3300048903 | Bacteria | 1481 |
| 453 | Ga0496101_0013543 | 3300048904 | Bacteria | 5468 |
| 454 | Ga0496101_0054912 | 3300048904 | Bacteria | 2875 |
| 455 | Ga0496101_0161133 | 3300048904 | Bacteria | 1720 |
| 456 | Ga0496102_0000812 | 3300048905 | Bacteria | 30387 |
| 457 | Ga0496102_0007688 | 3300048905 | Bacteria | 9208 |
| 458 | Ga0496102_0166928 | 3300048905 | Bacteria | 2071 |
| 459 | Ga0496102_0184835 | 3300048905 | Bacteria | 1964 |
| 460 | Ga0496102_0356841 | 3300048905 | Bacteria | 1376 |
| 461 | Ga0496102_0618510 | 3300048905 | Bacteria | 1006 |
| 462 | Ga0496103_0008246 | 3300048906 | Bacteria | 6185 |
| 463 | Ga0496103_0065850 | 3300048906 | Bacteria | 2260 |
| 464 | Ga0496104_0026116 | 3300048907 | Bacteria | 5388 |
| 465 | Ga0496104_0047752 | 3300048907 | Bacteria | 4035 |
| 466 | Ga0496104_0057282 | 3300048907 | Bacteria | 3687 |
| 467 | Ga0496104_0159160 | 3300048907 | Bacteria | 2166 |
| 468 | Ga0496105_0008151 | 3300048908 | Bacteria | 8145 |
| 469 | Ga0496105_0012039 | 3300048908 | Bacteria | 6848 |
| 470 | Ga0496105_0047987 | 3300048908 | Bacteria | 3524 |
| 471 | Ga0496106_0005870 | 3300048909 | Bacteria | 9081 |
| 472 | Ga0496106_0367314 | 3300048909 | Bacteria | 1156 |
| 473 | Ga0496107_0010410 | 3300048910 | Bacteria | 6458 |
| 474 | Ga0496107_0229919 | 3300048910 | Bacteria | 1380 |
| 475 | Ga0496109_0107096 | 3300048912 | Bacteria | 2596 |
| 476 | Ga0496110_0027645 | 3300048913 | Bacteria | 4863 |
| 477 | Ga0496111_0078607 | 3300048914 | Bacteria | 2406 |
| 478 | Ga0496112_0004958 | 3300048915 | Bacteria | 11405 |
| 479 | Ga0496112_0025546 | 3300048915 | Bacteria | 5672 |
| 480 | Ga0496113_0054618 | 3300048916 | Bacteria | 2990 |
| 481 | Ga0496113_0127189 | 3300048916 | Bacteria | 1996 |
| 482 | Ga0496113_0365612 | 3300048916 | Bacteria | 1158 |
| 483 | Ga0496114_0000601 | 3300048917 | Bacteria | 26597 |
| 484 | Ga0496115_0047386 | 3300048918 | Bacteria | 3437 |
| 485 | Ga0496115_0062997 | 3300048918 | Bacteria | 2992 |
| 486 | Ga0496116_0000402 | 3300048919 | Bacteria | 62213 |
| 487 | Ga0496116_0000899 | 3300048919 | Bacteria | 36846 |
| 488 | Ga0496116_0003126 | 3300048919 | Bacteria | 16629 |
| 489 | Ga0496116_0018521 | 3300048919 | Bacteria | 5363 |
| 490 | Ga0496117_0000697 | 3300048920 | Bacteria | 53296 |
| 491 | Ga0496117_0002423 | 3300048920 | Bacteria | 23609 |
| 492 | Ga0496117_0002759 | 3300048920 | Bacteria | 21513 |
| 493 | Ga0496117_0005366 | 3300048920 | Bacteria | 13504 |
| 494 | Ga0496117_0015678 | 3300048920 | Bacteria | 6438 |
| 495 | Ga0496117_0040445 | 3300048920 | Bacteria | 3428 |
| 496 | Ga0496117_0161562 | 3300048920 | Bacteria | 1312 |
| 497 | Ga0496118_0000135 | 3300048921 | Bacteria | 130330 |
| 498 | Ga0496118_0006187 | 3300048921 | Bacteria | 13263 |
| 499 | Ga0496118_0006644 | 3300048921 | Bacteria | 12626 |
| 500 | Ga0496118_0024029 | 3300048921 | Bacteria | 5274 |
| 501 | Ga0496118_0061139 | 3300048921 | Bacteria | 2791 |
| 502 | Ga0496118_0144336 | 3300048921 | Bacteria | 1502 |
| 503 | Ga0496119_0003195 | 3300048922 | Bacteria | 17172 |
| 504 | Ga0496119_0012721 | 3300048922 | Bacteria | 6800 |
| 505 | Ga0496120_0008082 | 3300048923 | Bacteria | 7732 |
| 506 | Ga0496120_0042537 | 3300048923 | Bacteria | 2652 |
| 507 | Ga0496121_0000361 | 3300048924 | Bacteria | 93571 |
| 508 | Ga0496121_0003581 | 3300048924 | Bacteria | 21934 |
| 509 | Ga0496121_0037331 | 3300048924 | Bacteria | 4317 |
| 510 | Ga0496121_0060071 | 3300048924 | Bacteria | 3130 |
| 511 | Ga0496121_0085926 | 3300048924 | Bacteria | 2474 |
| 512 | Ga0496122_0021326 | 3300048925 | Bacteria | 5804 |
| 513 | Ga0496122_0024733 | 3300048925 | Bacteria | 5245 |
| 514 | Ga0496122_0089098 | 3300048925 | Bacteria | 2111 |
| 515 | Ga0496122_0137323 | 3300048925 | Bacteria | 1537 |
