F468683
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 607 | 241 | 605 | 284 |
Family's Representative Sequence
| Representative Sequence | 3300013102|Ga0157371_10000284|Ga0157371_1000028430 |
| Length | 337 |
| Sequence | MNPKSPFSNRRKTKNGFFWRFYRNNNFRITPKHVFPNLYLKKIVLNLIVNKKLQSTFQLLRFHFSFFLMPVYWFALSQVKNINWFNAILIFFILHLLVYPASNGYNSYMDRDTSSVGGIKNPKVPTKQLFYFTVVMDIIAVALSVIISYIFAIGIFFYILASRAYSYRKIRLKKYPVIGYLTVIIFQGAVTFFLVYHGSSGNHSFGIHVLPMVASALLIGGFYPLTQIYQHEEDRKDGVTSLSYLLGYKGTFIFTGIVYASAFIVLGWYFYLQIMFLDFIVLQIFMLPVIVYFFIWFKKVTKNNDEANFKNTMRMNILASACSNLGFITLLILKMFE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2911138879 | Spirosoma sp. KUDC1026 | Isolate | Rhizosphere |
| 2 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 5 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 6 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 7 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 8 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 9 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 10 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 11 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 12 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 13 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 14 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 15 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 16 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 23 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 27 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 57 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 58 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 59 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 60 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 61 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 62 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 63 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 64 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 65 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 66 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 67 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 68 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 69 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 70 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 72 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 73 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 74 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 75 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 76 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 77 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 104 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 105 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 106 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 107 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 108 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 162 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 165 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 166 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 167 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 168 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 169 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 170 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 171 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 172 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 173 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 174 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 175 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 176 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 177 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 178 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 179 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 180 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 181 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 182 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 183 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 184 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 185 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 186 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 187 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 188 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 