F468680

General Info

Members Datasets Scaffolds Average Seq Length
607 293 595 159

Family's Representative Sequence

Representative Sequence 3300011119|Ga0105246_10104316|Ga0105246_101043164
Length 187
Sequence VQERRKRLNDGIFFYSSFSFYPGLTNITNMNKMPTLYEWAGDMPTFEKLFSIFYDKVLKDDLLGVVFKDMSPDHIKHVSHFVAEVFGGPKLYSTADGGSHANMIGHHIGKMLTEEKRQRWVQLLIQTADEIGLKSDPEFRSAFVGYLEWGTRIAVINSQLTENPMSHSEPMPKWGWGETGGPYIPED

Samples

Sample ID Description Type Environment
1 2738541278 Niastella sp. CF465 Isolate Unclassified
2 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
3 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
4 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
5 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
6 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
7 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
8 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
9 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
10 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
11 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
12 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
13 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
14 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
15 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
16 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
17 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
18 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
19 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
20 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
21 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
22 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
23 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
24 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
25 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
26 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
27 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
28 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
29 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
30 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
31 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
32 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
33 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
34 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
35 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
36 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
37 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
38 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
39 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
40 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
41 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
42 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
43 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
44 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
45 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
46 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
47 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
48 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
49 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
50 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
51 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
52 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
53 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
54 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
55 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
56 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
59 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
76 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
77 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
78 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
84 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
85 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
86 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
87 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
104 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
105 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
106 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
118 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
119 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
121 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
122 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
123 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
124 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
125 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
127 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
128 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
131 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
133 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
179 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
183 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
184 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
185 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
186 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
187 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
188 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
189 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
190 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
191 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
192 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
193 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
194 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
195 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
196 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
197 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
198 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
199 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
200 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
201 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
202 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
203 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
204 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
205 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
206 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
207 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
208 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
209 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
210 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
211 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
212 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
213 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
214 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
215 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
216 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
217 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
218 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
219 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
220 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
221 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
222 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
223 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
224 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
225 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
226 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
227 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
228 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
229 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
230 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
231 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
232 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
233 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
234 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
235 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
236 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
237 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
238 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
239 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
240 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
241 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
242 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
243 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
244 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
245 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
246 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
247 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
248 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
249 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
250 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
251 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
252 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
253 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
254 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
255 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
256 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
257 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
258 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
259 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
260 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
261 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
262 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
263 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
264 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
265 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
266 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
267 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
268 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
269 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
270 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
271 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
272 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
273 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
274 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
275 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
276 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
277 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
278 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
279 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
280 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
281 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
282 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
283 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
284 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
285 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
286 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
287 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
288 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
289 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
290 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
291 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
292 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
293 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.02
Metatranscriptomes 0
Isolates 1.98