| 516 | Ga0496122_0143392 | 3300048925 | Bacteria | 1489 |
| 517 | Ga0496123_0004360 | 3300048926 | Bacteria | 14958 |
| 518 | Ga0496123_0019747 | 3300048926 | Bacteria | 5299 |
| 519 | Ga0496123_0029473 | 3300048926 | Bacteria | 4039 |
| 520 | Ga0496123_0083106 | 3300048926 | Bacteria | 1938 |
| 521 | Ga0496124_0006236 | 3300048927 | Bacteria | 13065 |
| 522 | Ga0496124_0041254 | 3300048927 | Bacteria | 3984 |
| 523 | Ga0496124_0140384 | 3300048927 | Bacteria | 1907 |
| 524 | Ga0496124_0159908 | 3300048927 | Bacteria | 1757 |
| 525 | Ga0496125_0014170 | 3300048928 | Bacteria | 7776 |
| 526 | Ga0496125_0021611 | 3300048928 | Bacteria | 5997 |
| 527 | Ga0496126_0000196 | 3300048929 | Bacteria | 134394 |
| 528 | Ga0496126_0000398 | 3300048929 | Bacteria | 89253 |
| 529 | Ga0496126_0053823 | 3300048929 | Bacteria | 3649 |
| 530 | Ga0496126_0118569 | 3300048929 | Bacteria | 2297 |
| 531 | Ga0496126_0439786 | 3300048929 | Bacteria | 1051 |
| 532 | Ga0496126_0443455 | 3300048929 | Bacteria | 1046 |
| 533 | Ga0495678_000033 | 3300049459 | Bacteria | 211804 |
| 534 | Ga0495678_000129 | 3300049459 | Bacteria | 88910 |
| 535 | Ga0495678_002800 | 3300049459 | Bacteria | 11344 |
| 536 | Ga0495678_019669 | 3300049459 | Bacteria | 3006 |
| 537 | Ga0495682_0089050 | 3300049460 | Bacteria | 1109 |
| 538 | Ga0501240_004037 | 3300049673 | Bacteria | 1678 |
| 539 | nmdc:mga0k408_147882_c1 | 3300050493 | Bacteria | 1399 |
| 540 | nmdc:mga07m45_61468_c1 | 3300050496 | Bacteria | 2128 |
| 541 | Ga0500578_0043289 | 3300053086 | Bacteria | 2890 |
| 542 | Ga0500562_021166 | 3300053108 | Bacteria | 1691 |
| 543 | Ga0500618_003025 | 3300053125 | Bacteria | 5977 |
| 544 | Ga0500618_028790 | 3300053125 | Bacteria | 1313 |
| 545 | Ga0500559_0063006 | 3300053136 | Bacteria | 1657 |
| 546 | Ga0500616_0000522 | 3300053153 | Bacteria | 48622 |
| 547 | Ga0500645_003708 | 3300053730 | Bacteria | 6089 |
| 548 | Ga0500645_005673 | 3300053730 | Bacteria | 4560 |
| 549 | Ga0500587_005781 | 3300053739 | Bacteria | 1655 |
| 550 | 2509127225 | 2508501125 | Bacteria | 7208311 |
| 551 | 2511290688 | 2511231010 | Bacteria | 6373152 |
| 552 | 2511338048 | 2511231018 | Bacteria | 6436256 |
| 553 | 2511342860 | 2511231019 | Bacteria | 6520662 |
| 554 | 2511414263 | 2511231031 | Bacteria | 6558529 |
| 555 | 2513961270 | 2513237151 | Bacteria | 6309801 |
| 556 | 2514047075 | 2513237166 | Bacteria | 10373764 |
| 557 | 2527076519 | 2526164713 | Bacteria | 6780608 |
| 558 | 2563060745 | 2562617112 | Bacteria | 10918404 |
| 559 | 2587759181 | 2585428062 | Bacteria | 6842168 |
| 560 | 2600446850 | 2600254954 | Bacteria | 5100516 |
| 561 | 2600812360 | 2600255067 | Bacteria | 6795583 |
| 562 | 2601797431 | 2600255318 | Bacteria | 6383414 |
| 563 | 2606075837 | 2603880185 | Bacteria | 6379190 |
| 564 | 2606130874 | 2603880199 | Bacteria | 6377649 |
| 565 | 2624481693 | 2623620443 | Bacteria | 6427864 |
| 566 | 2713480356 | 2711768613 | Bacteria | 11048459 |
| 567 | 2715758091 | 2713897149 | Bacteria | 6506249 |
| 568 | 2738820584 | 2738541296 | Bacteria | 7285013 |
| 569 | 2738833064 | 2738541298 | Bacteria | 7286732 |
| 570 | 2738874591 | 2738541306 | Bacteria | 7284992 |
| 571 | 2739186221 | 2738543002 | Bacteria | 7284546 |
| 572 | 2739221189 | 2738543008 | Bacteria | 7282815 |
| 573 | 2739313823 | 2738543025 | Bacteria | 6600348 |
| 574 | 2753568231 | 2751185846 | Bacteria | 7242164 |
| 575 | 2792838124 | 2791355137 | Bacteria | 9654227 |
| 576 | 2808949752 | 2808606381 | Bacteria | 6646461 |
| 577 | 2808960286 | 2808606382 | Bacteria | 6841132 |
| 578 | 2808967701 | 2808606384 | Bacteria | 8474373 |
| 579 | 2809002532 | 2808606390 | Bacteria | 8476311 |
| 580 | 2809009810 | 2808606391 | Bacteria | 8308166 |
| 581 | 2842837618 | 2842832357 | Bacteria | 5959113 |