189 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 203 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 204 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 205 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 206 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 207 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 208 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 209 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 210 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 211 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 212 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 213 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 214 | 3300049650 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought | Metagenome | Rhizosphere |
| 215 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 216 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 217 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 218 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 219 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 220 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 221 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 222 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 223 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 224 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 225 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 226 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 227 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 228 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 229 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 230 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 233 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 234 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 235 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 236 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 237 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 238 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 239 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 240 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 241 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.67 |
| Metatranscriptomes | 0 |
| Isolates | 0.33 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.95 |
| Nodule | 0 |
| Rhizoplane | 0.49 |
| Rhizosphere | 91.76 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.79 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | ARcpr5yngRDRAFT_c003927 | 3300000043 | Bacteria | 1431 |
| 2 | JGI24740J21852_10000409 | 3300001979 | Bacteria | 18403 |
| 3 | JGI25154J39366_1000031 | 3300002738 | Bacteria | 190814 |
| 4 | JGI25153J46596_10005563 | 3300003215 | Bacteria | 6586 |
| 5 | JGI25153J46596_10009336 | 3300003215 | Unclassified | 4578 |
| 6 | rootH1_10028021 | 3300003316 | Bacteria | 3452 |
| 7 | rootH1_10070184 | 3300003316 | Unclassified | 2366 |
| 8 | rootH2_10009982 | 3300003320 | Bacteria | 25986 |
| 9 | rootH2_10076618 | 3300003320 | Bacteria | 3411 |
| 10 | rootL2_10028177 | 3300003322 | Bacteria | 2048 |
| 11 | rootL2_10145242 | 3300003322 | Bacteria | 2359 |
| 12 | rootL2_10247536 | 3300003322 | Bacteria | 1132 |
| 13 | rootH1_10116572 | 3300003323 | Bacteria | 3812 |
| 14 | rootH1_10123253 | 3300003323 | Bacteria | 5109 |
| 15 | JGI25160J50197_1000941 | 3300003354 | Bacteria | 15269 |
| 16 | JGI25160J50197_1006108 | 3300003354 | Bacteria | 4913 |
| 17 | Ga0055526_1012091 | 3300003771 | Bacteria | 3808 |
| 18 | Ga0055528_1001378 | 3300003790 | Bacteria | 14923 |
| 19 | Ga0055530_10002564 | 3300003791 | Bacteria | 11538 |
| 20 | Ga0055543_1018775 | 3300004625 | Bacteria | 1286 |
| 21 | Ga0065165_1002242 | 3300005262 | Bacteria | 17168 |
| 22 | Ga0070658_10001648 | 3300005327 | Bacteria | 18875 |
| 23 | Ga0070658_10081792 | 3300005327 | Bacteria | 2653 |
| 24 | Ga0070658_10160350 | 3300005327 | Bacteria | 1887 |
| 25 | Ga0070676_10000489 | 3300005328 | Bacteria | 18890 |
| 26 | Ga0070676_10004865 | 3300005328 | Bacteria | 7113 |
| 27 | Ga0070676_10005268 | 3300005328 | Bacteria | 6876 |
| 28 | Ga0070676_10400885 | 3300005328 | Bacteria | 954 |
| 29 | Ga0070683_100040688 | 3300005329 | Bacteria | 4274 |
| 30 | Ga0070690_100047878 | 3300005330 | Bacteria | 2721 |
| 31 | Ga0070690_100278511 | 3300005330 | Bacteria | 1192 |