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.83
Nodule 0
Rhizoplane 0.82
Rhizosphere 76.77
Stem 0
Stem Tuber 0
Unclassified 7.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1008198 3300001904 Unclassified 1738
2 JGI24739J22299_10010267 3300001989 Bacteria 3477
3 JGI24737J22298_10020627 3300001990 Bacteria 2103
4 JGI24743J22301_10065308 3300001991 Unclassified 754
5 JGI24744J21845_10012151 3300002077 Bacteria 1751
6 JGI25162J39368_1000016 3300002737 Bacteria 288734
7 JGI25162J39368_1000292 3300002737 Bacteria 46381
8 JGI25162J39368_1002581 3300002737 Bacteria 6834
9 JGI25158J39367_1009425 3300002739 Bacteria 1338
10 JGI25164J39214_1002580 3300002772 Bacteria 2683
11 JGI25165J46597_1001654 3300003214 Bacteria 10258
12 JGI25153J46596_10056687 3300003215 Bacteria 1088
13 rootH1_10158098 3300003316 Unclassified 1177
14 rootH2_10019378 3300003320 Unclassified 3778
15 rootH2_10092343 3300003320 Bacteria 5484
16 rootH2_10113973 3300003320 Bacteria 2934
17 rootL2_10012167 3300003322 Bacteria 5978
18 rootL2_10049774 3300003322 Bacteria 1287
19 rootL2_10241177 3300003322 Unclassified 1328
20 rootH1_10000759 3300003323 Bacteria 51501
21 rootH1_10016264 3300003323 Bacteria 11614
22 rootH1_10057158 3300003323 Bacteria 17078
23 rootH1_10098778 3300003323 Bacteria 1759
24 rootH1_10177811 3300003323 Bacteria 2978
25 JGI25160J50197_1003474 3300003354 Bacteria 7042
26 Ga0055526_1018819 3300003771 Unclassified 2553
27 Ga0055528_1000408 3300003790 Bacteria 34803
28 Ga0055530_10000983 3300003791 Bacteria 22945
29 Ga0055531_10000029 3300003794 Bacteria 159248
30 Ga0055543_1007112 3300004625 Bacteria 2622
31 Ga0055543_1026203 3300004625 Bacteria 1037
32 Ga0065165_1000043 3300005262 Bacteria 203850
33 Ga0065165_1000212 3300005262 Bacteria 100806
34 Ga0065714_10084686 3300005288 Bacteria 2185
35 Ga0065714_10136970 3300005288 Bacteria 1201
36 Ga0070676_10000973 3300005328 Bacteria 14233
37 Ga0070670_100088866 3300005331 Unclassified 2656
38 Ga0070670_100091752 3300005331 Bacteria 2612
39 Ga0068869_100174463 3300005334 Bacteria 1681
40 Ga0068869_100376667 3300005334 Bacteria 1162
41 Ga0070666_10000627 3300005335 Bacteria 21215
42 Ga0068868_100025339 3300005338 Bacteria 4510
43 Ga0068868_100060204 3300005338 Unclassified 3005
44 Ga0068868_100081583 3300005338 Bacteria 2593
45 Ga0068868_100166412 3300005338 Bacteria 1824
46 Ga0070660_100009654 3300005339 Bacteria 6797
47 Ga0070660_100095813 3300005339 Bacteria 2346
48 Ga0070691_10049848 3300005341 Bacteria 1996
49 Ga0070661_100377325 3300005344 Bacteria 1117
50 Ga0070668_100029338 3300005347 Bacteria 4178
51 Ga0070668_100042915 3300005347 Bacteria 3466
52 Ga0070668_100075593 3300005347 Bacteria 2630
53 Ga0070668_101364475 3300005347 Bacteria 646
54 Ga0070669_100022276 3300005353 Bacteria 4531
55 Ga0070669_100774379 3300005353 Bacteria 814
56 Ga0070671_100023698 3300005355 Bacteria 5025
57 Ga0070671_100695075 3300005355 Bacteria 882
58 Ga0070674_100072473 3300005356 Bacteria 2439
59 Ga0070673_100418802 3300005364 Unclassified 1200
60 Ga0070673_101070907 3300005364 Unclassified 752
61 Ga0070659_100000100 3300005366 Bacteria 63786
62 Ga0070659_100152486 3300005366 Bacteria 1886
63 Ga0070659_101091871 3300005366 Bacteria 703
64 Ga0070667_100004337 3300005367 Bacteria 11965
65 Ga0070667_100361157 3300005367 Bacteria 1316
66 Ga0070667_100521943 3300005367 Bacteria 1090
67 Ga0070667_100781349 3300005367 Unclassified 886
68 Ga0070700_100027062 3300005441 Bacteria 3396
69 Ga0070678_100058641 3300005456 Bacteria 2826
70 Ga0070662_100000768 3300005457 Bacteria 19743
71 Ga0070662_100004637 3300005457 Bacteria 8712
72 Ga0070662_100044715 3300005457 Bacteria 3173
73 Ga0070662_100415306 3300005457 Bacteria 1112
74 Ga0068867_100003119 3300005459 Bacteria 11692
75 Ga0070685_10317122 3300005466 Bacteria 1055
76 Ga0070698_100026527 3300005471 Bacteria 6031
77 Ga0070684_100614341 3300005535 Bacteria 1011
78 Ga0068853_100002873 3300005539 Bacteria 13070
79 Ga0068853_100006575 3300005539 Bacteria 9256
80 Ga0068853_100156705 3300005539 Bacteria 2052
81 Ga0068853_100252349 3300005539 Bacteria 1619
82 Ga0070686_101309600 3300005544 Unclassified 605
83 Ga0070696_100016321 3300005546 Bacteria 4998
84 Ga0070693_100121101 3300005547 Bacteria 1623
85 Ga0070665_100004187 3300005548 Bacteria 15173
86 Ga0070665_100117950 3300005548 Bacteria 2657
87 Ga0068855_100000071 3300005563 Bacteria 122638
88 Ga0068855_100004729 3300005563 Bacteria 16629
89 Ga0068855_100020908 3300005563 Bacteria 7848
90 Ga0068855_100028423 3300005563 Bacteria 6690
91 Ga0068855_100037028 3300005563 Bacteria 5804
92 Ga0068855_100076365 3300005563 Bacteria 3888
93 Ga0068855_100244953 3300005563 Bacteria 2001
94 Ga0068855_100350639 3300005563 Bacteria 1626
95 Ga0068855_100753222 3300005563 Bacteria 1038
96 Ga0068857_100022429 3300005577 Bacteria 5554
97 Ga0068857_100117212 3300005577 Bacteria 2396
98 Ga0068857_100709055 3300005577 Unclassified 956
99 Ga0068857_100853829 3300005577 Unclassified 871
100 Ga0068857_101093887 3300005577 Bacteria 769
101 Ga0068856_100005502 3300005614 Bacteria 12472
102 Ga0068856_100010672 3300005614 Bacteria 8926
103 Ga0068856_100016428 3300005614 Bacteria 7161
104 Ga0068856_100020713 3300005614 Bacteria 6388
105 Ga0068856_100033782 3300005614 Bacteria 5009
106 Ga0068856_100260872 3300005614 Unclassified 1748
107 Ga0068852_100023189 3300005616 Bacteria 4990
108 Ga0068852_100059682 3300005616 Bacteria 3309
109 Ga0068852_100060715 3300005616 Unclassified 3283
110 Ga0068852_100070137 3300005616 Bacteria 3074
111 Ga0068859_100000127 3300005617 Bacteria 72136
112 Ga0068859_100001600 3300005617 Bacteria 23125
113 Ga0068859_100160739 3300005617 Bacteria 2325
114 Ga0068864_100014831 3300005618 Bacteria 6474
115 Ga0068864_100207095 3300005618 Bacteria 1804
116 Ga0068864_100742351 3300005618 Unclassified 961
117 Ga0068861_100028049 3300005719 Bacteria 4106
118 Ga0068861_100191172 3300005719 Bacteria 1711
119 Ga0068861_100632886 3300005719 Bacteria 986
120 Ga0068851_10004550 3300005834 Bacteria 6259
121 Ga0068870_10091673 3300005840 Bacteria 1700
122 Ga0068863_100001425 3300005841 Bacteria 23686
123 Ga0068863_100019291 3300005841 Bacteria 6522
124 Ga0068863_100032439 3300005841 Bacteria 4979
125 Ga0068863_100220078 3300005841 Bacteria 1829
126 Ga0068863_100237992 3300005841 Bacteria 1757
127 Ga0068863_100307735 3300005841 Bacteria 1538
128 Ga0068858_100002322 3300005842 Bacteria 19226
129 Ga0068858_100338700 3300005842 Bacteria 1439
130 Ga0068858_100872274 3300005842 Bacteria 879
131 Ga0068860_100000323 3300005843 Bacteria 64975
132 Ga0068860_100006124 3300005843 Bacteria 12098
133 Ga0068860_100155494 3300005843 Bacteria 2204
134 Ga0068860_100333971 3300005843 Bacteria 1489
135 Ga0068862_100118814 3300005844 Bacteria 2328
136 Ga0081455_10029048 3300005937 Bacteria 5045
137 Ga0081538_10021709 3300005981 Bacteria 4673
138 Ga0075364_10794199 3300006051 Unclassified 645
139 Ga0075366_10000076 3300006195 Bacteria 38500
140 Ga0075366_10325615 3300006195 Unclassified 942
141 Ga0097621_100000236 3300006237 Bacteria 37155
142 Ga0097621_100011238 3300006237 Bacteria 6592
143 Ga0097621_100276908 3300006237 Bacteria 1476
144 Ga0097621_100394763 3300006237 Bacteria 1238
145 Ga0075370_10409112 3300006353 Bacteria 814
146 Ga0068871_100000481 3300006358 Bacteria 27278
147 Ga0068871_100009082 3300006358 Bacteria 7183
148 Ga0068871_101212153 3300006358 Bacteria 708
149 Ga0075428_100005123 3300006844 Bacteria 14564
150 Ga0075430_100001516 3300006846 Bacteria 18950
151 Ga0075431_100002814 3300006847 Bacteria 16835
152 Ga0075433_10059192 3300006852 Bacteria 3351
153 Ga0075434_100010992 3300006871 Bacteria 8514
154 Ga0075429_100003015 3300006880 Bacteria 14277
155 Ga0068865_100012833 3300006881 Bacteria 5282
156 Ga0068865_100292729 3300006881 Unclassified 1300
157 Ga0097620_100000127 3300006931 Bacteria 72136
158 Ga0097620_100001600 3300006931 Bacteria 23125
159 Ga0097620_100160747 3300006931 Bacteria 2325
160 Ga0097620_101600017 3300006931 Bacteria 719
161 Ga0105240_10000020 3300009093 Bacteria 399699
162 Ga0105240_10014694 3300009093 Bacteria 10680
163 Ga0105240_10028094 3300009093 Bacteria 7355
164 Ga0105240_10059160 3300009093 Bacteria 4783
165 Ga0105240_10146734 3300009093 Unclassified 2815
166 Ga0105240_10157172 3300009093 Bacteria 2703
167 Ga0105240_10209871 3300009093 Bacteria 2276
168 Ga0105240_10217489 3300009093 Bacteria 2228
169 Ga0105240_10334536 3300009093 Bacteria 1722
170 Ga0105240_11196078 3300009093 Bacteria 805
171 Ga0105240_11381515 3300009093 Bacteria 741
172 Ga0105240_12115146 3300009093 Unclassified 584
173 Ga0105240_12249730 3300009093 Bacteria 565
174 Ga0111539_10250833 3300009094 Bacteria 2061
175 Ga0105245_10047883 3300009098 Bacteria 3823
176 Ga0105245_10057741 3300009098 Bacteria 3491
177 Ga0105245_10622452 3300009098 Bacteria 1108
178 Ga0105245_10840337 3300009098 Bacteria 958
179 Ga0105245_12030687 3300009098 Unclassified 628
180 Ga0105247_10000331 3300009101 Bacteria 41671
181 Ga0105247_10037482 3300009101 Bacteria 2959
182 Ga0114129_10005409 3300009147 Bacteria 18033
183 Ga0105241_10001318 3300009174 Bacteria 18849
184 Ga0105241_10044024 3300009174 Bacteria 3381
185 Ga0105242_10017115 3300009176 Bacteria 5644
186 Ga0105242_10162575 3300009176 Bacteria 1956
187 Ga0105248_12265795 3300009177 Bacteria 618
188 Ga0105237_10000306 3300009545 Bacteria 68095
189 Ga0105237_10000951 3300009545 Bacteria 38923
190 Ga0105237_10001339 3300009545 Bacteria 32663
191 Ga0105237_10002191 3300009545 Bacteria 24446
192 Ga0105237_10006672 3300009545 Bacteria 12758
193 Ga0105237_10032349 3300009545 Bacteria 5295
194 Ga0105237_10057817 3300009545 Bacteria 3881
195 Ga0105237_10081112 3300009545 Bacteria 3234