| 582 | 2842844411 | 2842843487 | Bacteria | 6004777 |
| 583 | 2878033679 | 2878029506 | Bacteria | 6418441 |
| 584 | 2904488699 | 2904483920 | Bacteria | 7545285 |
| 585 | 2904616837 | 2904615490 | Bacteria | 10047340 |
| 586 | 2919069003 | 2919063839 | Bacteria | 6302690 |
| 587 | 2919387805 | 2919385768 | Bacteria | 5897293 |
| 588 | 2919529312 | 2919527303 | Bacteria | 7718827 |
| 589 | 2929205013 | 2929199973 | Bacteria | 7260745 |
| 590 | 2931394040 | 2931390751 | Bacteria | 6273349 |
| 591 | 2937847545 | 2937843397 | Bacteria | 5256375 |
| 592 | 2945938635 | 2945934425 | Bacteria | 7444609 |
| 593 | 2974290139 | 2974289157 | Bacteria | 6080362 |
| 594 | 2990708635 | 2990703756 | Bacteria | 7715990 |
| 595 | 2998143738 | 2998139840 | Bacteria | 6073514 |
| 596 | 3007513337 | 3007511990 | Bacteria | 6481491 |
| 597 | 3007861036 | 3007855910 | Bacteria | 5637581 |
| 598 | 3007861280 | 3007861166 | Bacteria | 6045338 |
| 599 | 642426370 | 641736151 | Bacteria | 7477263 |
| 600 | 642597550 | 642555112 | Bacteria | 8676562 |
| 601 | 8029997096 | 8029995093 | Bacteria | 5990776 |
| 602 | 8055272349 | 8055266321 | Bacteria | 7999742 |
| 603 | 8055303325 | 8055301274 | Bacteria | 8587385 |
| 604 | 8055821052 | 8055817908 | Bacteria | 6609162 |
| 605 | 8055913058 | 8055909800 | Bacteria | 7278581 |
| 606 | 8056167493 | 8056166840 | Bacteria | 5820959 |
| 607 | Ga0495672_0008048 | |||
| 608 | JGI24740J21852_10001480 | |||
| 609 | JGI24739J22299_10010995 | |||
| 610 | JGI24735J21928_10011185 | |||
| 611 | JGI24735J21928_10025010 | |||
| 612 | JGI24738J21930_10002369 | |||
| 613 | JGI25156J39149_1000573 | |||
| 614 | JGI25165J46597_1000691 | |||
| 615 | rootL2_10093322 | |||
| 616 | JGI25160J50197_1000029 | |||
| 617 | Ga0055533_1000323 | |||
| 618 | Ga0055532_1000026 | |||
| 619 | Ga0055525_1005247 | |||
| 620 | Ga0055527_1000018 | |||
| 621 | Ga0055535_1000020 | |||
| 622 | Ga0055542_1000031 | |||
| 623 | Ga0055529_1000036 | |||
| 624 | Ga0055536_1000067 | |||
| 625 | Ga0055530_10000877 | |||
| 626 | Ga0055540_1000163 | |||
| 627 | Ga0055531_10000789 | |||
| 628 | Ga0058692_1036553 | |||
| 629 | Ga0065165_1000040 | |||
| 630 | Ga0065714_10139917 | |||
| 631 | Ga0070663_100375876 | |||
| 632 | Ga0070678_100032990 | |||
| 633 | Ga0070672_100644025 | |||
| 634 | Ga0070665_100354747 | |||
| 635 | Ga0068851_10000280 | |||
| 636 | Ga0075366_10235345 | |||
| 637 | Ga0075370_10040043 | |||
| 638 | Ga0079104_1049726 | |||
| 639 | Ga0105251_10006206 | |||
| 640 | Ga0105251_10010371 | |||
| 641 | Ga0105251_10015118 | |||
| 642 | Ga0105251_10058078 | |||
| 643 | Ga0105251_10058108 | |||
| 644 | Ga0105251_10069487 | |||
| 645 | Ga0105244_10019231 | |||
| 646 | Ga0105244_10020161 | |||
| 647 | Ga0105244_10021745 | |||
| 648 | Ga0105244_10033536 | |||
| 649 | Ga0105250_10001714 | |||
| 650 | Ga0105250_10084431 | |||
| 651 | Ga0105250_10085973 | |||
| 652 | Ga0105240_10172846 | |||
| 653 | Ga0105240_10200780 | |||
| 654 | Ga0105240_10634710 | |||
| 655 | Ga0105248_10015603 | |||
| 656 | Ga0105248_10184734 | |||
| 657 | Ga0105238_10162443 | |||
| 658 | Ga0157373_10000409 | |||
| 659 | Ga0157371_10000396 | |||
| 660 | Ga0157371_10002173 | |||
| 661 | Ga0157371_10043169 | |||
| 662 | Ga0157370_10038781 | |||
| 663 | Ga0157370_10073949 | |||
| 664 | Ga0157370_10194793 | |||
| 665 | Ga0157370_10214844 | |||
| 666 | Ga0157369_10000544 | |||
| 667 | Ga0157369_10003144 | |||
| 668 | Ga0157369_10051031 | |||
| 669 | Ga0157369_10056620 | |||
| 670 | Ga0157369_10064728 | |||
| 671 | Ga0157369_10078768 | |||
| 672 | Ga0157369_10115383 | |||
| 673 | Ga0157369_10116327 | |||
| 674 | Ga0157374_10031635 | |||
| 675 | Ga0163162_10086721 | |||
| 676 | Ga0163162_10117312 | |||
| 677 | Ga0157375_10000100 | |||