| 32 | Ga0070670_100053373 | 3300005331 | Unclassified | 3471 |
| 33 | Ga0070670_100058021 | 3300005331 | Bacteria | 3323 |
| 34 | Ga0070677_10042946 | 3300005333 | Unclassified | 1793 |
| 35 | Ga0068869_100011325 | 3300005334 | Bacteria | 5844 |
| 36 | Ga0068869_100071604 | 3300005334 | Unclassified | 2567 |
| 37 | Ga0068869_100108650 | 3300005334 | Unclassified | 2108 |
| 38 | Ga0068869_100372887 | 3300005334 | Bacteria | 1168 |
| 39 | Ga0070666_10000031 | 3300005335 | Bacteria | 132089 |
| 40 | Ga0070666_10092331 | 3300005335 | Bacteria | 2081 |
| 41 | Ga0070680_100005567 | 3300005336 | Bacteria | 9537 |
| 42 | Ga0070680_100008782 | 3300005336 | Bacteria | 7752 |
| 43 | Ga0070682_100002866 | 3300005337 | Bacteria | 9563 |
| 44 | Ga0070682_100181005 | 3300005337 | Bacteria | 1472 |
| 45 | Ga0070682_100278342 | 3300005337 | Bacteria | 1218 |
| 46 | Ga0068868_100000187 | 3300005338 | Bacteria | 41327 |
| 47 | Ga0068868_100000427 | 3300005338 | Bacteria | 28309 |
| 48 | Ga0068868_100003257 | 3300005338 | Bacteria | 11304 |
| 49 | Ga0068868_100082494 | 3300005338 | Bacteria | 2578 |
| 50 | Ga0068868_100128787 | 3300005338 | Bacteria | 2070 |
| 51 | Ga0068868_100148261 | 3300005338 | Bacteria | 1930 |
| 52 | Ga0070660_100001959 | 3300005339 | Bacteria | 14198 |
| 53 | Ga0070660_100013641 | 3300005339 | Bacteria | 5839 |
| 54 | Ga0070660_100037847 | 3300005339 | Bacteria | 3658 |
| 55 | Ga0070660_100048944 | 3300005339 | Bacteria | 3247 |
| 56 | Ga0070691_10006430 | 3300005341 | Bacteria | 5370 |
| 57 | Ga0070691_10088105 | 3300005341 | Bacteria | 1527 |
| 58 | Ga0070661_100002315 | 3300005344 | Bacteria | 13085 |
| 59 | Ga0070661_100047630 | 3300005344 | Bacteria | 3138 |
| 60 | Ga0070661_100209652 | 3300005344 | Bacteria | 1491 |
| 61 | Ga0070692_10087061 | 3300005345 | Bacteria | 1692 |
| 62 | Ga0070668_100003714 | 3300005347 | Bacteria | 11263 |
| 63 | Ga0070668_100027163 | 3300005347 | Bacteria | 4344 |
| 64 | Ga0070668_100313498 | 3300005347 | Bacteria | 1319 |
| 65 | Ga0070669_100449076 | 3300005353 | Bacteria | 1062 |
| 66 | Ga0070675_100035460 | 3300005354 | Unclassified | 4054 |
| 67 | Ga0070675_100064519 | 3300005354 | Bacteria | 3028 |
| 68 | Ga0070675_100110972 | 3300005354 | Bacteria | 2320 |
| 69 | Ga0070671_100121363 | 3300005355 | Bacteria | 2200 |
| 70 | Ga0070671_100221765 | 3300005355 | Bacteria | 1604 |
| 71 | Ga0070671_100238505 | 3300005355 | Bacteria | 1544 |
| 72 | Ga0070674_100007803 | 3300005356 | Bacteria | 6327 |
| 73 | Ga0070674_100339814 | 3300005356 | Bacteria | 1209 |
| 74 | Ga0070673_100000124 | 3300005364 | Bacteria | 35840 |
| 75 | Ga0070673_100022372 | 3300005364 | Unclassified | 4600 |
| 76 | Ga0070673_100070512 | 3300005364 | Bacteria | 2805 |
| 77 | Ga0070673_100207215 | 3300005364 | Bacteria | 1691 |
| 78 | Ga0070673_100346412 | 3300005364 | Bacteria | 1318 |
| 79 | Ga0070673_100355710 | 3300005364 | Bacteria | 1301 |
| 80 | Ga0070659_100003555 | 3300005366 | Bacteria | 11096 |
| 81 | Ga0070659_100028329 | 3300005366 | Bacteria | 4324 |
| 82 | Ga0070659_100087565 | 3300005366 | Bacteria | 2493 |
| 83 | Ga0070659_100328513 | 3300005366 | Bacteria | 1279 |
| 84 | Ga0070667_100000980 | 3300005367 | Bacteria | 26248 |
| 85 | Ga0070667_100007822 | 3300005367 | Bacteria | 8866 |
| 86 | Ga0070667_100011432 | 3300005367 | Bacteria | 7340 |
| 87 | Ga0070667_100174060 | 3300005367 | Unclassified | 1901 |
| 88 | Ga0070701_10095774 | 3300005438 | Bacteria | 1635 |
| 89 | Ga0070701_10302166 | 3300005438 | Bacteria | 984 |
| 90 | Ga0070663_100547125 | 3300005455 | Bacteria | 967 |
| 91 | Ga0070678_100007411 | 3300005456 | Bacteria | 6505 |
| 92 | Ga0070678_100057194 | 3300005456 | Bacteria | 2856 |
| 93 | Ga0070678_100308276 | 3300005456 | Bacteria | 1348 |
| 94 | Ga0070662_100002199 | 3300005457 | Bacteria | 11964 |
| 95 | Ga0070662_100009734 | 3300005457 | Bacteria | 6292 |
| 96 | Ga0070662_100010835 | 3300005457 | Bacteria | 6003 |
| 97 | Ga0070662_100011948 | 3300005457 | Bacteria | 5742 |
| 98 | Ga0070662_100130026 | 3300005457 | Bacteria | 1940 |
| 99 | Ga0070662_100210733 | 3300005457 | Bacteria | 1546 |
| 100 | Ga0070662_100473921 | 3300005457 | Unclassified | 1041 |
| 101 | Ga0070681_10023031 | 3300005458 | Bacteria | 6262 |
| 102 | Ga0070681_10077245 | 3300005458 | Bacteria | 3288 |
| 103 | Ga0070681_10147631 | 3300005458 | Unclassified | 2279 |
| 104 | Ga0070681_10208487 | 3300005458 | Bacteria | 1871 |