196 Ga0105237_10181075 3300009545 Bacteria 2107
197 Ga0105237_10288482 3300009545 Bacteria 1644
198 Ga0105237_10836204 3300009545 Unclassified 927
199 Ga0105238_10002988 3300009551 Bacteria 16891
200 Ga0105238_10009617 3300009551 Bacteria 9672
201 Ga0105238_10016525 3300009551 Bacteria 7470
202 Ga0105238_10029116 3300009551 Bacteria 5627
203 Ga0105238_10381580 3300009551 Bacteria 1401
204 Ga0105238_12073404 3300009551 Bacteria 603
205 Ga0105238_12259852 3300009551 Bacteria 579
206 Ga0105249_10002916 3300009553 Bacteria 14751
207 Ga0105249_10007496 3300009553 Bacteria 9520
208 Ga0105249_10037692 3300009553 Bacteria 4387
209 Ga0105239_10000026 3300010375 Bacteria 248302
210 Ga0105239_10000086 3300010375 Bacteria 129798
211 Ga0105239_10000305 3300010375 Bacteria 72644
212 Ga0105239_10000478 3300010375 Bacteria 58328
213 Ga0105239_10000786 3300010375 Bacteria 45039
214 Ga0105239_10002354 3300010375 Bacteria 24082
215 Ga0105239_10005302 3300010375 Bacteria 15144
216 Ga0105239_10005859 3300010375 Bacteria 14329
217 Ga0105239_10010291 3300010375 Bacteria 10478
218 Ga0105239_10036564 3300010375 Bacteria 5391
219 Ga0105239_10137928 3300010375 Bacteria 2716
220 Ga0105239_10155857 3300010375 Bacteria 2550
221 Ga0105239_10236866 3300010375 Bacteria 2049
222 Ga0105239_10334649 3300010375 Bacteria 1708
223 Ga0105239_10626143 3300010375 Bacteria 1228
224 Ga0105239_10819953 3300010375 Bacteria 1066
225 Ga0105239_11815397 3300010375 Bacteria 707
226 Ga0105246_10063199 3300011119 Bacteria 2581
227 Ga0105246_10085581 3300011119 Bacteria 2258
228 Ga0105246_10104316 3300011119 Bacteria 2070
229 Ga0105246_10151320 3300011119 Bacteria 1757
230 Ga0105246_10177884 3300011119 Unclassified 1635
231 Ga0105246_10510772 3300011119 Bacteria 1022
232 Ga0105246_11094045 3300011119 Bacteria 727
233 Ga0157373_10036424 3300013100 Bacteria 3531
234 Ga0157371_10000678 3300013102 Bacteria 40299
235 Ga0157371_10116467 3300013102 Unclassified 1899
236 Ga0157371_11006196 3300013102 Unclassified 636
237 Ga0157370_10123789 3300013104 Unclassified 2414
238 Ga0157370_10272399 3300013104 Bacteria 1564
239 Ga0157370_10416577 3300013104 Bacteria 1236
240 Ga0157370_10631070 3300013104 Bacteria 980
241 Ga0157370_11010300 3300013104 Unclassified 753
242 Ga0157369_10051787 3300013105 Bacteria 4442
243 Ga0157369_10061231 3300013105 Bacteria 4058
244 Ga0157374_10000076 3300013296 Bacteria 97502
245 Ga0157374_10071131 3300013296 Bacteria 3280
246 Ga0157374_10280575 3300013296 Unclassified 1645
247 Ga0157374_10876567 3300013296 Bacteria 915
248 Ga0157378_10017443 3300013297 Bacteria 6301
249 Ga0157378_10030417 3300013297 Unclassified 4771
250 Ga0157378_10058097 3300013297 Bacteria 3450
251 Ga0157378_10773715 3300013297 Bacteria 984
252 Ga0163162_10063575 3300013306 Bacteria 3734
253 Ga0163162_10146954 3300013306 Bacteria 2474
254 Ga0157372_10000243 3300013307 Bacteria 60266
255 Ga0157372_10108654 3300013307 Bacteria 3175
256 Ga0157372_10636444 3300013307 Bacteria 1242
257 Ga0157375_10024183 3300013308 Bacteria 5619
258 Ga0157375_10026127 3300013308 Bacteria 5437
259 Ga0157375_10042553 3300013308 Bacteria 4397
260 Ga0157375_10047338 3300013308 Bacteria 4199
261 Ga0157375_11156940 3300013308 Bacteria 907
262 Ga0157375_12282558 3300013308 Unclassified 645
263 Ga0163163_10067466 3300014325 Bacteria 3557
264 Ga0163163_10237514 3300014325 Unclassified 1872
265 Ga0163163_11296641 3300014325 Unclassified 790
266 Ga0157379_10088615 3300014968 Bacteria 2775
267 Ga0157376_10047950 3300014969 Bacteria 3529
268 Ga0157376_10266456 3300014969 Bacteria 1607
269 Ga0157376_10919627 3300014969 Bacteria 894
270 Ga0182007_10036379 3300015262 Bacteria 1656
271 Ga0163161_10015766 3300017792 Bacteria 5269
272 Ga0163161_10053957 3300017792 Bacteria 2916
273 Ga0213872_10038112 3300021361 Bacteria 2194
274 Ga0209436_100592 3300025208 Bacteria 15513
275 Ga0209563_106596 3300025230 Bacteria 1981
276 Ga0207427_100131 3300025231 Bacteria 93947
277 Ga0209437_100041 3300025233 Bacteria 444465
278 Ga0209437_100048 3300025233 Bacteria 405107
279 Ga0209437_100262 3300025233 Bacteria 81344
280 Ga0209646_1004231 3300025246 Bacteria 2645
281 Ga0209129_1010947 3300025258 Bacteria 2212
282 Ga0209233_1000029 3300025261 Bacteria 641642
283 Ga0209233_1001063 3300025261 Bacteria 11367
284 Ga0209455_1000890 3300025272 Bacteria 15673
285 Ga0209673_1000014 3300025273 Bacteria 537082
286 Ga0209673_1000018 3300025273 Bacteria 458281
287 Ga0209130_1022654 3300025284 Bacteria 1397
288 Ga0209676_1000619 3300025292 Bacteria 51687
289 Ga0209564_1001794 3300025295 Bacteria 19831
290 Ga0209564_1002501 3300025295 Bacteria 14289
291 Ga0209758_1003524 3300025297 Bacteria 14109
292 Ga0209758_1005574 3300025297 Bacteria 9580
293 Ga0209050_1000290 3300025298 Bacteria 106310
294 Ga0207426_1000148 3300025302 Bacteria 190030
295 Ga0207426_1001055 3300025302 Bacteria 26141
296 Ga0207426_1029364 3300025302 Bacteria 1814
297 Ga0209051_1036440 3300025303 Unclassified 1816
298 Ga0209257_1000013 3300025304 Bacteria 1047305
299 Ga0209257_1004996 3300025304 Bacteria 9677
300 Ga0207656_10367601 3300025321 Unclassified 720
301 Ga0207710_10000898 3300025900 Bacteria 15911
302 Ga0207688_10150521 3300025901 Bacteria 1374
303 Ga0207680_10000277 3300025903 Bacteria 24642
304 Ga0207647_10000209 3300025904 Bacteria 47604
305 Ga0207647_10017871 3300025904 Bacteria 4811
306 Ga0207647_10081088 3300025904 Bacteria 1945
307 Ga0207645_10000563 3300025907 Bacteria 30643
308 Ga0207645_10149366 3300025907 Bacteria 1525
309 Ga0207654_10000739 3300025911 Bacteria 18174
310 Ga0207654_10000901 3300025911 Bacteria 16449
311 Ga0207654_10012416 3300025911 Bacteria 4365
312 Ga0207707_10740247 3300025912 Bacteria 823
313 Ga0207695_10000020 3300025913 Bacteria 723025
314 Ga0207695_10004092 3300025913 Bacteria 20044
315 Ga0207695_10009077 3300025913 Bacteria 12349
316 Ga0207695_10009438 3300025913 Bacteria 12066
317 Ga0207695_10045827 3300025913 Bacteria 4639
318 Ga0207695_10051776 3300025913 Bacteria 4308
319 Ga0207695_10216828 3300025913 Bacteria 1822
320 Ga0207695_10309984 3300025913 Bacteria 1468
321 Ga0207695_10330368 3300025913 Bacteria 1413
322 Ga0207671_10000346 3300025914 Bacteria 68081
323 Ga0207671_10000564 3300025914 Bacteria 49795
324 Ga0207671_10001557 3300025914 Bacteria 26250
325 Ga0207671_10003903 3300025914 Bacteria 14535
326 Ga0207671_10004151 3300025914 Bacteria 14003
327 Ga0207671_10006512 3300025914 Bacteria 10378
328 Ga0207671_10009204 3300025914 Bacteria 8284
329 Ga0207671_10045399 3300025914 Bacteria 3250
330 Ga0207671_10118474 3300025914 Bacteria 2022
331 Ga0207671_10605030 3300025914 Bacteria 873
332 Ga0207657_10028969 3300025919 Bacteria 5045
333 Ga0207657_10103730 3300025919 Bacteria 2357
334 Ga0207646_11417804 3300025922 Bacteria 604
335 Ga0207681_10443885 3300025923 Bacteria 1055
336 Ga0207694_10022511 3300025924 Bacteria 4782
337 Ga0207694_10028367 3300025924 Bacteria 4267
338 Ga0207694_10034659 3300025924 Bacteria 3871
339 Ga0207694_10063098 3300025924 Unclassified 2886
340 Ga0207694_10357991 3300025924 Bacteria 1209
341 Ga0207694_10815190 3300025924 Bacteria 788
342 Ga0207694_11436563 3300025924 Bacteria 583
343 Ga0207650_10022754 3300025925 Unclassified 4440
344 Ga0207650_11026529 3300025925 Bacteria 702
345 Ga0207659_10236723 3300025926 Bacteria 1475
346 Ga0207687_10022594 3300025927 Bacteria 4188
347 Ga0207687_10367194 3300025927 Unclassified 1176
348 Ga0207687_10681058 3300025927 Bacteria 871
349 Ga0207644_10007191 3300025931 Bacteria 7246
350 Ga0207690_10000609 3300025932 Bacteria 23117
351 Ga0207690_10212829 3300025932 Bacteria 1475
352 Ga0207706_10000257 3300025933 Bacteria 57965
353 Ga0207706_10012626 3300025933 Bacteria 7689
354 Ga0207706_10046663 3300025933 Bacteria 3836
355 Ga0207706_11129109 3300025933 Unclassified 654
356 Ga0207686_10330035 3300025934 Bacteria 1142
357 Ga0207709_10698634 3300025935 Bacteria 811
358 Ga0207670_10000008 3300025936 Bacteria 303208
359 Ga0207669_10042040 3300025937 Bacteria 2665
360 Ga0207704_10000696 3300025938 Bacteria 14820
361 Ga0207689_10000482 3300025942 Bacteria 37605
362 Ga0207689_10365198 3300025942 Bacteria 1201
363 Ga0207661_10942450 3300025944 Bacteria 795
364 Ga0207667_10000964 3300025949 Bacteria 36656
365 Ga0207667_10006190 3300025949 Bacteria 14526
366 Ga0207667_10019056 3300025949 Bacteria 7671
367 Ga0207667_10027187 3300025949 Bacteria 6234
368 Ga0207667_10185325 3300025949 Bacteria 2137
369 Ga0207651_10036059 3300025960 Bacteria 3224
370 Ga0207651_11127767 3300025960 Unclassified 703
371 Ga0207712_10014726 3300025961 Bacteria 5036
372 Ga0207712_10121781 3300025961 Bacteria 1975
373 Ga0207668_10011429 3300025972 Bacteria 5395
374 Ga0207668_10555735 3300025972 Bacteria 995
375 Ga0207658_10014850 3300025986 Bacteria 5337
376 Ga0207658_10388200 3300025986 Bacteria 1224
377 Ga0207658_10813686 3300025986 Bacteria 848
378 Ga0207677_10123895 3300026023 Bacteria 1949
379 Ga0207677_10145058 3300026023 Bacteria 1823
380 Ga0207677_10202209 3300026023 Unclassified 1580
381 Ga0207703_10009655 3300026035 Bacteria 7575
382 Ga0207703_10237806 3300026035 Bacteria 1636
383 Ga0207703_10557796 3300026035 Bacteria 1080
384 Ga0207639_10015805 3300026041 Bacteria 5328
385 Ga0207639_10023699 3300026041 Bacteria 4433
386 Ga0207639_10127144 3300026041 Bacteria 2104
387 Ga0207639_11056803 3300026041 Bacteria 761
388 Ga0207708_10005382 3300026075 Bacteria 9432
389 Ga0207702_10000348 3300026078 Bacteria 53003
390 Ga0207702_10007364 3300026078 Bacteria 9399
391 Ga0207702_10023438 3300026078 Bacteria 5119
392 Ga0207702_10065094 3300026078 Bacteria 3121
393 Ga0207702_10097717 3300026078 Bacteria 2585
394 Ga0207702_10152082 3300026078 Unclassified 2106