| 678 | Ga0157375_10017981 | |||
| 679 | Ga0182008_10001767 | |||
| 680 | Ga0182008_10002290 | |||
| 681 | Ga0182008_10059241 | |||
| 682 | Ga0182008_10101889 | |||
| 683 | Ga0182006_1001771 | |||
| 684 | Ga0182006_1014140 | |||
| 685 | Ga0182006_1046679 | |||
| 686 | Ga0182005_1049749 | |||
| 687 | Ga0183361_10004 | |||
| 688 | Ga0163161_10000121 | |||
| 689 | Ga0163161_10015315 | |||
| 690 | Ga0209435_106481 | |||
| 691 | Ga0209674_100020 | |||
| 692 | Ga0209674_108755 | |||
| 693 | Ga0209672_100013 | |||
| 694 | Ga0209147_100013 | |||
| 695 | Ga0209563_101128 | |||
| 696 | Ga0207427_101007 | |||
| 697 | Ga0209258_100016 | |||
| 698 | Ga0209646_1020829 | |||
| 699 | Ga0209677_113973 | |||
| 700 | Ga0209148_1000020 | |||
| 701 | Ga0209759_1000010 | |||
| 702 | Ga0209759_1000083 | |||
| 703 | Ga0209759_1010869 | |||
| 704 | Ga0209233_1000153 | |||
| 705 | Ga0209455_1000017 | |||
| 706 | Ga0209130_1003104 | |||
| 707 | Ga0209675_1004121 | |||
| 708 | Ga0209675_1009812 | |||
| 709 | Ga0209676_1000002 | |||
| 710 | Ga0209676_1000166 | |||
| 711 | Ga0209564_1004023 | |||
| 712 | Ga0209050_1000275 | |||
| 713 | Ga0209256_1011944 | |||
| 714 | Ga0207426_1000004 | |||
| 715 | Ga0209051_1000001 | |||
| 716 | Ga0209257_1000181 | |||
| 717 | Ga0207656_10000271 | |||
| 718 | Ga0207696_1000739 | |||
| 719 | Ga0207696_1053612 | |||
| 720 | Ga0207655_1018380 | |||
| 721 | Ga0207655_1023188 | |||
| 722 | Ga0207655_1025122 | |||
| 723 | Ga0207713_1000231 | |||
| 724 | Ga0207713_1000424 | |||
| 725 | Ga0207713_1003169 | |||
| 726 | Ga0207713_1005816 | |||
| 727 | Ga0207713_1040234 | |||
| 728 | Ga0207713_1050334 | |||
| 729 | Ga0207647_10024595 | |||
| 730 | Ga0207647_10028744 | |||
| 731 | Ga0207647_10063328 | |||
| 732 | Ga0207695_10117470 | |||
| 733 | Ga0207681_10005361 | |||
| 734 | Ga0207659_10283679 | |||
| 735 | Ga0207709_10000045 | |||
| 736 | Ga0207691_10413665 | |||
| 737 | Ga0207711_10008507 | |||
| 738 | Ga0207711_10047821 | |||
| 739 | Ga0207711_10417315 | |||
| 740 | Ga0207639_10084477 | |||
| 741 | Ga0207678_10107204 | |||
| 742 | Ga0207683_10048363 | |||
| 743 | Ga0209281_1013398 | |||
| 744 | Ga0209371_1015917 | |||
| 745 | Ga0268266_10006646 | |||
| 746 | Ga0307517_10001042 | |||
| 747 | Ga0307517_10052668 | |||
| 748 | Ga0307517_10168599 | |||
| 749 | Ga0307515_10000463 | |||
| 750 | Ga0307515_10001074 | |||
| 751 | Ga0307515_10033059 | |||
| 752 | Ga0307515_10245030 | |||
| 753 | Ga0265338_10000325 | |||
| 754 | Ga0268256_1009825 | |||
| 755 | Ga0307512_10065951 | |||
| 756 | Ga0316179_1107741 | |||
| 757 | Ga0316178_1056695 | |||
| 758 | Ga0307513_10009671 | |||
| 759 | Ga0307513_10134735 | |||
| 760 | Ga0307408_100034109 | |||
| 761 | Ga0307508_10000040 | |||
| 762 | Ga0307508_10177392 | |||
| 763 | Ga0307516_10004086 | |||
| 764 | Ga0307405_10182639 | |||
| 765 | Ga0307407_10015706 | |||
| 766 | Ga0307412_10000002 | |||
| 767 | Ga0307412_10015215 | |||
| 768 | Ga0307412_10506008 | |||
| 769 | Ga0307409_100003301 | |||
| 770 | Ga0307416_100422634 | |||
| 771 | Ga0307414_10583565 | |||
| 772 | Ga0307411_10005502 | |||
| 773 | Ga0307510_10000104 | |||
| 774 | Ga0395905_0000035 | |||
| 775 | Ga0395905_0122335 | |||
| 776 | Ga0436364_0137883 | |||
| 777 | Ga0436361_0750749 | |||
| 778 | Ga0439438_001468 | |||
| 779 | Ga0439438_002602 | |||
| 780 | Ga0439447_023581 | |||
| 781 | Ga0439447_065812 | |||
| 782 | Ga0451807_1085242 | |||
| 783 | Ga0451849_0390853 | |||
| 784 | Ga0451853_1186014 | |||
| 785 | Ga0439431_0017194 | |||
| 786 | Ga0439445_0013598 | |||
| 787 | Ga0439432_005086 | |||
| 788 | Ga0439451_003552 | |||
| 789 | Ga0439452_000060 | |||
| 790 | Ga0439456_000387 | |||
| 791 | Ga0439463_006629 | |||
| 792 | Ga0450911_000044 | |||
| 793 | Ga0450900_003549 | |||
| 794 | Ga0450902_001708 | |||