| 105 | Ga0068867_100002368 | 3300005459 | Bacteria | 13255 |
| 106 | Ga0068867_100003400 | 3300005459 | Bacteria | 11202 |
| 107 | Ga0068867_100028878 | 3300005459 | Bacteria | 3994 |
| 108 | Ga0068867_100066748 | 3300005459 | Unclassified | 2680 |
| 109 | Ga0068867_100080730 | 3300005459 | Bacteria | 2450 |
| 110 | Ga0070685_10049557 | 3300005466 | Bacteria | 2423 |
| 111 | Ga0070685_10076045 | 3300005466 | Bacteria | 2002 |
| 112 | Ga0070685_10302072 | 3300005466 | Bacteria | 1079 |
| 113 | Ga0070707_100351801 | 3300005468 | Bacteria | 1431 |
| 114 | Ga0070679_100003309 | 3300005530 | Bacteria | 14759 |
| 115 | Ga0070679_100026672 | 3300005530 | Bacteria | 5681 |
| 116 | Ga0070679_100321858 | 3300005530 | Bacteria | 1496 |
| 117 | Ga0070684_100001198 | 3300005535 | Bacteria | 18634 |
| 118 | Ga0070684_100004469 | 3300005535 | Bacteria | 10650 |
| 119 | Ga0070684_100049157 | 3300005535 | Bacteria | 3659 |
| 120 | Ga0070684_100281219 | 3300005535 | Bacteria | 1524 |
| 121 | Ga0070684_100507321 | 3300005535 | Unclassified | 1117 |
| 122 | Ga0068853_100002569 | 3300005539 | Bacteria | 13648 |
| 123 | Ga0068853_100002879 | 3300005539 | Bacteria | 13060 |
| 124 | Ga0068853_100010908 | 3300005539 | Bacteria | 7363 |
| 125 | Ga0068853_100231375 | 3300005539 | Unclassified | 1691 |
| 126 | Ga0068853_100259861 | 3300005539 | Bacteria | 1596 |
| 127 | Ga0068853_100635687 | 3300005539 | Bacteria | 1015 |
| 128 | Ga0070672_100000105 | 3300005543 | Bacteria | 41868 |
| 129 | Ga0070672_100096093 | 3300005543 | Bacteria | 2397 |
| 130 | Ga0070672_100114098 | 3300005543 | Bacteria | 2205 |
| 131 | Ga0070672_100291040 | 3300005543 | Bacteria | 1383 |
| 132 | Ga0070686_100001965 | 3300005544 | Bacteria | 11413 |
| 133 | Ga0070693_100004189 | 3300005547 | Bacteria | 6810 |
| 134 | Ga0070665_100000018 | 3300005548 | Bacteria | 434118 |
| 135 | Ga0070665_100000635 | 3300005548 | Bacteria | 47836 |
| 136 | Ga0070665_100076193 | 3300005548 | Unclassified | 3361 |
| 137 | Ga0070665_100130947 | 3300005548 | Bacteria | 2511 |
| 138 | Ga0068855_100007383 | 3300005563 | Bacteria | 13306 |
| 139 | Ga0068855_100019495 | 3300005563 | Bacteria | 8151 |
| 140 | Ga0068855_100031575 | 3300005563 | Bacteria | 6325 |
| 141 | Ga0068855_100045431 | 3300005563 | Bacteria | 5196 |
| 142 | Ga0068855_100079040 | 3300005563 | Bacteria | 3815 |
| 143 | Ga0068855_100097871 | 3300005563 | Unclassified | 3380 |
| 144 | Ga0068855_100144424 | 3300005563 | Bacteria | 2710 |
| 145 | Ga0068855_100349166 | 3300005563 | Bacteria | 1630 |
| 146 | Ga0070664_100006530 | 3300005564 | Bacteria | 9403 |
| 147 | Ga0070664_100020320 | 3300005564 | Bacteria | 5467 |
| 148 | Ga0070664_100083437 | 3300005564 | Bacteria | 2757 |
| 149 | Ga0070664_100270073 | 3300005564 | Bacteria | 1532 |
| 150 | Ga0070664_100366106 | 3300005564 | Bacteria | 1313 |
| 151 | Ga0070664_100380197 | 3300005564 | Bacteria | 1289 |
| 152 | Ga0068857_100000287 | 3300005577 | Bacteria | 34776 |
| 153 | Ga0068857_100007841 | 3300005577 | Bacteria | 9207 |
| 154 | Ga0068857_100011785 | 3300005577 | Bacteria | 7604 |
| 155 | Ga0068857_100186221 | 3300005577 | Bacteria | 1890 |
| 156 | Ga0068857_100213959 | 3300005577 | Bacteria | 1759 |
| 157 | Ga0068857_100219479 | 3300005577 | Bacteria | 1736 |
| 158 | Ga0068854_100010687 | 3300005578 | Bacteria | 5958 |
| 159 | Ga0068854_100026109 | 3300005578 | Bacteria | 4012 |
| 160 | Ga0068854_100309376 | 3300005578 | Bacteria | 1281 |
| 161 | Ga0068856_100044643 | 3300005614 | Bacteria | 4363 |
| 162 | Ga0068856_100050966 | 3300005614 | Bacteria | 4081 |
| 163 | Ga0068856_100075596 | 3300005614 | Bacteria | 3336 |
| 164 | Ga0068856_100126812 | 3300005614 | Bacteria | 2556 |
| 165 | Ga0068852_100008024 | 3300005616 | Bacteria | 7745 |
| 166 | Ga0068852_100031900 | 3300005616 | Bacteria | 4356 |
| 167 | Ga0068852_100044179 | 3300005616 | Bacteria | 3782 |
| 168 | Ga0068852_100060810 | 3300005616 | Bacteria | 3280 |
| 169 | Ga0068852_100098181 | 3300005616 | Unclassified | 2637 |
| 170 | Ga0068852_100156239 | 3300005616 | Unclassified | 2125 |
| 171 | Ga0068852_100157821 | 3300005616 | Unclassified | 2115 |
| 172 | Ga0068859_100000045 | 3300005617 | Bacteria | 143607 |
| 173 | Ga0068859_100026115 | 3300005617 | Bacteria | 5858 |
| 174 | Ga0068859_100049476 | 3300005617 | Bacteria | 4221 |
| 175 | Ga0068859_100220111 | 3300005617 | Bacteria | 1986 |