395 Ga0207702_10683797 3300026078 Bacteria 1010
396 Ga0207702_11176616 3300026078 Bacteria 761
397 Ga0207641_10000229 3300026088 Bacteria 72315
398 Ga0207641_10063323 3300026088 Bacteria 3159
399 Ga0207641_10064998 3300026088 Bacteria 3120
400 Ga0207641_10090032 3300026088 Unclassified 2682
401 Ga0207641_10916088 3300026088 Unclassified 871
402 Ga0207648_10031081 3300026089 Bacteria 4722
403 Ga0207676_10065763 3300026095 Bacteria 2888
404 Ga0207676_10442519 3300026095 Bacteria 1224
405 Ga0207676_10451149 3300026095 Unclassified 1212
406 Ga0207674_10040252 3300026116 Bacteria 4842
407 Ga0207674_10134034 3300026116 Bacteria 2440
408 Ga0207674_10722828 3300026116 Unclassified 961
409 Ga0207675_100004300 3300026118 Bacteria 13763
410 Ga0207675_100077488 3300026118 Bacteria 3114
411 Ga0207675_100143042 3300026118 Bacteria 2273
412 Ga0207675_101352969 3300026118 Bacteria 733
413 Ga0207698_10013772 3300026142 Bacteria 5350
414 Ga0207698_10029274 3300026142 Bacteria 3942
415 Ga0207698_10849334 3300026142 Bacteria 918
416 Ga0207428_10504094 3300027907 Bacteria 879
417 Ga0268266_10021378 3300028379 Bacteria 5512
418 Ga0268265_10159244 3300028380 Bacteria 1915
419 Ga0268264_10000149 3300028381 Bacteria 163972
420 Ga0268264_10012662 3300028381 Bacteria 6944
421 Ga0268264_10296600 3300028381 Bacteria 1520
422 Ga0268264_10876781 3300028381 Bacteria 900
423 Ga0307515_10000081 3300028794 Bacteria 224753
424 Ga0307515_10000565 3300028794 Bacteria 87276
425 Ga0307515_10000675 3300028794 Bacteria 78628
426 Ga0307515_10142363 3300028794 Unclassified 2564
427 Ga0307515_10359506 3300028794 Bacteria 1098
428 Ga0265338_10248061 3300028800 Bacteria 1315
429 Ga0307512_10392173 3300030522 Unclassified 588
430 Ga0316177_1209065 3300030731 Bacteria 2177
431 Ga0316176_1099934 3300030732 Bacteria 17940
432 Ga0307513_10063037 3300031456 Bacteria 3914
433 Ga0307513_10198062 3300031456 Unclassified 1853
434 Ga0307509_10075078 3300031507 Bacteria 3512
435 Ga0307509_10075918 3300031507 Bacteria 3489
436 Ga0307509_10215601 3300031507 Bacteria 1739
437 Ga0307509_10390306 3300031507 Bacteria 1102
438 Ga0265313_10080134 3300031595 Bacteria 1485
439 Ga0307508_10018666 3300031616 Bacteria 6303
440 Ga0307508_10186593 3300031616 Bacteria 1676
441 Ga0307516_10039934 3300031730 Bacteria 4674
442 Ga0307405_10029850 3300031731 Bacteria 3190
443 Ga0307412_10059595 3300031911 Bacteria 2559
444 Ga0307414_10010345 3300032004 Bacteria 5408
445 Ga0307507_10000225 3300033179 Bacteria 107651
446 Ga0307507_10127368 3300033179 Bacteria 2008
447 Ga0307510_10086961 3300033180 Bacteria 2995
448 Ga0373935_0298034 3300035692 Unclassified 1139
449 Ga0373935_1033963 3300035692 Bacteria 611
450 Ga0395899_0000237 3300037312 Bacteria 74249
451 Ga0395899_0000696 3300037312 Bacteria 33847
452 Ga0395900_0000197 3300037418 Bacteria 95775
453 Ga0395900_0020011 3300037418 Bacteria 6823
454 Ga0395898_0047871 3300037466 Bacteria 4193
455 Ga0395905_0000186 3300037471 Bacteria 99159
456 Ga0395905_0016974 3300037471 Bacteria 6912
457 Ga0395905_0021319 3300037471 Bacteria 6130
458 Ga0436361_0993878 3300039447 Bacteria 2685
459 Ga0439436_0026131 3300041404 Bacteria 1713
460 Ga0439465_0148686 3300041413 Bacteria 835
461 Ga0451797_1221364 3300041453 Bacteria 909
462 Ga0451802_0792178 3300041460 Unclassified 813
463 Ga0451802_1079529 3300041460 Bacteria 593
464 Ga0451849_0616948 3300041505 Unclassified 542
465 Ga0451843_0634422 3300041509 Bacteria 1035
466 Ga0451855_0059125 3300041511 Unclassified 618
467 Ga0451853_0142508 3300041512 Bacteria 1034
468 Ga0439448_0007149 3300042005 Bacteria 3227
469 Ga0439449_0023190 3300042007 Bacteria 2322
470 Ga0439449_0133710 3300042007 Bacteria 922
471 Ga0439449_0164646 3300042007 Unclassified 828
472 Ga0439457_000663 3300042014 Bacteria 10198
473 Ga0466972_0104902 3300044658 Bacteria 1337
474 Ga0466972_0110767 3300044658 Bacteria 1297
475 Ga0466972_0505801 3300044658 Unclassified 569
476 Ga0466961_0073215 3300044693 Unclassified 2173
477 Ga0466970_0010634 3300044765 Bacteria 4674
478 Ga0466970_0242240 3300044765 Unclassified 1009
479 Ga0466957_0012709 3300044842 Bacteria 4879
480 Ga0466957_0727253 3300044842 Bacteria 702
481 Ga0466959_0001443 3300045049 Bacteria 14558
482 Ga0466959_0602594 3300045049 Bacteria 739
483 Ga0495629_0858676 3300046459 Bacteria 597
484 Ga0495638_0196386 3300046460 Bacteria 1142
485 Ga0495638_0240382 3300046460 Bacteria 1003
486 Ga0495651_0073140 3300046462 Bacteria 2603
487 Ga0495651_0337327 3300046462 Bacteria 1000
488 Ga0495651_0463467 3300046462 Bacteria 817
489 Ga0495650_0032159 3300046471 Bacteria 2350
490 Ga0495580_0673420 3300046472 Bacteria 679
491 Ga0495606_0005856 3300046507 Bacteria 11585
492 Ga0495606_0315474 3300046507 Bacteria 842
493 Ga0495608_0411119 3300046511 Bacteria 827
494 Ga0495616_0000883 3300046513 Bacteria 21770
495 Ga0495620_0128340 3300046515 Bacteria 996
496 Ga0495631_0006002 3300046518 Bacteria 6316
497 Ga0495632_0277687 3300046519 Bacteria 746
498 Ga0495648_0078714 3300046524 Bacteria 1884
499 Ga0495648_0116985 3300046524 Bacteria 1439
500 Ga0495648_0280610 3300046524 Unclassified 790
501 Ga0495648_0313299 3300046524 Bacteria 730
502 Ga0495663_0197671 3300046525 Bacteria 701
503 Ga0495642_0498006 3300046528 Unclassified 539
504 Ga0495652_0108579 3300046529 Bacteria 2236
505 Ga0495652_0355720 3300046529 Bacteria 1048
506 Ga0495654_0149522 3300046530 Bacteria 1034
507 Ga0495609_0004199 3300046538 Bacteria 7986
508 Ga0495633_0000015 3300046558 Bacteria 254484
509 Ga0495668_0000021 3300046616 Bacteria 381308
510 Ga0495668_0000312 3300046616 Bacteria 66963
511 Ga0495668_0044413 3300046616 Unclassified 2470
512 Ga0495668_0631238 3300046616 Bacteria 592
513 Ga0495611_0000873 3300046648 Bacteria 16406
514 Ga0495625_0000239 3300046660 Bacteria 85876
515 Ga0495625_0000282 3300046660 Bacteria 79268
516 Ga0495625_0037573 3300046660 Bacteria 3552
517 Ga0495625_0039862 3300046660 Bacteria 3428
518 Ga0495625_0044826 3300046660 Bacteria 3200
519 Ga0495625_0082266 3300046660 Bacteria 2239
520 Ga0495625_0179366 3300046660 Bacteria 1410
521 Ga0495625_0848950 3300046660 Unclassified 527
522 Ga0495661_0022073 3300046665 Bacteria 4143
523 Ga0495658_0094451 3300046683 Bacteria 1776
524 Ga0495671_0302099 3300046692 Bacteria 770
525 Ga0495649_0051111 3300046694 Bacteria 2242
526 Ga0495683_0050690 3300047323 Bacteria 2077
527 Ga0495687_120335 3300047443 Bacteria 949
528 Ga0495686_0000106 3300047472 Bacteria 175852
529 Ga0495686_0010035 3300047472 Bacteria 6764
530 Ga0495686_0352021 3300047472 Bacteria 800
531 Ga0496101_0077969 3300048904 Bacteria 2443
532 Ga0496112_0793288 3300048915 Bacteria 872
533 Ga0496121_0000007 3300048924 Bacteria 942516
534 Ga0496121_0130116 3300048924 Unclassified 1885
535 Ga0496125_0371057 3300048928 Bacteria 847
536 Ga0495678_003539 3300049459 Bacteria 9587
537 Ga0495682_0011515 3300049460 Bacteria 3403
538 Ga0501223_101150 3300049663 Unclassified 594
539 Ga0501238_047502 3300049671 Unclassified 639
540 Ga0501249_032921 3300049679 Bacteria 1160
541 Ga0501225_0028951 3300049705 Bacteria 1522
542 Ga0501269_000497 3300049766 Bacteria 8141
543 nmdc:mga03n38_277482_c1 3300050490 Unclassified 893
544 nmdc:mga0k408_26900_c1 3300050493 Bacteria 3263
545 nmdc:mga0k408_603721_c1 3300050493 Unclassified 647
546 nmdc:mga0k408_72218_c1 3300050493 Bacteria 2015
547 nmdc:mga0k408_96_c1 3300050493 Bacteria 42356
548 nmdc:mga05p37_28459_c1 3300050507 Bacteria 6813
549 nmdc:mga05p37_5508_c1 3300050507 Bacteria 14870
550 nmdc:mga09592_20965_c1 3300050508 Bacteria 5381
551 nmdc:mga0qj67_25286_c1 3300050509 Bacteria 4587
552 nmdc:mga06r32_2991_c1 3300050510 Bacteria 15132
553 nmdc:mga08y16_237834_c1 3300050511 Bacteria 1883
554 nmdc:mga0rr50_720108_c1 3300050513 Bacteria 852
555 nmdc:mga0a205_198069_c1 3300050515 Bacteria 1900
556 Ga0500578_0000066 3300053086 Bacteria 116854
557 Ga0500578_0267908 3300053086 Bacteria 1023
558 Ga0500644_0000847 3300053088 Bacteria 10224
559 Ga0500644_0026403 3300053088 Bacteria 1797
560 Ga0500646_0107523 3300053090 Unclassified 883
561 Ga0500583_0000030 3300053092 Bacteria 105809
562 Ga0500583_0000384 3300053092 Bacteria 14299
563 Ga0500650_0052238 3300053098 Bacteria 1900
564 Ga0500555_033216 3300053103 Bacteria 1455
565 Ga0500556_0060082 3300053104 Bacteria 1398
566 Ga0500569_003066 3300053109 Unclassified 3369
567 Ga0500572_077496 3300053111 Bacteria 1037
568 Ga0500607_252359 3300053121 Unclassified 700
569 Ga0500608_000436 3300053122 Bacteria 15703
570 Ga0500614_014154 3300053123 Bacteria 1762
571 Ga0500618_000051 3300053125 Bacteria 104272
572 Ga0500652_204491 3300053131 Bacteria 800
573 Ga0500655_036454 3300053133 Unclassified 957
574 Ga0500658_0012057 3300053134 Unclassified 3186
575 Ga0500559_0029203 3300053136 Bacteria 2360
576 Ga0500564_153007 3300053138 Bacteria 982
577 Ga0500573_0228024 3300053140 Bacteria 973
578 Ga0500588_0130808 3300053146 Unclassified 893
579 Ga0500616_0002312 3300053153 Bacteria 16122
580 Ga0500616_0050825 3300053153 Bacteria 2187
581 Ga0500616_0051935 3300053153 Bacteria 2158
582 Ga0500616_0068085 3300053153 Bacteria 1824
583 Ga0500616_0082297 3300053153 Bacteria 1615
584 Ga0500616_0101043 3300053153 Bacteria 1409
585 Ga0500622_0000016 3300053156 Bacteria 337983
586 Ga0500622_0000130 3300053156 Bacteria 79522
587 Ga0500622_0001291 3300053156 Bacteria 20383
588 Ga0500622_0122744 3300053156 Bacteria 1258
589 Ga0500627_0384760 3300053158 Unclassified 600
590 Ga0500633_0006238 3300053160 Unclassified 2907
591 Ga0500633_0058345 3300053160 Bacteria 1352
592 Ga0500634_0142569 3300053161 Bacteria 1132
593 Ga0500611_000003 3300053727 Bacteria 333431
594 Ga0500611_072823 3300053727 Unclassified 841
595 Ga0500645_046351 3300053730 Bacteria 1276