| 795 | Ga0450906_000249 | |||
| 796 | Ga0450908_021926 | |||
| 797 | Ga0450918_006939 | |||
| 798 | Ga0466960_0037283 | |||
| 799 | Ga0466967_0171226 | |||
| 800 | Ga0495617_002990 | |||
| 801 | Ga0495617_005056 | |||
| 802 | Ga0495627_000417 | |||
| 803 | Ga0495627_000714 | |||
| 804 | Ga0495627_011856 | |||
| 805 | Ga0495592_0021809 | |||
| 806 | Ga0495603_0002996 | |||
| 807 | Ga0495603_0006907 | |||
| 808 | Ga0495590_0001222 | |||
| 809 | Ga0495590_0011316 | |||
| 810 | Ga0495590_0024367 | |||
| 811 | Ga0495591_001927 | |||
| 812 | Ga0495591_015342 | |||
| 813 | Ga0495591_018494 | |||
| 814 | Ga0495629_0002042 | |||
| 815 | Ga0495629_0002913 | |||
| 816 | Ga0495638_0000755 | |||
| 817 | Ga0495638_0003223 | |||
| 818 | Ga0495638_0023587 | |||
| 819 | Ga0495653_0013480 | |||
| 820 | Ga0495653_0021391 | |||
| 821 | Ga0495653_0075585 | |||
| 822 | Ga0495650_0000309 | |||
| 823 | Ga0495650_0000785 | |||
| 824 | Ga0495650_0003731 | |||
| 825 | Ga0495650_0006224 | |||
| 826 | Ga0495650_0041808 | |||
| 827 | Ga0495580_0002321 | |||
| 828 | Ga0495580_0002852 | |||
| 829 | Ga0495582_0014513 | |||
| 830 | Ga0495605_0000032 | |||
| 831 | Ga0495605_0001063 | |||
| 832 | Ga0495605_0002965 | |||
| 833 | Ga0495605_0012808 | |||
| 834 | Ga0495605_0013969 | |||
| 835 | Ga0495662_0015690 | |||
| 836 | Ga0495662_0051284 | |||
| 837 | Ga0495664_0004932 | |||
| 838 | Ga0495664_0019491 | |||
| 839 | Ga0495664_0051934 | |||
| 840 | Ga0495584_0000156 | |||
| 841 | Ga0495584_0003314 | |||
| 842 | Ga0495584_0022262 | |||
| 843 | Ga0495584_0083073 | |||
| 844 | Ga0495584_0086286 | |||
| 845 | Ga0495584_0189388 | |||
| 846 | Ga0495585_0007037 | |||
| 847 | Ga0495585_0240122 | |||
| 848 | Ga0495594_0051975 | |||
| 849 | Ga0495596_0011835 | |||
| 850 | Ga0495596_0044308 | |||
| 851 | Ga0495596_0059576 | |||
| 852 | Ga0495607_0001453 | |||
| 853 | Ga0495607_0001488 | |||
| 854 | Ga0495607_0063236 | |||
| 855 | Ga0495583_0000052 | |||
| 856 | Ga0495583_0000086 | |||
| 857 | Ga0495583_0002895 | |||
| 858 | Ga0495583_0012557 | |||
| 859 | Ga0495583_0015799 | |||
| 860 | Ga0495606_0001056 | |||
| 861 | Ga0495606_0001874 | |||
| 862 | Ga0495606_0017452 | |||
| 863 | Ga0495606_0028197 | |||
| 864 | Ga0495606_0040642 | |||
| 865 | Ga0495606_0102782 | |||
| 866 | Ga0495608_0035872 | |||
| 867 | Ga0495610_0000194 | |||
| 868 | Ga0495610_0002775 | |||
| 869 | Ga0495610_0005243 | |||
| 870 | Ga0495610_0008718 | |||
| 871 | Ga0495610_0022154 | |||
| 872 | Ga0495610_0036386 | |||
| 873 | Ga0495616_0002599 | |||
| 874 | Ga0495616_0007212 | |||
| 875 | Ga0495616_0112674 | |||
| 876 | Ga0495618_0011579 | |||
| 877 | Ga0495620_0000082 | |||
| 878 | Ga0495620_0000324 | |||
| 879 | Ga0495620_0001531 | |||
| 880 | Ga0495620_0003136 | |||
| 881 | Ga0495620_0017133 | |||
| 882 | Ga0495620_0023584 | |||
| 883 | Ga0495628_0013074 | |||
| 884 | Ga0495628_0052095 | |||
| 885 | Ga0495628_0085406 | |||
| 886 | Ga0495628_0143999 | |||
| 887 | Ga0495630_0136150 | |||
| 888 | Ga0495630_0174262 | |||
| 889 | Ga0495631_0000169 | |||
| 890 | Ga0495631_0004313 | |||
| 891 | Ga0495631_0045156 | |||
| 892 | Ga0495632_0000191 | |||
| 893 | Ga0495632_0010056 | |||
| 894 | Ga0495632_0034537 | |||
| 895 | Ga0495632_0194849 | |||
| 896 | Ga0495637_0000164 | |||
| 897 | Ga0495637_0003717 | |||
| 898 | Ga0495643_0003883 | |||
| 899 | Ga0495643_0010891 | |||
| 900 | Ga0495643_0026744 | |||
| 901 | Ga0495643_0026787 | |||
| 902 | Ga0495644_0005953 | |||
| 903 | Ga0495648_0000827 | |||
| 904 | Ga0495648_0024840 | |||
| 905 | Ga0495648_0040350 | |||
| 906 | Ga0495666_0000333 | |||
| 907 | Ga0495642_0018772 | |||
| 908 | Ga0495642_0051422 | |||
| 909 | Ga0495642_0127905 | |||
| 910 | Ga0495652_0013004 | |||
| 911 | Ga0495652_0045262 | |||
| 912 | Ga0495652_0229598 | |||