| 176 | Ga0068859_100475765 | 3300005617 | Bacteria | 1345 |
| 177 | Ga0068864_100001254 | 3300005618 | Bacteria | 21079 |
| 178 | Ga0068864_100001485 | 3300005618 | Bacteria | 19316 |
| 179 | Ga0068864_100161078 | 3300005618 | Unclassified | 2040 |
| 180 | Ga0068864_100480800 | 3300005618 | Bacteria | 1192 |
| 181 | Ga0068866_10070600 | 3300005718 | Bacteria | 1844 |
| 182 | Ga0068861_100201581 | 3300005719 | Unclassified | 1670 |
| 183 | Ga0068861_100422216 | 3300005719 | Bacteria | 1188 |
| 184 | Ga0068851_10000475 | 3300005834 | Bacteria | 17677 |
| 185 | Ga0068851_10008746 | 3300005834 | Bacteria | 4691 |
| 186 | Ga0068851_10063590 | 3300005834 | Bacteria | 1895 |
| 187 | Ga0068851_10073973 | 3300005834 | Bacteria | 1768 |
| 188 | Ga0068863_100002352 | 3300005841 | Bacteria | 18798 |
| 189 | Ga0068863_100005370 | 3300005841 | Bacteria | 12635 |
| 190 | Ga0068863_100083560 | 3300005841 | Bacteria | 3026 |
| 191 | Ga0068863_100561491 | 3300005841 | Bacteria | 1128 |
| 192 | Ga0068863_100595920 | 3300005841 | Bacteria | 1093 |
| 193 | Ga0068858_100003543 | 3300005842 | Bacteria | 15456 |
| 194 | Ga0068858_100476066 | 3300005842 | Bacteria | 1205 |
| 195 | Ga0068858_100538290 | 3300005842 | Bacteria | 1130 |
| 196 | Ga0068860_100001418 | 3300005843 | Bacteria | 25953 |
| 197 | Ga0068860_100008301 | 3300005843 | Bacteria | 10335 |
| 198 | Ga0068860_100018642 | 3300005843 | Bacteria | 6750 |
| 199 | Ga0068860_100039499 | 3300005843 | Unclassified | 4514 |
| 200 | Ga0068860_100076409 | 3300005843 | Unclassified | 3185 |
| 201 | Ga0068860_100220951 | 3300005843 | Bacteria | 1840 |
| 202 | Ga0068860_100576537 | 3300005843 | Bacteria | 1129 |
| 203 | Ga0068862_100052368 | 3300005844 | Bacteria | 3492 |
| 204 | Ga0068862_100241903 | 3300005844 | Bacteria | 1641 |
| 205 | Ga0075366_10077696 | 3300006195 | Bacteria | 1981 |
| 206 | Ga0075366_10086190 | 3300006195 | Bacteria | 1879 |
| 207 | Ga0097621_100000499 | 3300006237 | Bacteria | 27492 |
| 208 | Ga0097621_100007453 | 3300006237 | Bacteria | 7827 |
| 209 | Ga0097621_100035931 | 3300006237 | Unclassified | 3960 |
| 210 | Ga0097621_100193579 | 3300006237 | Bacteria | 1762 |
| 211 | Ga0068871_100002567 | 3300006358 | Bacteria | 12404 |
| 212 | Ga0068871_100008100 | 3300006358 | Bacteria | 7544 |
| 213 | Ga0068871_100131671 | 3300006358 | Bacteria | 2121 |
| 214 | Ga0068871_100228898 | 3300006358 | Bacteria | 1613 |
| 215 | Ga0068871_100535463 | 3300006358 | Unclassified | 1059 |
| 216 | Ga0075428_100023898 | 3300006844 | Bacteria | 6763 |
| 217 | Ga0075430_100018099 | 3300006846 | Bacteria | 5996 |
| 218 | Ga0075434_100009056 | 3300006871 | Bacteria | 9272 |
| 219 | Ga0075429_100014092 | 3300006880 | Bacteria | 6927 |
| 220 | Ga0068865_100001094 | 3300006881 | Bacteria | 15637 |
| 221 | Ga0068865_100006917 | 3300006881 | Bacteria | 6954 |
| 222 | Ga0068865_100016931 | 3300006881 | Bacteria | 4677 |
| 223 | Ga0068865_100208891 | 3300006881 | Unclassified | 1520 |
| 224 | Ga0097620_100000045 | 3300006931 | Bacteria | 143607 |
| 225 | Ga0097620_100026115 | 3300006931 | Bacteria | 5858 |
| 226 | Ga0097620_100049476 | 3300006931 | Bacteria | 4221 |
| 227 | Ga0097620_100220098 | 3300006931 | Bacteria | 1986 |
| 228 | Ga0097620_100475764 | 3300006931 | Bacteria | 1345 |
| 229 | Ga0105240_10000472 | 3300009093 | Bacteria | 74359 |
| 230 | Ga0105240_10009860 | 3300009093 | Bacteria | 13483 |
| 231 | Ga0105240_10019870 | 3300009093 | Bacteria | 8972 |
| 232 | Ga0105240_10022478 | 3300009093 | Bacteria | 8358 |
| 233 | Ga0105240_10097824 | 3300009093 | Unclassified | 3575 |
| 234 | Ga0105240_10154276 | 3300009093 | Unclassified | 2733 |
| 235 | Ga0111539_10073279 | 3300009094 | Bacteria | 4038 |
| 236 | Ga0105247_10003520 | 3300009101 | Bacteria | 10181 |
| 237 | Ga0105247_10033980 | 3300009101 | Bacteria | 3105 |
| 238 | Ga0105243_10109968 | 3300009148 | Bacteria | 2304 |
| 239 | Ga0105243_10589518 | 3300009148 | Bacteria | 1068 |
| 240 | Ga0105241_10000985 | 3300009174 | Bacteria | 21588 |
| 241 | Ga0105241_10001733 | 3300009174 | Bacteria | 16555 |
| 242 | Ga0105241_10006485 | 3300009174 | Bacteria | 8628 |
| 243 | Ga0105241_10006681 | 3300009174 | Bacteria | 8489 |
| 244 | Ga0105241_10068382 | 3300009174 | Bacteria | 2752 |
| 245 | Ga0105241_10219785 | 3300009174 | Unclassified | 1596 |
| 246 | Ga0105241_10251282 | 3300009174 | Bacteria | 1499 |
| 247 | Ga0105241_10295272 | 3300009174 | Bacteria | 1389 |