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013296 Ga0157374_10071131 Ga0157374_100711314 145
2 3300005617 Ga0068859_100001600 Ga0068859_1000016008 147
3 3300006931 Ga0097620_100001600 Ga0097620_1000016008 147
4 3300009098 Ga0105245_12030687 Ga0105245_120306872 147
5 iso_pu_bacteria 2816332119 2816422368 148
6 3300003320 rootH2_10113973 rootH2_101139732 149
7 3300005535 Ga0070684_100614341 Ga0070684_1006143412 150
8 3300005547 Ga0070693_100121101 Ga0070693_1001211013 150
9 3300009551 Ga0105238_12073404 Ga0105238_120734041 150
10 3300025912 Ga0207707_10740247 Ga0207707_107402471 150
11 3300025924 Ga0207694_11436563 Ga0207694_114365631 150
12 3300025944 Ga0207661_10942450 Ga0207661_109424502 150
13 3300026078 Ga0207702_10683797 Ga0207702_106837973 150
14 3300048915 Ga0496112_0793288 Ga0496112_0793288_57_512 150
15 iso_pu_bacteria 2738541278 2738728170 150
16 iso_pu_bacteria 2896085136 2896087512 151
17 3300005614 Ga0068856_100260872 Ga0068856_1002608722 152
18 3300005840 Ga0068870_10091673 Ga0068870_100916732 152
19 3300006844 Ga0075428_100005123 Ga0075428_1000051234 152
20 3300006846 Ga0075430_100001516 Ga0075430_10000151615 152
21 3300006847 Ga0075431_100002814 Ga0075431_1000028147 152
22 3300006880 Ga0075429_100003015 Ga0075429_1000030154 152
23 3300009147 Ga0114129_10005409 Ga0114129_100054096 152
24 3300025949 Ga0207667_10185325 Ga0207667_101853253 152
25 3300026078 Ga0207702_10152082 Ga0207702_101520822 152
26 3300026118 Ga0207675_101352969 Ga0207675_1013529691 152
27 3300031595 Ga0265313_10080134 Ga0265313_100801342 152
28 3300050507 nmdc:mga05p37_5508_c1 nmdc:mga05p37_5508_c1_12731_13192 152
29 3300050508 nmdc:mga09592_20965_c1 nmdc:mga09592_20965_c1_3829_4290 152
30 3300050509 nmdc:mga0qj67_25286_c1 nmdc:mga0qj67_25286_c1_2876_3337 152
31 3300050510 nmdc:mga06r32_2991_c1 nmdc:mga06r32_2991_c1_3121_3582 152
32 iso_pu_bacteria 2929154850 2929155922 152
33 3300003320 rootH2_10019378 rootH2_100193784 153
34 3300003322 rootL2_10012167 rootL2_100121673 153
35 3300003323 rootH1_10000759 rootH1_1000075945 153
36 3300005341 Ga0070691_10049848 Ga0070691_100498482 153
37 3300005347 Ga0070668_100029338 Ga0070668_1000293382 153
38 3300005347 Ga0070668_101364475 Ga0070668_1013644751 153
39 3300005353 Ga0070669_100774379 Ga0070669_1007743791 153
40 3300005364 Ga0070673_101070907 Ga0070673_1010709072 153
41 3300005366 Ga0070659_101091871 Ga0070659_1010918711 153
42 3300005441 Ga0070700_100027062 Ga0070700_1000270623 153
43 3300005457 Ga0070662_100004637 Ga0070662_10000463712 153
44 3300005457 Ga0070662_100044715 Ga0070662_1000447155 153
45 3300005471 Ga0070698_100026527 Ga0070698_1000265274 153
46 3300005539 Ga0068853_100002873 Ga0068853_1000028738 153
47 3300005539 Ga0068853_100156705 Ga0068853_1001567055 153
48 3300005546 Ga0070696_100016321 Ga0070696_1000163216 153
49 3300005563 Ga0068855_100753222 Ga0068855_1007532221 153
50 3300005577 Ga0068857_101093887 Ga0068857_1010938872 153
51 3300005616 Ga0068852_100059682 Ga0068852_1000596822 153
52 3300005616 Ga0068852_100060715 Ga0068852_1000607152 153
53 3300005719 Ga0068861_100028049 Ga0068861_1000280494 153
54 3300005981 Ga0081538_10021709 Ga0081538_100217092 153
55 3300006195 Ga0075366_10325615 Ga0075366_103256152 153
56 3300006358 Ga0068871_101212153 Ga0068871_1012121532 153
57 3300009093 Ga0105240_10146734 Ga0105240_101467342 153
58 3300009098 Ga0105245_10047883 Ga0105245_100478832 153
59 3300009545 Ga0105237_10002191 Ga0105237_1000219119 153
60 3300009551 Ga0105238_10016525 Ga0105238_1001652510 153
61 3300009551 Ga0105238_10029116 Ga0105238_100291163 153
62 3300009553 Ga0105249_10007496 Ga0105249_1000749613 153
63 3300010375 Ga0105239_10002354 Ga0105239_100023548 153
64 3300011119 Ga0105246_11094045 Ga0105246_110940452 153
65 3300013102 Ga0157371_11006196 Ga0157371_110061961 153
66 3300013306 Ga0163162_10146954 Ga0163162_101469544 153
67 3300017792 Ga0163161_10053957 Ga0163161_100539576 153
68 3300025246 Ga0209646_1004231 Ga0209646_10042313 153
69 3300025901 Ga0207688_10150521 Ga0207688_101505211 153
70 3300025907 Ga0207645_10149366 Ga0207645_101493662 153
71 3300025913 Ga0207695_10045827 Ga0207695_100458273 153
72 3300025914 Ga0207671_10009204 Ga0207671_1000920410 153
73 3300025922 Ga0207646_11417804 Ga0207646_114178041 153
74 3300025923 Ga0207681_10443885 Ga0207681_104438851 153
75 3300025924 Ga0207694_10028367 Ga0207694_100283676 153
76 3300025924 Ga0207694_10063098 Ga0207694_100630983 153
77 3300025925 Ga0207650_11026529 Ga0207650_110265292 153
78 3300025927 Ga0207687_10022594 Ga0207687_100225945 153
79 3300025932 Ga0207690_10212829 Ga0207690_102128292 153
80 3300025933 Ga0207706_10012626 Ga0207706_1001262612 153
81 3300025933 Ga0207706_10046663 Ga0207706_100466632 153
82 3300025961 Ga0207712_10121781 Ga0207712_101217812 153
83 3300025972 Ga0207668_10555735 Ga0207668_105557352 153
84 3300026041 Ga0207639_10015805 Ga0207639_100158054 153
85 3300026041 Ga0207639_10127144 Ga0207639_101271441 153
86 3300026075 Ga0207708_10005382 Ga0207708_100053827 153
87 3300026118 Ga0207675_100004300 Ga0207675_10000430013 153
88 3300030522 Ga0307512_10392173 Ga0307512_103921731 153
89 3300031456 Ga0307513_10063037 Ga0307513_100630378 153
90 3300031456 Ga0307513_10198062 Ga0307513_101980623 153
91 3300035692 Ga0373935_1033963 Ga0373935_1033963_21_494 153
92 3300041404 Ga0439436_0026131 Ga0439436_0026131_1166_1642 153
93 3300041509 Ga0451843_0634422 Ga0451843_0634422_534_1007 153
94 3300041511 Ga0451855_0059125 Ga0451855_0059125_129_602 153
95 3300042007 Ga0439449_0023190 Ga0439449_0023190_313_789 153
96 3300042007 Ga0439449_0133710 Ga0439449_0133710_296_769 153
97 3300042014 Ga0439457_000663 Ga0439457_000663_1621_2097 153
98 3300044658 Ga0466972_0110767 Ga0466972_0110767_227_703 153
99 3300044842 Ga0466957_0012709 Ga0466957_0012709_3521_3997 153
100 3300046515 Ga0495620_0128340 Ga0495620_0128340_433_897 153
101 3300046519 Ga0495632_0277687 Ga0495632_0277687_103_576 153
102 3300046524 Ga0495648_0280610 Ga0495648_0280610_137_610 153
103 3300046616 Ga0495668_0631238 Ga0495668_0631238_27_503 153
104 3300046648 Ga0495611_0000873 Ga0495611_0000873_9899_10372 153
105 3300046694 Ga0495649_0051111 Ga0495649_0051111_1716_2189 153
106 3300050493 nmdc:mga0k408_72218_c1 nmdc:mga0k408_72218_c1_1227_1703 153
107 3300053086 Ga0500578_0000066 Ga0500578_0000066_61785_62261 153
108 3300053090 Ga0500646_0107523 Ga0500646_0107523_117_590 153
109 3300053092 Ga0500583_0000030 Ga0500583_0000030_69157_69630 153
110 3300053092 Ga0500583_0000384 Ga0500583_0000384_3861_4334 153
111 3300053098 Ga0500650_0052238 Ga0500650_0052238_1226_1699 153
112 3300053103 Ga0500555_033216 Ga0500555_033216_56_529 153
113 3300053111 Ga0500572_077496 Ga0500572_077496_509_985 153
114 3300053140 Ga0500573_0228024 Ga0500573_0228024_358_831 153
115 3300053146 Ga0500588_0130808 Ga0500588_0130808_106_579 153
116 3300053153 Ga0500616_0051935 Ga0500616_0051935_700_1179 153
117 3300053156 Ga0500622_0122744 Ga0500622_0122744_293_766 153
118 3300053727 Ga0500611_072823 Ga0500611_072823_184_657 153
119 iso_pu_bacteria 2818991460 2819681428 153
120 iso_pu_bacteria 2842903701 2842907858 153
121 iso_pu_bacteria 2884791551 2884792194 153
122 iso_pu_bacteria 2929177148 2929179767 153
123 iso_pu_bacteria 2929239360 2929242008 153
124 iso_pu_bacteria 2945977869 2945982189 153
125 iso_pu_bacteria 2946013367 2946018420 153
126 3300001989 JGI24739J22299_10010267 JGI24739J22299_100102675 154
127 3300001991 JGI24743J22301_10065308 JGI24743J22301_100653082 154
128 3300003215 JGI25153J46596_10056687 JGI25153J46596_100566872 154
129 3300003322 rootL2_10049774 rootL2_100497741 154
130 3300003323 rootH1_10016264 rootH1_100162645 154
131 3300003771 Ga0055526_1018819 Ga0055526_10188193 154
132 3300003790 Ga0055528_1000408 Ga0055528_100040812 154
133 3300003791 Ga0055530_10000983 Ga0055530_1000098318 154
134 3300003794 Ga0055531_10000029 Ga0055531_10000029119 154
135 3300004625 Ga0055543_1007112 Ga0055543_10071123 154
136 3300005262 Ga0065165_1000212 Ga0065165_100021228 154
137 3300005331 Ga0070670_100088866 Ga0070670_1000888664 154
138 3300005331 Ga0070670_100091752 Ga0070670_1000917522 154
139 3300005334 Ga0068869_100376667 Ga0068869_1003766671 154
140 3300005335 Ga0070666_10000627 Ga0070666_1000062712 154
141 3300005338 Ga0068868_100060204 Ga0068868_1000602041 154
142 3300005338 Ga0068868_100166412 Ga0068868_1001664123 154
143 3300005347 Ga0070668_100042915 Ga0070668_1000429154 154
144 3300005347 Ga0070668_100075593 Ga0070668_1000755933 154
145 3300005353 Ga0070669_100022276 Ga0070669_1000222765 154
146 3300005355 Ga0070671_100695075 Ga0070671_1006950752 154
147 3300005364 Ga0070673_100418802 Ga0070673_1004188022 154
148 3300005367 Ga0070667_100004337 Ga0070667_10000433711 154
149 3300005367 Ga0070667_100361157 Ga0070667_1003611572 154
150 3300005367 Ga0070667_100521943 Ga0070667_1005219432 154
151 3300005367 Ga0070667_100781349 Ga0070667_1007813491 154
152 3300005466 Ga0070685_10317122 Ga0070685_103171221 154
153 3300005539 Ga0068853_100252349 Ga0068853_1002523491 154
154 3300005563 Ga0068855_100004729 Ga0068855_1000047298 154
155 3300005563 Ga0068855_100020908 Ga0068855_1000209082 154
156 3300005577 Ga0068857_100853829 Ga0068857_1008538292 154
157 3300005614 Ga0068856_100016428 Ga0068856_1000164282 154
158 3300005617 Ga0068859_100000127 Ga0068859_10000012759 154
159 3300005617 Ga0068859_100160739 Ga0068859_1001607392 154
160 3300005618 Ga0068864_100014831 Ga0068864_1000148317 154
161 3300005618 Ga0068864_100207095 Ga0068864_1002070952 154
162 3300005618 Ga0068864_100742351 Ga0068864_1007423512 154
163 3300005719 Ga0068861_100191172 Ga0068861_1001911722 154
164 3300005719 Ga0068861_100632886 Ga0068861_1006328863 154
165 3300005834 Ga0068851_10004550 Ga0068851_100045504 154
166 3300005841 Ga0068863_100001425 Ga0068863_10000142517 154
167 3300005841 Ga0068863_100019291 Ga0068863_1000192915 154
168 3300005841 Ga0068863_100032439 Ga0068863_1000324395 154
169 3300005841 Ga0068863_100220078 Ga0068863_1002200781 154
170 3300005841 Ga0068863_100237992 Ga0068863_1002379923 154
171 3300005842 Ga0068858_100002322 Ga0068858_1000023225 154
172 3300005842 Ga0068858_100872274 Ga0068858_1008722742 154
173 3300005843 Ga0068860_100006124 Ga0068860_10000612412 154
174 3300005843 Ga0068860_100155494 Ga0068860_1001554944 154
175 3300005843 Ga0068860_100333971 Ga0068860_1003339712 154
176 3300005844 Ga0068862_100118814 Ga0068862_1001188142 154
177 3300006237 Ga0097621_100011238 Ga0097621_1000112386 154
178 3300006237 Ga0097621_100394763 Ga0097621_1003947632 154
179 3300006358 Ga0068871_100009082 Ga0068871_1000090824 154
180 3300006881 Ga0068865_100292729 Ga0068865_1002927291 154
181 3300006931 Ga0097620_100000127 Ga0097620_10000012712 154
182 3300006931 Ga0097620_100160747 Ga0097620_1001607472 154
183 3300006931 Ga0097620_101600017 Ga0097620_1016000172 154
184 3300009093 Ga0105240_10334536 Ga0105240_103345363 154
185 3300009093 Ga0105240_12115146 Ga0105240_121151462 154
186 3300009093 Ga0105240_12249730 Ga0105240_122497301 154
187 3300009098 Ga0105245_10057741 Ga0105245_100577413 154
188 3300009098 Ga0105245_10840337 Ga0105245_108403373 154
189 3300009101 Ga0105247_10000331 Ga0105247_1000033142 154
190 3300009101 Ga0105247_10037482 Ga0105247_100374823 154
191 3300009174 Ga0105241_10044024 Ga0105241_100440241 154
192 3300009176 Ga0105242_10162575 Ga0105242_101625753 154
193 3300009545 Ga0105237_10006672 Ga0105237_100066725 154
194 3300009545 Ga0105237_10057817 Ga0105237_100578177 154
195 3300009545 Ga0105237_10836204 Ga0105237_108362041 154
196 3300009553 Ga0105249_10002916 Ga0105249_1000291613 154
197 3300009553 Ga0105249_10037692 Ga0105249_100376924 154
198 3300010375 Ga0105239_10005302 Ga0105239_1000530211 154
199 3300010375 Ga0105239_10137928 Ga0105239_101379283 154
200 3300010375 Ga0105239_10236866 Ga0105239_102368663 154
201 3300010375 Ga0105239_10819953 Ga0105239_108199532 154
202 3300011119 Ga0105246_10063199 Ga0105246_100631992 154
203 3300011119 Ga0105246_10104316 Ga0105246_101043164 154
204 3300011119 Ga0105246_10510772 Ga0105246_105107722 154
205 3300013296 Ga0157374_10280575 Ga0157374_102805752 154