| 913 | Ga0495654_0000244 | |||
| 914 | Ga0495654_0000802 | |||
| 915 | Ga0495654_0001781 | |||
| 916 | Ga0495654_0006649 | |||
| 917 | Ga0495654_0008051 | |||
| 918 | Ga0495654_0033717 | |||
| 919 | Ga0495654_0053503 | |||
| 920 | Ga0495665_0000006 | |||
| 921 | Ga0495665_0133915 | |||
| 922 | Ga0495586_0045500 | |||
| 923 | Ga0495586_0049975 | |||
| 924 | Ga0495609_0000032 | |||
| 925 | Ga0495609_0000145 | |||
| 926 | Ga0495609_0000770 | |||
| 927 | Ga0495609_0001931 | |||
| 928 | Ga0495609_0011601 | |||
| 929 | Ga0495609_0055853 | |||
| 930 | Ga0495597_0000992 | |||
| 931 | Ga0495597_0002309 | |||
| 932 | Ga0495597_0002611 | |||
| 933 | Ga0495597_0005030 | |||
| 934 | Ga0495597_0011882 | |||
| 935 | Ga0495597_0095069 | |||
| 936 | Ga0495597_0096355 | |||
| 937 | Ga0495645_0000208 | |||
| 938 | Ga0495622_0004276 | |||
| 939 | Ga0495622_0005006 | |||
| 940 | Ga0495633_0000615 | |||
| 941 | Ga0495633_0004982 | |||
| 942 | Ga0495667_0023723 | |||
| 943 | Ga0495667_0050816 | |||
| 944 | Ga0495656_0251201 | |||
| 945 | Ga0495668_0099670 | |||
| 946 | Ga0495634_0002514 | |||
| 947 | Ga0495611_0000052 | |||
| 948 | Ga0495611_0010719 | |||
| 949 | Ga0495625_0003859 | |||
| 950 | Ga0495625_0004472 | |||
| 951 | Ga0495625_0005154 | |||
| 952 | Ga0495625_0007414 | |||
| 953 | Ga0495625_0055491 | |||
| 954 | Ga0495635_0014319 | |||
| 955 | Ga0495661_0000405 | |||
| 956 | Ga0495661_0053724 | |||
| 957 | Ga0495661_0075017 | |||
| 958 | Ga0495588_0030678 | |||
| 959 | Ga0495588_0035830 | |||
| 960 | Ga0495657_0161904 | |||
| 961 | Ga0495623_0047758 | |||
| 962 | Ga0495623_0080074 | |||
| 963 | Ga0495646_0003054 | |||
| 964 | Ga0495646_0018017 | |||
| 965 | Ga0495646_0170122 | |||
| 966 | Ga0495658_0016126 | |||
| 967 | Ga0495669_0014847 | |||
| 968 | Ga0495624_0000446 | |||
| 969 | Ga0495624_0000578 | |||
| 970 | Ga0495624_0088026 | |||
| 971 | Ga0495670_0000293 | |||
| 972 | Ga0495670_0029806 | |||
| 973 | Ga0495670_0398318 | |||
| 974 | Ga0495671_0000435 | |||
| 975 | Ga0495671_0002560 | |||
| 976 | Ga0495671_0017195 | |||
| 977 | Ga0495671_0137063 | |||
| 978 | Ga0495671_0233114 | |||
| 979 | Ga0495649_0002107 | |||
| 980 | Ga0495649_0003440 | |||
| 981 | Ga0495649_0015086 | |||
| 982 | Ga0495649_0029602 | |||
| 983 | Ga0495649_0048291 | |||
| 984 | Ga0495649_0056276 | |||
| 985 | Ga0495649_0072972 | |||
| 986 | Ga0495649_0097484 | |||
| 987 | Ga0495589_0000973 | |||
| 988 | Ga0495589_0018376 | |||
| 989 | Ga0495589_0229587 | |||
| 990 | Ga0495600_0302136 | |||
| 991 | Ga0495660_0001786 | |||
| 992 | Ga0495660_0002290 | |||
| 993 | Ga0495660_0004174 | |||
| 994 | Ga0495660_0023809 | |||
| 995 | Ga0495660_0056130 | |||
| 996 | Ga0495660_0087130 | |||
| 997 | Ga0495660_0091447 | |||
| 998 | Ga0495660_0128221 | |||
| 999 | Ga0495581_0004076 | |||
| 1000 | Ga0495604_0015519 | |||
| 1001 | Ga0495604_0056812 | |||
| 1002 | Ga0495674_0002322 | |||
| 1003 | Ga0495674_0039597 | |||
| 1004 | Ga0495674_0307734 | |||
| 1005 | Ga0495672_0010087 | |||
| 1006 | Ga0495672_0018842 | |||
| 1007 | Ga0495672_0075001 | |||
| 1008 | Ga0495676_0000108 | |||
| 1009 | Ga0495680_0001268 | |||
| 1010 | Ga0495680_0014736 | |||
| 1011 | Ga0495683_0000011 | |||
| 1012 | Ga0495683_0000281 | |||
| 1013 | Ga0495683_0001451 | |||
| 1014 | Ga0495683_0106192 | |||
| 1015 | Ga0495687_012635 | |||
| 1016 | Ga0495687_025928 | |||
| 1017 | Ga0495687_036739 | |||
| 1018 | Ga0495675_0031931 | |||
| 1019 | Ga0495675_0062577 | |||
| 1020 | Ga0495675_0141431 | |||
| 1021 | Ga0495679_000297 | |||
| 1022 | Ga0495679_001697 | |||
| 1023 | Ga0495679_003845 | |||
| 1024 | Ga0495673_0000077 | |||
| 1025 | Ga0495673_0000198 | |||
| 1026 | Ga0495673_0000910 | |||
| 1027 | Ga0495673_0018339 | |||
| 1028 | Ga0495673_0021985 | |||
| 1029 | Ga0495673_0022336 | |||