| 248 | Ga0105242_10010544 | 3300009176 | Bacteria | 7096 |
| 249 | Ga0105242_10020808 | 3300009176 | Bacteria | 5146 |
| 250 | Ga0105242_10564478 | 3300009176 | Unclassified | 1093 |
| 251 | Ga0105248_10022859 | 3300009177 | Bacteria | 6942 |
| 252 | Ga0105248_10151001 | 3300009177 | Bacteria | 2621 |
| 253 | Ga0105237_10001767 | 3300009545 | Bacteria | 27942 |
| 254 | Ga0105237_10054400 | 3300009545 | Bacteria | 4010 |
| 255 | Ga0105237_10060266 | 3300009545 | Unclassified | 3797 |
| 256 | Ga0105237_10317901 | 3300009545 | Bacteria | 1560 |
| 257 | Ga0105237_10360118 | 3300009545 | Bacteria | 1459 |
| 258 | Ga0105237_10415685 | 3300009545 | Bacteria | 1350 |
| 259 | Ga0105238_10002017 | 3300009551 | Bacteria | 20488 |
| 260 | Ga0105238_10041527 | 3300009551 | Bacteria | 4658 |
| 261 | Ga0105238_10159680 | 3300009551 | Bacteria | 2230 |
| 262 | Ga0105249_10011083 | 3300009553 | Bacteria | 7922 |
| 263 | Ga0105249_10085265 | 3300009553 | Unclassified | 2943 |
| 264 | Ga0105249_10339243 | 3300009553 | Bacteria | 1519 |
| 265 | Ga0105239_10001180 | 3300010375 | Bacteria | 35825 |
| 266 | Ga0157373_10009844 | 3300013100 | Bacteria | 7047 |
| 267 | Ga0157373_10031382 | 3300013100 | Bacteria | 3825 |
| 268 | Ga0157373_10067784 | 3300013100 | Bacteria | 2523 |
| 269 | Ga0157373_10164397 | 3300013100 | Bacteria | 1562 |
| 270 | Ga0157371_10000284 | 3300013102 | Bacteria | 68549 |
| 271 | Ga0157371_10000725 | 3300013102 | Bacteria | 38633 |
| 272 | Ga0157371_10016390 | 3300013102 | Bacteria | 5531 |
| 273 | Ga0157371_10032796 | 3300013102 | Unclassified | 3735 |
| 274 | Ga0157371_10158586 | 3300013102 | Bacteria | 1615 |
| 275 | Ga0157371_10208211 | 3300013102 | Bacteria | 1403 |
| 276 | Ga0157370_10004751 | 3300013104 | Bacteria | 15462 |
| 277 | Ga0157370_10009358 | 3300013104 | Bacteria | 10483 |
| 278 | Ga0157370_10021147 | 3300013104 | Bacteria | 6488 |
| 279 | Ga0157370_10157853 | 3300013104 | Bacteria | 2110 |
| 280 | Ga0157369_10073809 | 3300013105 | Bacteria | 3659 |
| 281 | Ga0157369_10082252 | 3300013105 | Bacteria | 3445 |
| 282 | Ga0157374_10000260 | 3300013296 | Bacteria | 48732 |
| 283 | Ga0157374_10002980 | 3300013296 | Bacteria | 14179 |
| 284 | Ga0157374_10027083 | 3300013296 | Bacteria | 5166 |
| 285 | Ga0157374_10051644 | 3300013296 | Bacteria | 3826 |
| 286 | Ga0157374_10079023 | 3300013296 | Bacteria | 3116 |
| 287 | Ga0157378_10003039 | 3300013297 | Bacteria | 14913 |
| 288 | Ga0157378_10010672 | 3300013297 | Bacteria | 8026 |
| 289 | Ga0157378_10012828 | 3300013297 | Bacteria | 7335 |
| 290 | Ga0157378_10013251 | 3300013297 | Bacteria | 7209 |
| 291 | Ga0157378_10071685 | 3300013297 | Bacteria | 3112 |
| 292 | Ga0157378_10328610 | 3300013297 | Bacteria | 1487 |
| 293 | Ga0163162_10000312 | 3300013306 | Bacteria | 45022 |
| 294 | Ga0163162_10001336 | 3300013306 | Bacteria | 23007 |
| 295 | Ga0163162_10001523 | 3300013306 | Bacteria | 21599 |
| 296 | Ga0163162_10004258 | 3300013306 | Bacteria | 13763 |
| 297 | Ga0163162_10022439 | 3300013306 | Bacteria | 6218 |
| 298 | Ga0163162_10074114 | 3300013306 | Bacteria | 3462 |
| 299 | Ga0163162_10074490 | 3300013306 | Bacteria | 3454 |
| 300 | Ga0157372_10000741 | 3300013307 | Bacteria | 35589 |
| 301 | Ga0157372_10018758 | 3300013307 | Bacteria | 7443 |
| 302 | Ga0157372_10023974 | 3300013307 | Bacteria | 6620 |
| 303 | Ga0157372_10094440 | 3300013307 | Bacteria | 3405 |
| 304 | Ga0157372_10113180 | 3300013307 | Bacteria | 3110 |
| 305 | Ga0157372_10167842 | 3300013307 | Bacteria | 2538 |
| 306 | Ga0157372_10186876 | 3300013307 | Bacteria | 2399 |
| 307 | Ga0157372_10195909 | 3300013307 | Bacteria | 2340 |
| 308 | Ga0157372_10201832 | 3300013307 | Bacteria | 2303 |
| 309 | Ga0157372_10211924 | 3300013307 | Unclassified | 2245 |
| 310 | Ga0157372_10223170 | 3300013307 | Bacteria | 2184 |
| 311 | Ga0157372_10234475 | 3300013307 | Bacteria | 2128 |
| 312 | Ga0157372_10245818 | 3300013307 | Unclassified | 2076 |
| 313 | Ga0157372_10299321 | 3300013307 | Bacteria | 1871 |
| 314 | Ga0157372_10410828 | 3300013307 | Unclassified | 1577 |
| 315 | Ga0157372_10563121 | 3300013307 | Bacteria | 1328 |
| 316 | Ga0157375_10000686 | 3300013308 | Bacteria | 29989 |
| 317 | Ga0157375_10002871 | 3300013308 | Bacteria | 14932 |
| 318 | Ga0157375_10010009 | 3300013308 | Bacteria | 8337 |
| 319 | Ga0157375_10478217 | 3300013308 | Bacteria | 1411 |