206 3300013296 Ga0157374_10876567 Ga0157374_108765671 154
207 3300013297 Ga0157378_10030417 Ga0157378_100304171 154
208 3300013306 Ga0163162_10063575 Ga0163162_100635756 154
209 3300013307 Ga0157372_10636444 Ga0157372_106364442 154
210 3300013308 Ga0157375_10024183 Ga0157375_100241833 154
211 3300013308 Ga0157375_10042553 Ga0157375_100425532 154
212 3300013308 Ga0157375_11156940 Ga0157375_111569402 154
213 3300014325 Ga0163163_10067466 Ga0163163_100674663 154
214 3300014325 Ga0163163_10237514 Ga0163163_102375143 154
215 3300014325 Ga0163163_11296641 Ga0163163_112966411 154
216 3300014968 Ga0157379_10088615 Ga0157379_100886155 154
217 3300014969 Ga0157376_10266456 Ga0157376_102664562 154
218 3300014969 Ga0157376_10919627 Ga0157376_109196272 154
219 3300025273 Ga0209673_1000014 Ga0209673_1000014436 154
220 3300025273 Ga0209673_1000018 Ga0209673_1000018384 154
221 3300025295 Ga0209564_1001794 Ga0209564_10017943 154
222 3300025295 Ga0209564_1002501 Ga0209564_100250112 154
223 3300025297 Ga0209758_1003524 Ga0209758_10035246 154
224 3300025297 Ga0209758_1005574 Ga0209758_100557411 154
225 3300025298 Ga0209050_1000290 Ga0209050_100029027 154
226 3300025302 Ga0207426_1001055 Ga0207426_100105520 154
227 3300025303 Ga0209051_1036440 Ga0209051_10364403 154
228 3300025304 Ga0209257_1000013 Ga0209257_1000013753 154
229 3300025304 Ga0209257_1004996 Ga0209257_10049965 154
230 3300025321 Ga0207656_10367601 Ga0207656_103676011 154
231 3300025900 Ga0207710_10000898 Ga0207710_100008989 154
232 3300025903 Ga0207680_10000277 Ga0207680_1000027710 154
233 3300025911 Ga0207654_10000739 Ga0207654_1000073915 154
234 3300025914 Ga0207671_10003903 Ga0207671_100039036 154
235 3300025925 Ga0207650_10022754 Ga0207650_100227543 154
236 3300025926 Ga0207659_10236723 Ga0207659_102367232 154
237 3300025927 Ga0207687_10367194 Ga0207687_103671942 154
238 3300025927 Ga0207687_10681058 Ga0207687_106810581 154
239 3300025934 Ga0207686_10330035 Ga0207686_103300351 154
240 3300025936 Ga0207670_10000008 Ga0207670_1000000855 154
241 3300025942 Ga0207689_10000482 Ga0207689_1000048226 154
242 3300025942 Ga0207689_10365198 Ga0207689_103651982 154
243 3300025949 Ga0207667_10019056 Ga0207667_100190565 154
244 3300025960 Ga0207651_11127767 Ga0207651_111277672 154
245 3300025961 Ga0207712_10014726 Ga0207712_100147263 154
246 3300025972 Ga0207668_10011429 Ga0207668_100114293 154
247 3300025986 Ga0207658_10014850 Ga0207658_100148503 154
248 3300025986 Ga0207658_10388200 Ga0207658_103882002 154
249 3300025986 Ga0207658_10813686 Ga0207658_108136861 154
250 3300026023 Ga0207677_10123895 Ga0207677_101238953 154
251 3300026035 Ga0207703_10009655 Ga0207703_100096553 154
252 3300026035 Ga0207703_10557796 Ga0207703_105577961 154
253 3300026041 Ga0207639_11056803 Ga0207639_110568032 154
254 3300026078 Ga0207702_10065094 Ga0207702_100650942 154
255 3300026088 Ga0207641_10000229 Ga0207641_1000022960 154
256 3300026088 Ga0207641_10063323 Ga0207641_100633233 154
257 3300026088 Ga0207641_10090032 Ga0207641_100900322 154
258 3300026088 Ga0207641_10916088 Ga0207641_109160881 154
259 3300026095 Ga0207676_10065763 Ga0207676_100657635 154
260 3300026095 Ga0207676_10451149 Ga0207676_104511492 154
261 3300026116 Ga0207674_10134034 Ga0207674_101340342 154
262 3300026118 Ga0207675_100077488 Ga0207675_1000774883 154
263 3300026118 Ga0207675_100143042 Ga0207675_1001430422 154
264 3300026142 Ga0207698_10029274 Ga0207698_100292743 154
265 3300028380 Ga0268265_10159244 Ga0268265_101592442 154
266 3300028381 Ga0268264_10012662 Ga0268264_100126623 154
267 3300028381 Ga0268264_10296600 Ga0268264_102966002 154
268 3300028381 Ga0268264_10876781 Ga0268264_108767811 154
269 3300028794 Ga0307515_10000565 Ga0307515_1000056575 154
270 3300028794 Ga0307515_10142363 Ga0307515_101423633 154
271 3300028794 Ga0307515_10359506 Ga0307515_103595062 154
272 3300031507 Ga0307509_10215601 Ga0307509_102156014 154
273 3300031507 Ga0307509_10390306 Ga0307509_103903061 154
274 3300031616 Ga0307508_10186593 Ga0307508_101865932 154
275 3300031730 Ga0307516_10039934 Ga0307516_100399345 154
276 3300032004 Ga0307414_10010345 Ga0307414_100103459 154
277 3300033179 Ga0307507_10127368 Ga0307507_101273682 154
278 3300037471 Ga0395905_0021319 Ga0395905_0021319_3409_3891 154
279 3300041460 Ga0451802_1079529 Ga0451802_1079529_13_483 154
280 3300041512 Ga0451853_0142508 Ga0451853_0142508_448_918 154
281 3300044658 Ga0466972_0104902 Ga0466972_0104902_411_884 154
282 3300044658 Ga0466972_0505801 Ga0466972_0505801_67_546 154
283 3300046460 Ga0495638_0196386 Ga0495638_0196386_607_1086 154
284 3300046616 Ga0495668_0044413 Ga0495668_0044413_1742_2212 154
285 3300046660 Ga0495625_0848950 Ga0495625_0848950_22_495 154
286 3300046665 Ga0495661_0022073 Ga0495661_0022073_2163_2639 154
287 3300046692 Ga0495671_0302099 Ga0495671_0302099_273_740 154
288 3300048904 Ga0496101_0077969 Ga0496101_0077969_1458_1925 154
289 3300048928 Ga0496125_0371057 Ga0496125_0371057_230_724 154
290 3300050493 nmdc:mga0k408_26900_c1 nmdc:mga0k408_26900_c1_1273_1752 154
291 3300050493 nmdc:mga0k408_603721_c1 nmdc:mga0k408_603721_c1_67_540 154
292 3300050507 nmdc:mga05p37_28459_c1 nmdc:mga05p37_28459_c1_4731_5210 154
293 3300053086 Ga0500578_0267908 Ga0500578_0267908_356_826 154
294 3300053088 Ga0500644_0000847 Ga0500644_0000847_7326_7805 154
295 3300053088 Ga0500644_0026403 Ga0500644_0026403_690_1163 154
296 3300053109 Ga0500569_003066 Ga0500569_003066_694_1176 154
297 3300053121 Ga0500607_252359 Ga0500607_252359_187_669 154
298 3300053134 Ga0500658_0012057 Ga0500658_0012057_1872_2354 154
299 3300053153 Ga0500616_0068085 Ga0500616_0068085_1036_1506 154
300 3300053153 Ga0500616_0101043 Ga0500616_0101043_631_1113 154
301 3300053156 Ga0500622_0000016 Ga0500622_0000016_73540_74010 154
302 3300053156 Ga0500622_0000130 Ga0500622_0000130_68787_69272 154
303 3300053156 Ga0500622_0001291 Ga0500622_0001291_11184_11657 154
304 3300053158 Ga0500627_0384760 Ga0500627_0384760_110_580 154
305 3300053160 Ga0500633_0006238 Ga0500633_0006238_1459_1938 154
306 3300053160 Ga0500633_0058345 Ga0500633_0058345_726_1208 154
307 3300053161 Ga0500634_0142569 Ga0500634_0142569_365_844 154
308 3300053727 Ga0500611_000003 Ga0500611_000003_52208_52684 154
309 3300003322 rootL2_10241177 rootL2_102411771 155
310 3300005548 Ga0070665_100117950 Ga0070665_1001179504 155
311 3300005577 Ga0068857_100709055 Ga0068857_1007090551 155
312 3300005614 Ga0068856_100005502 Ga0068856_1000055025 155
313 3300006051 Ga0075364_10794199 Ga0075364_107941991 155
314 3300006852 Ga0075433_10059192 Ga0075433_100591922 155
315 3300006871 Ga0075434_100010992 Ga0075434_1000109921 155
316 3300009094 Ga0111539_10250833 Ga0111539_102508332 155
317 3300011119 Ga0105246_10177884 Ga0105246_101778842 155
318 3300013308 Ga0157375_12282558 Ga0157375_122825581 155
319 3300026078 Ga0207702_10097717 Ga0207702_100977172 155
320 3300026116 Ga0207674_10722828 Ga0207674_107228282 155
321 3300027907 Ga0207428_10504094 Ga0207428_105040941 155
322 3300031616 Ga0307508_10018666 Ga0307508_100186662 155
323 3300033180 Ga0307510_10086961 Ga0307510_100869614 155
324 3300041413 Ga0439465_0148686 Ga0439465_0148686_110_583 155
325 3300044842 Ga0466957_0727253 Ga0466957_0727253_145_615 155
326 3300045049 Ga0466959_0602594 Ga0466959_0602594_21_491 155
327 3300050490 nmdc:mga03n38_277482_c1 nmdc:mga03n38_277482_c1_45_518 155
328 3300050511 nmdc:mga08y16_237834_c1 nmdc:mga08y16_237834_c1_492_965 155
329 3300050513 nmdc:mga0rr50_720108_c1 nmdc:mga0rr50_720108_c1_319_792 155
330 3300050515 nmdc:mga0a205_198069_c1 nmdc:mga0a205_198069_c1_1090_1563 155
331 3300053730 Ga0500645_046351 Ga0500645_046351_322_798 155
332 iso_pu_bacteria 2919437846 2919440386 155
333 3300002737 JGI25162J39368_1002581 JGI25162J39368_10025815 156
334 3300002739 JGI25158J39367_1009425 JGI25158J39367_10094252 156
335 3300002772 JGI25164J39214_1002580 JGI25164J39214_10025803 156
336 3300003214 JGI25165J46597_1001654 JGI25165J46597_10016545 156
337 3300003323 rootH1_10057158 rootH1_1005715813 156
338 3300003323 rootH1_10177811 rootH1_101778113 156
339 3300003354 JGI25160J50197_1003474 JGI25160J50197_10034747 156
340 3300005366 Ga0070659_100000100 Ga0070659_10000010043 156
341 3300005548 Ga0070665_100004187 Ga0070665_10000418712 156
342 3300005841 Ga0068863_100307735 Ga0068863_1003077352 156
343 3300005843 Ga0068860_100000323 Ga0068860_10000032312 156
344 3300005937 Ga0081455_10029048 Ga0081455_100290482 156
345 3300006237 Ga0097621_100276908 Ga0097621_1002769081 156
346 3300009093 Ga0105240_10217489 Ga0105240_102174892 156
347 3300009177 Ga0105248_12265795 Ga0105248_122657951 156
348 3300009545 Ga0105237_10000306 Ga0105237_1000030613 156
349 3300009545 Ga0105237_10000951 Ga0105237_1000095122 156
350 3300009551 Ga0105238_10002988 Ga0105238_100029882 156
351 3300009551 Ga0105238_10381580 Ga0105238_103815802 156
352 3300009551 Ga0105238_12259852 Ga0105238_122598521 156
353 3300010375 Ga0105239_10000086 Ga0105239_1000008650 156
354 3300010375 Ga0105239_10036564 Ga0105239_100365645 156
355 3300013104 Ga0157370_11010300 Ga0157370_110103002 156
356 3300013297 Ga0157378_10773715 Ga0157378_107737152 156
357 3300025208 Ga0209436_100592 Ga0209436_10059216 156
358 3300025230 Ga0209563_106596 Ga0209563_1065962 156
359 3300025231 Ga0207427_100131 Ga0207427_10013189 156
360 3300025233 Ga0209437_100048 Ga0209437_10004821 156
361 3300025261 Ga0209233_1000029 Ga0209233_1000029356 156
362 3300025284 Ga0209130_1022654 Ga0209130_10226542 156
363 3300025302 Ga0207426_1000148 Ga0207426_10001488 156
364 3300025904 Ga0207647_10081088 Ga0207647_100810883 156
365 3300025913 Ga0207695_10009438 Ga0207695_100094385 156
366 3300025913 Ga0207695_10330368 Ga0207695_103303682 156
367 3300025914 Ga0207671_10000346 Ga0207671_1000034613 156
368 3300025914 Ga0207671_10001557 Ga0207671_100015579 156
369 3300025924 Ga0207694_10034659 Ga0207694_100346593 156
370 3300025924 Ga0207694_10357991 Ga0207694_103579912 156
371 3300025924 Ga0207694_10815190 Ga0207694_108151902 156
372 3300025932 Ga0207690_10000609 Ga0207690_1000060921 156
373 3300025935 Ga0207709_10698634 Ga0207709_106986341 156
374 3300026088 Ga0207641_10064998 Ga0207641_100649983 156
375 3300026095 Ga0207676_10442519 Ga0207676_104425192 156
376 3300028379 Ga0268266_10021378 Ga0268266_100213784 156
377 3300028381 Ga0268264_10000149 Ga0268264_1000014993 156
378 3300031507 Ga0307509_10075918 Ga0307509_100759184 156
379 3300041453 Ga0451797_1221364 Ga0451797_1221364_384_860 156
380 3300041460 Ga0451802_0792178 Ga0451802_0792178_149_628 156
381 3300041505 Ga0451849_0616948 Ga0451849_0616948_16_510 156
382 3300046462 Ga0495651_0463467 Ga0495651_0463467_53_532 156
383 3300046472 Ga0495580_0673420 Ga0495580_0673420_59_535 156
384 3300048924 Ga0496121_0130116 Ga0496121_0130116_1252_1728 156
385 3300053136 Ga0500559_0029203 Ga0500559_0029203_1079_1555 156
386 3300053153 Ga0500616_0050825 Ga0500616_0050825_582_1058 156
387 3300002737 JGI25162J39368_1000292 JGI25162J39368_100029210 157
388 3300003316 rootH1_10158098 rootH1_101580981 157
389 3300003320 rootH2_10092343 rootH2_100923434 157
390 3300003323 rootH1_10098778 rootH1_100987783 157
391 3300005288 Ga0065714_10136970 Ga0065714_101369701 157
392 3300005544 Ga0070686_101309600 Ga0070686_1013096001 157
393 3300005577 Ga0068857_100117212 Ga0068857_1001172122 157
394 3300006195 Ga0075366_10000076 Ga0075366_1000007635 157
395 3300006353 Ga0075370_10409112 Ga0075370_104091122 157
396 3300009093 Ga0105240_10000020 Ga0105240_1000002032 157
397 3300009093 Ga0105240_11196078 Ga0105240_111960782 157
398 3300010375 Ga0105239_10000305 Ga0105239_1000030510 157
399 3300010375 Ga0105239_10000786 Ga0105239_1000078632 157
400 3300013104 Ga0157370_10123789 Ga0157370_101237892 157
401 3300013104 Ga0157370_10631070 Ga0157370_106310702 157
402 3300025233 Ga0209437_100041 Ga0209437_10004110 157
403 3300025258 Ga0209129_1010947 Ga0209129_10109472 157
404 3300025913 Ga0207695_10000020 Ga0207695_10000020494 157
405 3300028794 Ga0307515_10000081 Ga0307515_1000008154 157
406 3300028794 Ga0307515_10000675 Ga0307515_100006756 157
407 3300030731 Ga0316177_1209065 Ga0316177_12090652 157