| 1030 | Ga0495673_0024238 | |||
| 1031 | Ga0495681_0000598 | |||
| 1032 | Ga0495681_0004178 | |||
| 1033 | Ga0495681_0006267 | |||
| 1034 | Ga0495681_0008294 | |||
| 1035 | Ga0495681_0118349 | |||
| 1036 | Ga0495684_0135007 | |||
| 1037 | Ga0495686_0000044 | |||
| 1038 | Ga0495686_0001757 | |||
| 1039 | Ga0495686_0007379 | |||
| 1040 | Ga0495686_0063792 | |||
| 1041 | Ga0495686_0088809 | |||
| 1042 | Ga0495593_0000259 | |||
| 1043 | Ga0495593_0008948 | |||
| 1044 | Ga0495593_0018077 | |||
| 1045 | Ga0495593_0020591 | |||
| 1046 | Ga0495602_0001569 | |||
| 1047 | Ga0495602_0043455 | |||
| 1048 | Ga0495602_0059112 | |||
| 1049 | Ga0495602_0291699 | |||
| 1050 | Ga0495614_0006247 | |||
| 1051 | Ga0495614_0052701 | |||
| 1052 | Ga0495626_0000269 | |||
| 1053 | Ga0495626_0007346 | |||
| 1054 | Ga0495626_0040934 | |||
| 1055 | Ga0496100_0000178 | |||
| 1056 | Ga0496100_0002612 | |||
| 1057 | Ga0496100_0067379 | |||
| 1058 | Ga0496100_0192481 | |||
| 1059 | Ga0496101_0013543 | |||
| 1060 | Ga0496101_0054912 | |||
| 1061 | Ga0496101_0161133 | |||
| 1062 | Ga0496102_0000812 | |||
| 1063 | Ga0496102_0007688 | |||
| 1064 | Ga0496102_0166928 | |||
| 1065 | Ga0496102_0184835 | |||
| 1066 | Ga0496102_0356841 | |||
| 1067 | Ga0496102_0618510 | |||
| 1068 | Ga0496103_0008246 | |||
| 1069 | Ga0496103_0065850 | |||
| 1070 | Ga0496104_0026116 | |||
| 1071 | Ga0496104_0047752 | |||
| 1072 | Ga0496104_0057282 | |||
| 1073 | Ga0496104_0159160 | |||
| 1074 | Ga0496105_0008151 | |||
| 1075 | Ga0496105_0012039 | |||
| 1076 | Ga0496105_0047987 | |||
| 1077 | Ga0496106_0005870 | |||
| 1078 | Ga0496106_0367314 | |||
| 1079 | Ga0496107_0010410 | |||
| 1080 | Ga0496107_0229919 | |||
| 1081 | Ga0496109_0107096 | |||
| 1082 | Ga0496110_0027645 | |||
| 1083 | Ga0496111_0078607 | |||
| 1084 | Ga0496112_0004958 | |||
| 1085 | Ga0496112_0025546 | |||
| 1086 | Ga0496113_0054618 | |||
| 1087 | Ga0496113_0127189 | |||
| 1088 | Ga0496113_0365612 | |||
| 1089 | Ga0496114_0000601 | |||
| 1090 | Ga0496115_0047386 | |||
| 1091 | Ga0496115_0062997 | |||
| 1092 | Ga0496116_0000402 | |||
| 1093 | Ga0496116_0000899 | |||
| 1094 | Ga0496116_0003126 | |||
| 1095 | Ga0496116_0018521 | |||
| 1096 | Ga0496117_0000697 | |||
| 1097 | Ga0496117_0002423 | |||
| 1098 | Ga0496117_0002759 | |||
| 1099 | Ga0496117_0005366 | |||
| 1100 | Ga0496117_0015678 | |||
| 1101 | Ga0496117_0040445 | |||
| 1102 | Ga0496117_0161562 | |||
| 1103 | Ga0496118_0000135 | |||
| 1104 | Ga0496118_0006187 | |||
| 1105 | Ga0496118_0006644 | |||
| 1106 | Ga0496118_0024029 | |||
| 1107 | Ga0496118_0061139 | |||
| 1108 | Ga0496118_0144336 | |||
| 1109 | Ga0496119_0003195 | |||
| 1110 | Ga0496119_0012721 | |||
| 1111 | Ga0496120_0008082 | |||
| 1112 | Ga0496120_0042537 | |||
| 1113 | Ga0496121_0000361 | |||
| 1114 | Ga0496121_0003581 | |||
| 1115 | Ga0496121_0037331 | |||
| 1116 | Ga0496121_0060071 | |||
| 1117 | Ga0496121_0085926 | |||
| 1118 | Ga0496122_0021326 | |||
| 1119 | Ga0496122_0024733 | |||
| 1120 | Ga0496122_0089098 | |||
| 1121 | Ga0496122_0137323 | |||
| 1122 | Ga0496122_0143392 | |||
| 1123 | Ga0496123_0004360 | |||
| 1124 | Ga0496123_0019747 | |||
| 1125 | Ga0496123_0029473 | |||
| 1126 | Ga0496123_0083106 | |||
| 1127 | Ga0496124_0006236 | |||
| 1128 | Ga0496124_0041254 | |||
| 1129 | Ga0496124_0140384 | |||
| 1130 | Ga0496124_0159908 | |||
| 1131 | Ga0496125_0014170 | |||
| 1132 | Ga0496125_0021611 | |||
| 1133 | Ga0496126_0000196 | |||
| 1134 | Ga0496126_0000398 | |||
| 1135 | Ga0496126_0053823 | |||
| 1136 | Ga0496126_0118569 | |||
| 1137 | Ga0496126_0439786 | |||
| 1138 | Ga0496126_0443455 | |||
| 1139 | Ga0495678_000033 | |||
| 1140 | Ga0495678_000129 | |||
| 1141 | Ga0495678_002800 | |||
| 1142 | Ga0495678_019669 | |||
| 1143 | Ga0495682_0089050 | |||