| 320 | Ga0163163_10000346 | 3300014325 | Bacteria | 44619 |
| 321 | Ga0163163_10135642 | 3300014325 | Bacteria | 2502 |
| 322 | Ga0163163_10495187 | 3300014325 | Bacteria | 1284 |
| 323 | Ga0157377_10017063 | 3300014745 | Unclassified | 3750 |
| 324 | Ga0157379_10000242 | 3300014968 | Bacteria | 42795 |
| 325 | Ga0157379_10011127 | 3300014968 | Bacteria | 7844 |
| 326 | Ga0157379_10032372 | 3300014968 | Bacteria | 4662 |
| 327 | Ga0157379_10052461 | 3300014968 | Bacteria | 3643 |
| 328 | Ga0157379_10179209 | 3300014968 | Bacteria | 1914 |
| 329 | Ga0157376_10001139 | 3300014969 | Bacteria | 17447 |
| 330 | Ga0157376_10085547 | 3300014969 | Unclassified | 2717 |
| 331 | Ga0157376_10192255 | 3300014969 | Bacteria | 1872 |
| 332 | Ga0157376_10394225 | 3300014969 | Bacteria | 1337 |
| 333 | Ga0163161_10034025 | 3300017792 | Bacteria | 3644 |
| 334 | Ga0163161_10128416 | 3300017792 | Bacteria | 1910 |
| 335 | Ga0213876_10037551 | 3300021384 | Unclassified | 2555 |
| 336 | Ga0209646_1000009 | 3300025246 | Bacteria | 652154 |
| 337 | Ga0209026_1000396 | 3300025250 | Bacteria | 38774 |
| 338 | Ga0209673_1000016 | 3300025273 | Bacteria | 506202 |
| 339 | Ga0209564_1004934 | 3300025295 | Bacteria | 7886 |
| 340 | Ga0209050_1000124 | 3300025298 | Bacteria | 194022 |
| 341 | Ga0207426_1000211 | 3300025302 | Bacteria | 137322 |
| 342 | Ga0207426_1000339 | 3300025302 | Bacteria | 87978 |
| 343 | Ga0209257_1000658 | 3300025304 | Bacteria | 54552 |
| 344 | Ga0207697_10009658 | 3300025315 | Unclassified | 4156 |
| 345 | Ga0207656_10023113 | 3300025321 | Bacteria | 2500 |
| 346 | Ga0207656_10050990 | 3300025321 | Bacteria | 1789 |
| 347 | Ga0207642_10054151 | 3300025899 | Bacteria | 1829 |
| 348 | Ga0207688_10030435 | 3300025901 | Unclassified | 2976 |
| 349 | Ga0207680_10000141 | 3300025903 | Bacteria | 34433 |
| 350 | Ga0207680_10076151 | 3300025903 | Bacteria | 2095 |
| 351 | Ga0207647_10002819 | 3300025904 | Bacteria | 13115 |
| 352 | Ga0207647_10027231 | 3300025904 | Bacteria | 3729 |
| 353 | Ga0207645_10001794 | 3300025907 | Bacteria | 17325 |
| 354 | Ga0207645_10040449 | 3300025907 | Bacteria | 2985 |
| 355 | Ga0207645_10054686 | 3300025907 | Bacteria | 2549 |
| 356 | Ga0207705_10007257 | 3300025909 | Bacteria | 8155 |
| 357 | Ga0207705_10043803 | 3300025909 | Bacteria | 3215 |
| 358 | Ga0207654_10057810 | 3300025911 | Bacteria | 2255 |
| 359 | Ga0207654_10271483 | 3300025911 | Unclassified | 1144 |
| 360 | Ga0207654_10306619 | 3300025911 | Bacteria | 1081 |
| 361 | Ga0207695_10001688 | 3300025913 | Bacteria | 35472 |
| 362 | Ga0207695_10004070 | 3300025913 | Bacteria | 20110 |
| 363 | Ga0207695_10028517 | 3300025913 | Bacteria | 6188 |
| 364 | Ga0207695_10059033 | 3300025913 | Bacteria | 3980 |
| 365 | Ga0207695_10064026 | 3300025913 | Unclassified | 3788 |
| 366 | Ga0207695_10106388 | 3300025913 | Unclassified | 2791 |
| 367 | Ga0207671_10011688 | 3300025914 | Bacteria | 7117 |
| 368 | Ga0207671_10011870 | 3300025914 | Bacteria | 7049 |
| 369 | Ga0207671_10142434 | 3300025914 | Bacteria | 1848 |
| 370 | Ga0207671_10209971 | 3300025914 | Bacteria | 1522 |
| 371 | Ga0207671_10236354 | 3300025914 | Bacteria | 1434 |
| 372 | Ga0207660_10005510 | 3300025917 | Bacteria | 8222 |
| 373 | Ga0207660_10041338 | 3300025917 | Unclassified | 3230 |
| 374 | Ga0207657_10009181 | 3300025919 | Bacteria | 9972 |
| 375 | Ga0207657_10023896 | 3300025919 | Bacteria | 5676 |
| 376 | Ga0207657_10134061 | 3300025919 | Bacteria | 2028 |
| 377 | Ga0207657_10192301 | 3300025919 | Bacteria | 1645 |
| 378 | Ga0207657_10340403 | 3300025919 | Bacteria | 1184 |
| 379 | Ga0207649_10021026 | 3300025920 | Bacteria | 3749 |
| 380 | Ga0207649_10026846 | 3300025920 | Bacteria | 3372 |
| 381 | Ga0207652_10000045 | 3300025921 | Bacteria | 125343 |
| 382 | Ga0207652_10000214 | 3300025921 | Bacteria | 61294 |
| 383 | Ga0207652_10008710 | 3300025921 | Bacteria | 8165 |
| 384 | Ga0207652_10016246 | 3300025921 | Bacteria | 6073 |
| 385 | Ga0207652_10035250 | 3300025921 | Bacteria | 4222 |
| 386 | Ga0207652_10236324 | 3300025921 | Bacteria | 1647 |
| 387 | Ga0207681_10011577 | 3300025923 | Bacteria | 5419 |
| 388 | Ga0207681_10017517 | 3300025923 | Unclassified | 4499 |
| 389 | Ga0207681_10280009 | 3300025923 | Bacteria | 1313 |
| 390 | Ga0207681_10325805 | 3300025923 | Bacteria | 1223 |
| 391 | Ga0207650_10002954 | 3300025925 | Bacteria | 11729 |