408 3300030732 Ga0316176_1099934 Ga0316176_10999345 157
409 3300031731 Ga0307405_10029850 Ga0307405_100298504 157
410 3300031911 Ga0307412_10059595 Ga0307412_100595953 157
411 3300033179 Ga0307507_10000225 Ga0307507_1000022540 157
412 3300042007 Ga0439449_0164646 Ga0439449_0164646_232_708 157
413 3300044693 Ga0466961_0073215 Ga0466961_0073215_942_1460 157
414 3300044765 Ga0466970_0010634 Ga0466970_0010634_3616_4098 157
415 3300044765 Ga0466970_0242240 Ga0466970_0242240_422_940 157
416 3300045049 Ga0466959_0001443 Ga0466959_0001443_9333_9851 157
417 3300046459 Ga0495629_0858676 Ga0495629_0858676_80_559 157
418 3300046462 Ga0495651_0337327 Ga0495651_0337327_335_814 157
419 3300046511 Ga0495608_0411119 Ga0495608_0411119_75_554 157
420 3300046524 Ga0495648_0116985 Ga0495648_0116985_161_640 157
421 3300046524 Ga0495648_0313299 Ga0495648_0313299_92_571 157
422 3300046525 Ga0495663_0197671 Ga0495663_0197671_30_518 157
423 3300046529 Ga0495652_0355720 Ga0495652_0355720_274_753 157
424 3300046530 Ga0495654_0149522 Ga0495654_0149522_85_564 157
425 3300046538 Ga0495609_0004199 Ga0495609_0004199_2481_2969 157
426 3300046558 Ga0495633_0000015 Ga0495633_0000015_75587_76075 157
427 3300046616 Ga0495668_0000021 Ga0495668_0000021_203209_203688 157
428 3300046616 Ga0495668_0000312 Ga0495668_0000312_16515_16991 157
429 3300046660 Ga0495625_0000239 Ga0495625_0000239_71967_72464 157
430 3300046660 Ga0495625_0000282 Ga0495625_0000282_20576_21055 157
431 3300046683 Ga0495658_0094451 Ga0495658_0094451_870_1349 157
432 3300047472 Ga0495686_0000106 Ga0495686_0000106_28567_29043 157
433 3300049460 Ga0495682_0011515 Ga0495682_0011515_550_1029 157
434 3300049663 Ga0501223_101150 Ga0501223_101150_80_556 157
435 3300049671 Ga0501238_047502 Ga0501238_047502_54_530 157
436 3300049679 Ga0501249_032921 Ga0501249_032921_618_1094 157
437 3300049705 Ga0501225_0028951 Ga0501225_0028951_184_660 157
438 3300049766 Ga0501269_000497 Ga0501269_000497_3291_3767 157
439 3300050493 nmdc:mga0k408_96_c1 nmdc:mga0k408_96_c1_28089_28586 157
440 3300053104 Ga0500556_0060082 Ga0500556_0060082_370_846 157
441 3300053123 Ga0500614_014154 Ga0500614_014154_100_579 157
442 3300053153 Ga0500616_0002312 Ga0500616_0002312_4728_5204 157
443 3300001904 JGI24736J21556_1008198 JGI24736J21556_10081982 158
444 3300001990 JGI24737J22298_10020627 JGI24737J22298_100206273 158
445 3300002077 JGI24744J21845_10012151 JGI24744J21845_100121512 158
446 3300002737 JGI25162J39368_1000016 JGI25162J39368_100001635 158
447 3300004625 Ga0055543_1026203 Ga0055543_10262032 158
448 3300005262 Ga0065165_1000043 Ga0065165_10000433 158
449 3300005288 Ga0065714_10084686 Ga0065714_100846861 158
450 3300005328 Ga0070676_10000973 Ga0070676_1000097312 158
451 3300005334 Ga0068869_100174463 Ga0068869_1001744632 158
452 3300005338 Ga0068868_100025339 Ga0068868_1000253391 158
453 3300005338 Ga0068868_100081583 Ga0068868_1000815832 158
454 3300005339 Ga0070660_100009654 Ga0070660_1000096543 158
455 3300005339 Ga0070660_100095813 Ga0070660_1000958133 158
456 3300005344 Ga0070661_100377325 Ga0070661_1003773252 158
457 3300005355 Ga0070671_100023698 Ga0070671_1000236984 158
458 3300005356 Ga0070674_100072473 Ga0070674_1000724732 158
459 3300005366 Ga0070659_100152486 Ga0070659_1001524862 158
460 3300005456 Ga0070678_100058641 Ga0070678_1000586412 158
461 3300005457 Ga0070662_100000768 Ga0070662_10000076815 158
462 3300005457 Ga0070662_100415306 Ga0070662_1004153062 158
463 3300005459 Ga0068867_100003119 Ga0068867_1000031199 158
464 3300005539 Ga0068853_100006575 Ga0068853_1000065756 158
465 3300005563 Ga0068855_100000071 Ga0068855_10000007140 158
466 3300005563 Ga0068855_100028423 Ga0068855_1000284238 158
467 3300005563 Ga0068855_100037028 Ga0068855_1000370285 158
468 3300005563 Ga0068855_100076365 Ga0068855_1000763654 158
469 3300005563 Ga0068855_100244953 Ga0068855_1002449532 158
470 3300005563 Ga0068855_100350639 Ga0068855_1003506392 158
471 3300005577 Ga0068857_100022429 Ga0068857_1000224298 158
472 3300005614 Ga0068856_100010672 Ga0068856_1000106728 158
473 3300005614 Ga0068856_100020713 Ga0068856_1000207137 158
474 3300005614 Ga0068856_100033782 Ga0068856_1000337825 158
475 3300005616 Ga0068852_100023189 Ga0068852_1000231894 158
476 3300005616 Ga0068852_100070137 Ga0068852_1000701373 158
477 3300005842 Ga0068858_100338700 Ga0068858_1003387002 158
478 3300006237 Ga0097621_100000236 Ga0097621_10000023618 158
479 3300006358 Ga0068871_100000481 Ga0068871_1000004814 158
480 3300006881 Ga0068865_100012833 Ga0068865_1000128333 158
481 3300009093 Ga0105240_10014694 Ga0105240_100146943 158
482 3300009093 Ga0105240_10028094 Ga0105240_100280948 158
483 3300009093 Ga0105240_10059160 Ga0105240_100591603 158
484 3300009093 Ga0105240_10157172 Ga0105240_101571722 158
485 3300009093 Ga0105240_10209871 Ga0105240_102098713 158
486 3300009093 Ga0105240_11381515 Ga0105240_113815152 158
487 3300009098 Ga0105245_10622452 Ga0105245_106224522 158
488 3300009174 Ga0105241_10001318 Ga0105241_100013185 158
489 3300009176 Ga0105242_10017115 Ga0105242_100171152 158
490 3300009545 Ga0105237_10001339 Ga0105237_1000133916 158
491 3300009545 Ga0105237_10032349 Ga0105237_100323492 158
492 3300009545 Ga0105237_10081112 Ga0105237_100811122 158
493 3300009545 Ga0105237_10181075 Ga0105237_101810753 158
494 3300009545 Ga0105237_10288482 Ga0105237_102884821 158
495 3300009551 Ga0105238_10009617 Ga0105238_100096178 158
496 3300010375 Ga0105239_10000026 Ga0105239_10000026128 158
497 3300010375 Ga0105239_10000478 Ga0105239_1000047840 158
498 3300010375 Ga0105239_10005859 Ga0105239_100058597 158
499 3300010375 Ga0105239_10010291 Ga0105239_100102919 158
500 3300010375 Ga0105239_10155857 Ga0105239_101558571 158
501 3300010375 Ga0105239_10334649 Ga0105239_103346492 158
502 3300010375 Ga0105239_10626143 Ga0105239_106261432 158
503 3300010375 Ga0105239_11815397 Ga0105239_118153971 158
504 3300011119 Ga0105246_10085581 Ga0105246_100855812 158
505 3300011119 Ga0105246_10151320 Ga0105246_101513202 158
506 3300013100 Ga0157373_10036424 Ga0157373_100364242 158
507 3300013102 Ga0157371_10000678 Ga0157371_1000067836 158
508 3300013102 Ga0157371_10116467 Ga0157371_101164672 158
509 3300013104 Ga0157370_10272399 Ga0157370_102723992 158
510 3300013104 Ga0157370_10416577 Ga0157370_104165772 158
511 3300013105 Ga0157369_10051787 Ga0157369_100517873 158
512 3300013105 Ga0157369_10061231 Ga0157369_100612313 158
513 3300013296 Ga0157374_10000076 Ga0157374_1000007678 158
514 3300013297 Ga0157378_10017443 Ga0157378_100174436 158
515 3300013297 Ga0157378_10058097 Ga0157378_100580974 158
516 3300013307 Ga0157372_10000243 Ga0157372_1000024335 158
517 3300013307 Ga0157372_10108654 Ga0157372_101086544 158
518 3300013308 Ga0157375_10026127 Ga0157375_100261273 158
519 3300013308 Ga0157375_10047338 Ga0157375_100473383 158
520 3300014969 Ga0157376_10047950 Ga0157376_100479502 158
521 3300015262 Ga0182007_10036379 Ga0182007_100363792 158
522 3300017792 Ga0163161_10015766 Ga0163161_100157665 158
523 3300021361 Ga0213872_10038112 Ga0213872_100381123 158
524 3300025233 Ga0209437_100262 Ga0209437_10026235 158
525 3300025261 Ga0209233_1001063 Ga0209233_10010633 158
526 3300025272 Ga0209455_1000890 Ga0209455_10008904 158
527 3300025292 Ga0209676_1000619 Ga0209676_100061916 158
528 3300025302 Ga0207426_1029364 Ga0207426_10293643 158
529 3300025904 Ga0207647_10000209 Ga0207647_1000020914 158
530 3300025904 Ga0207647_10017871 Ga0207647_100178712 158
531 3300025907 Ga0207645_10000563 Ga0207645_100005637 158
532 3300025911 Ga0207654_10000901 Ga0207654_100009013 158
533 3300025911 Ga0207654_10012416 Ga0207654_100124162 158
534 3300025913 Ga0207695_10004092 Ga0207695_1000409218 158
535 3300025913 Ga0207695_10009077 Ga0207695_1000907710 158
536 3300025913 Ga0207695_10051776 Ga0207695_100517763 158
537 3300025913 Ga0207695_10216828 Ga0207695_102168283 158
538 3300025913 Ga0207695_10309984 Ga0207695_103099842 158
539 3300025914 Ga0207671_10000564 Ga0207671_1000056414 158
540 3300025914 Ga0207671_10004151 Ga0207671_1000415110 158
541 3300025914 Ga0207671_10006512 Ga0207671_100065122 158
542 3300025914 Ga0207671_10045399 Ga0207671_100453993 158
543 3300025914 Ga0207671_10118474 Ga0207671_101184742 158
544 3300025914 Ga0207671_10605030 Ga0207671_106050302 158
545 3300025919 Ga0207657_10028969 Ga0207657_100289692 158
546 3300025919 Ga0207657_10103730 Ga0207657_101037303 158
547 3300025924 Ga0207694_10022511 Ga0207694_100225112 158
548 3300025931 Ga0207644_10007191 Ga0207644_100071917 158
549 3300025933 Ga0207706_10000257 Ga0207706_1000025751 158
550 3300025933 Ga0207706_11129109 Ga0207706_111291091 158
551 3300025937 Ga0207669_10042040 Ga0207669_100420402 158
552 3300025938 Ga0207704_10000696 Ga0207704_100006967 158
553 3300025949 Ga0207667_10000964 Ga0207667_100009642 158
554 3300025949 Ga0207667_10006190 Ga0207667_100061904 158
555 3300025949 Ga0207667_10027187 Ga0207667_100271872 158
556 3300025960 Ga0207651_10036059 Ga0207651_100360593 158
557 3300026023 Ga0207677_10145058 Ga0207677_101450583 158
558 3300026023 Ga0207677_10202209 Ga0207677_102022092 158
559 3300026035 Ga0207703_10237806 Ga0207703_102378062 158
560 3300026041 Ga0207639_10023699 Ga0207639_100236993 158
561 3300026078 Ga0207702_10000348 Ga0207702_1000034814 158
562 3300026078 Ga0207702_10007364 Ga0207702_100073647 158
563 3300026078 Ga0207702_10023438 Ga0207702_100234387 158
564 3300026078 Ga0207702_11176616 Ga0207702_111766161 158
565 3300026089 Ga0207648_10031081 Ga0207648_100310812 158
566 3300026116 Ga0207674_10040252 Ga0207674_100402526 158
567 3300026142 Ga0207698_10013772 Ga0207698_100137724 158
568 3300026142 Ga0207698_10849334 Ga0207698_108493342 158
569 3300028800 Ga0265338_10248061 Ga0265338_102480611 158
570 3300031507 Ga0307509_10075078 Ga0307509_100750782 158
571 3300035692 Ga0373935_0298034 Ga0373935_0298034_164_667 158
572 3300037312 Ga0395899_0000237 Ga0395899_0000237_16752_17237 158
573 3300037312 Ga0395899_0000696 Ga0395899_0000696_31263_31742 158
574 3300037418 Ga0395900_0000197 Ga0395900_0000197_84763_85242 158
575 3300037418 Ga0395900_0020011 Ga0395900_0020011_4507_4992 158
576 3300037466 Ga0395898_0047871 Ga0395898_0047871_1634_2113 158
577 3300037471 Ga0395905_0000186 Ga0395905_0000186_17419_17898 158
578 3300037471 Ga0395905_0016974 Ga0395905_0016974_291_776 158
579 3300039447 Ga0436361_0993878 Ga0436361_0993878_1457_1933 158
580 3300042005 Ga0439448_0007149 Ga0439448_0007149_1448_1927 158
581 3300046460 Ga0495638_0240382 Ga0495638_0240382_282_764 158
582 3300046462 Ga0495651_0073140 Ga0495651_0073140_474_956 158
583 3300046471 Ga0495650_0032159 Ga0495650_0032159_566_1048 158
584 3300046507 Ga0495606_0005856 Ga0495606_0005856_60_548 158
585 3300046507 Ga0495606_0315474 Ga0495606_0315474_257_739 158
586 3300046513 Ga0495616_0000883 Ga0495616_0000883_17261_17743 158
587 3300046518 Ga0495631_0006002 Ga0495631_0006002_1634_2113 158
588 3300046524 Ga0495648_0078714 Ga0495648_0078714_28_510 158
589 3300046528 Ga0495642_0498006 Ga0495642_0498006_28_510 158
590 3300046529 Ga0495652_0108579 Ga0495652_0108579_1634_2116 158
591 3300046660 Ga0495625_0037573 Ga0495625_0037573_142_624 158
592 3300046660 Ga0495625_0039862 Ga0495625_0039862_2812_3294 158
593 3300046660 Ga0495625_0044826 Ga0495625_0044826_1457_1942 158
594 3300046660 Ga0495625_0082266 Ga0495625_0082266_692_1174 158
595 3300046660 Ga0495625_0179366 Ga0495625_0179366_680_1162 158
596 3300047323 Ga0495683_0050690 Ga0495683_0050690_1303_1782 158
597 3300047443 Ga0495687_120335 Ga0495687_120335_281_763 158
598 3300047472 Ga0495686_0010035 Ga0495686_0010035_331_813 158
599 3300047472 Ga0495686_0352021 Ga0495686_0352021_114_596 158
600 3300048924 Ga0496121_0000007 Ga0496121_0000007_113664_114143 158
601 3300049459 Ga0495678_003539 Ga0495678_003539_2742_3224 158
602 3300053122 Ga0500608_000436 Ga0500608_000436_6710_7189 158
603 3300053125 Ga0500618_000051 Ga0500618_000051_14528_15016 158
604 3300053131 Ga0500652_204491 Ga0500652_204491_64_546 158
605 3300053133 Ga0500655_036454 Ga0500655_036454_460_945 158
606 3300053138 Ga0500564_153007 Ga0500564_153007_208_738 158
607 3300053153 Ga0500616_0082297 Ga0500616_0082297_783_1268 158