| 1144 | Ga0501240_004037 | |||
| 1145 | nmdc:mga0k408_147882_c1 | |||
| 1146 | nmdc:mga07m45_61468_c1 | |||
| 1147 | Ga0500578_0043289 | |||
| 1148 | Ga0500562_021166 | |||
| 1149 | Ga0500618_003025 | |||
| 1150 | Ga0500618_028790 | |||
| 1151 | Ga0500559_0063006 | |||
| 1152 | Ga0500616_0000522 | |||
| 1153 | Ga0500645_003708 | |||
| 1154 | Ga0500645_005673 | |||
| 1155 | Ga0500587_005781 | |||
| 1156 | 2509127225 | |||
| 1157 | 2511290688 | |||
| 1158 | 2511338048 | |||
| 1159 | 2511342860 | |||
| 1160 | 2511414263 | |||
| 1161 | 2513961270 | |||
| 1162 | 2514047075 | |||
| 1163 | 2527076519 | |||
| 1164 | 2563060745 | |||
| 1165 | 2587759181 | |||
| 1166 | 2600446850 | |||
| 1167 | 2600812360 | |||
| 1168 | 2601797431 | |||
| 1169 | 2606075837 | |||
| 1170 | 2606130874 | |||
| 1171 | 2624481693 | |||
| 1172 | 2713480356 | |||
| 1173 | 2715758091 | |||
| 1174 | 2738820584 | |||
| 1175 | 2738833064 | |||
| 1176 | 2738874591 | |||
| 1177 | 2739186221 | |||
| 1178 | 2739221189 | |||
| 1179 | 2739313823 | |||
| 1180 | 2753568231 | |||
| 1181 | 2792838124 | |||
| 1182 | 2808949752 | |||
| 1183 | 2808960286 | |||
| 1184 | 2808967701 | |||
| 1185 | 2809002532 | |||
| 1186 | 2809009810 | |||
| 1187 | 2842837618 | |||
| 1188 | 2842844411 | |||
| 1189 | 2878033679 | |||
| 1190 | 2904488699 | |||
| 1191 | 2904616837 | |||
| 1192 | 2919069003 | |||
| 1193 | 2919387805 | |||
| 1194 | 2919529312 | |||
| 1195 | 2929205013 | |||
| 1196 | 2931394040 | |||
| 1197 | 2937847545 | |||
| 1198 | 2945938635 | |||
| 1199 | 2974290139 | |||
| 1200 | 2990708635 | |||
| 1201 | 2998143738 | |||
| 1202 | 3007513337 | |||
| 1203 | 3007861036 | |||
| 1204 | 3007861280 | |||
| 1205 | 642426370 | |||
| 1206 | 642597550 | |||
| 1207 | 8029997096 | |||
| 1208 | 8055272349 | |||
| 1209 | 8055303325 | |||
| 1210 | 8055821052 | |||
| 1211 | 8055913058 | |||
| 1212 | 8056167493 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3ocr-assembly2.cif.gz_B | crystal structure of aldolase ii superfamily protein from pseudomonas syringae | 0.9128 | 21 | 262 |
| 3ocr-assembly1.cif.gz_A | crystal structure of aldolase ii superfamily protein from pseudomonas syringae | 0.9065 | 16 | 262 |
| 3ocr-assembly1.cif.gz_A | crystal structure of aldolase ii superfamily protein from pseudomonas syringae | 0.8894 | 16 | 262 |
| 4xxf-assembly1.cif.gz_A | l-fuculose 1-phosphate aldolase from glaciozyma antarctica pi12 | 0.8886 | 25 | 262 |
| 3ocr-assembly2.cif.gz_B | crystal structure of aldolase ii superfamily protein from pseudomonas syringae | 0.8849 | 21 | 262 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q54T47_16_268_3.40.225.10 | Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain | 0.9185 | 21 | 262 | 3.40.225.10 |
| af_Q20952_347_604_3.40.225.10 | Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain | 0.9144 | 21 | 257 | 3.40.225.10 |
| 3ocrB00 | Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain | 0.9116 | 21 | 262 | 3.40.225.10 |
| af_Q9U9K0_112_366_3.40.225.10 | Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain | 0.8929 | 21 | 259 | 3.40.225.10 |
| 4xxfA00 | Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain | 0.8885 | 25 | 262 | 3.40.225.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-R4WS08-F1-model_v4 | Putative adolase/adducin | 0.9887 | 18 | 262 |
GO:0005856
GO:0051015 |
| AF-A0A226WMR9-F1-model_v4 | Ribulose-5-phosphate 4-epimerase | 0.9871 | 26 | 262 |
GO:0005856
GO:0051015 |
| AF-A0A158JAS6-F1-model_v4 | Aldolase | 0.9834 | 1 | 262 |
GO:0005856
GO:0051015 |
| AF-B1G7Z7-F1-model_v4 | Class II aldolase/adducin family protein | 0.9828 | 1 | 262 |
GO:0005856
GO:0051015 |
| AF-A0A1C7ZAK6-F1-model_v4 | Class II aldolase/adducin N-terminal domain-containing protein | 0.9804 | 1 | 262 |
GO:0005856
GO:0005996 GO:0051015 |