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01152

Bac_globin

Bacterial-like globin

35

148

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ux8-assembly1.cif.gz_A x-ray structure of truncated oxygen-avid haemoglobin from bacillus subtilis 0.8919 8 128
5v3u-assembly1.cif.gz_B crystal structure of the group ii truncated hemoglobin from bacillus anthracis: trp90leu mutant 0.8843 8 135
5d1v-assembly1.cif.gz_B crystal structure and thermal stability of hemoglobin from thermophilic phototrophic bacterium chloroflexus aurantiacus 0.8826 8 132
5v3v-assembly1.cif.gz_B crystal structure of the group ii truncated hemoglobin from bacillus anthracis: tyr26ala mutant 0.8821 9 135
5v3t-assembly1.cif.gz_B crystal structure of the group ii truncated hemoglobin from bacillus anthracis 0.8817 9 135
ID Description Score Start End Superfamily
1ux8A00 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.8919 8 128 1.10.490.10
5d1vB00 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.8826 8 132 1.10.490.10
1ux8A00 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.8713 8 128 1.10.490.10
5d1vB00 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.8626 8 132 1.10.490.10
af_P9WN23_1_128_1.10.490.10 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.8488 9 135 1.10.490.10
ID Description Score Start End GO Terms
AF-A0A841DTC1-F1-model_v4 Truncated hemoglobin YjbI 0.9716 6 69 GO:0019825
GO:0020037
AF-A0A494W212-F1-model_v4 Globin 0.9696 4 158 GO:0019825
GO:0020037
GO:0046872
AF-A0A529VRY8-F1-model_v4 Globin 0.9667 4 114 GO:0019825
GO:0020037
GO:0046872
AF-A0A1G7TAS5-F1-model_v4 Hemoglobin 0.9665 1 149 GO:0019825
GO:0020037
GO:0046872
AF-A0A327NZ79-F1-model_v4 Globin 0.966 1 152 GO:0019825
GO:0020037
GO:0046872

Feature Viewer

pLDDT pTM Quality
93.15 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map