| 392 | Ga0207650_10288149 | 3300025925 | Bacteria | 1338 |
| 393 | Ga0207659_10035806 | 3300025926 | Bacteria | 3434 |
| 394 | Ga0207659_10096132 | 3300025926 | Bacteria | 2223 |
| 395 | Ga0207687_10137272 | 3300025927 | Bacteria | 1851 |
| 396 | Ga0207644_10008911 | 3300025931 | Bacteria | 6573 |
| 397 | Ga0207644_10036096 | 3300025931 | Unclassified | 3468 |
| 398 | Ga0207644_10041431 | 3300025931 | Bacteria | 3258 |
| 399 | Ga0207644_10044110 | 3300025931 | Bacteria | 3167 |
| 400 | Ga0207644_10198329 | 3300025931 | Bacteria | 1582 |
| 401 | Ga0207690_10011163 | 3300025932 | Bacteria | 5361 |
| 402 | Ga0207706_10003994 | 3300025933 | Bacteria | 13976 |
| 403 | Ga0207706_10007275 | 3300025933 | Bacteria | 10234 |
| 404 | Ga0207706_10059068 | 3300025933 | Bacteria | 3378 |
| 405 | Ga0207706_10061177 | 3300025933 | Bacteria | 3316 |
| 406 | Ga0207686_10050058 | 3300025934 | Unclassified | 2597 |
| 407 | Ga0207686_10245279 | 3300025934 | Bacteria | 1306 |
| 408 | Ga0207670_10070587 | 3300025936 | Bacteria | 2413 |
| 409 | Ga0207669_10096141 | 3300025937 | Bacteria | 1943 |
| 410 | Ga0207704_10000562 | 3300025938 | Bacteria | 16547 |
| 411 | Ga0207704_10187715 | 3300025938 | Bacteria | 1500 |
| 412 | Ga0207691_10000012 | 3300025940 | Bacteria | 147942 |
| 413 | Ga0207691_10004759 | 3300025940 | Bacteria | 13125 |
| 414 | Ga0207691_10088274 | 3300025940 | Unclassified | 2781 |
| 415 | Ga0207691_10108794 | 3300025940 | Bacteria | 2467 |
| 416 | Ga0207691_10216348 | 3300025940 | Unclassified | 1662 |
| 417 | Ga0207691_10224567 | 3300025940 | Bacteria | 1628 |
| 418 | Ga0207711_10324337 | 3300025941 | Unclassified | 1424 |
| 419 | Ga0207689_10008936 | 3300025942 | Bacteria | 8687 |
| 420 | Ga0207689_10009466 | 3300025942 | Bacteria | 8410 |
| 421 | Ga0207689_10018137 | 3300025942 | Bacteria | 5944 |
| 422 | Ga0207689_10030002 | 3300025942 | Bacteria | 4534 |
| 423 | Ga0207689_10070533 | 3300025942 | Bacteria | 2871 |
| 424 | Ga0207689_10138065 | 3300025942 | Unclassified | 2007 |
| 425 | Ga0207689_10213690 | 3300025942 | Bacteria | 1594 |
| 426 | Ga0207661_10003108 | 3300025944 | Bacteria | 11489 |
| 427 | Ga0207661_10152076 | 3300025944 | Unclassified | 2001 |
| 428 | Ga0207679_10004210 | 3300025945 | Bacteria | 8939 |
| 429 | Ga0207679_10017260 | 3300025945 | Unclassified | 4811 |
| 430 | Ga0207667_10000643 | 3300025949 | Bacteria | 45271 |
| 431 | Ga0207667_10034450 | 3300025949 | Bacteria | 5437 |
| 432 | Ga0207667_10045123 | 3300025949 | Bacteria | 4669 |
| 433 | Ga0207667_10083216 | 3300025949 | Bacteria | 3313 |
| 434 | Ga0207667_10097434 | 3300025949 | Unclassified | 3035 |
| 435 | Ga0207667_10132420 | 3300025949 | Bacteria | 2568 |
| 436 | Ga0207667_10175197 | 3300025949 | Bacteria | 2204 |
| 437 | Ga0207651_10000216 | 3300025960 | Bacteria | 24808 |
| 438 | Ga0207651_10240143 | 3300025960 | Bacteria | 1476 |
| 439 | Ga0207651_10354520 | 3300025960 | Bacteria | 1236 |
| 440 | Ga0207712_10010440 | 3300025961 | Bacteria | 5896 |
| 441 | Ga0207668_10001361 | 3300025972 | Bacteria | 14445 |
| 442 | Ga0207668_10054223 | 3300025972 | Bacteria | 2782 |
| 443 | Ga0207640_10015769 | 3300025981 | Bacteria | 4380 |
| 444 | Ga0207640_10048773 | 3300025981 | Bacteria | 2739 |
| 445 | Ga0207640_10109399 | 3300025981 | Bacteria | 1955 |
| 446 | Ga0207658_10000374 | 3300025986 | Bacteria | 43784 |
| 447 | Ga0207658_10008025 | 3300025986 | Bacteria | 7193 |
| 448 | Ga0207658_10033838 | 3300025986 | Unclassified | 3648 |
| 449 | Ga0207658_10050631 | 3300025986 | Bacteria | 3057 |
| 450 | Ga0207658_10057016 | 3300025986 | Bacteria | 2901 |
| 451 | Ga0207677_10000984 | 3300026023 | Bacteria | 15691 |
| 452 | Ga0207677_10004993 | 3300026023 | Bacteria | 7161 |
| 453 | Ga0207677_10018387 | 3300026023 | Unclassified | 4193 |
| 454 | Ga0207677_10092119 | 3300026023 | Unclassified | 2206 |
| 455 | Ga0207677_10280466 | 3300026023 | Bacteria | 1367 |
| 456 | Ga0207703_10035352 | 3300026035 | Bacteria | 3970 |
| 457 | Ga0207703_10278392 | 3300026035 | Bacteria | 1518 |
| 458 | Ga0207703_10579352 | 3300026035 | Bacteria | 1060 |
| 459 | Ga0207639_10002390 | 3300026041 | Bacteria | 12590 |
| 460 | Ga0207639_10019277 | 3300026041 | Bacteria | 4863 |
| 461 | Ga0207639_10081393 | 3300026041 | Bacteria | 2564 |
| 462 | Ga0207639_10158079 | 3300026041 | Bacteria | 1907 |
| 463 | Ga0207639_10396638 | 3300026041 | Bacteria | 1242 |
| 464 | Ga0207639_10545805 | 3300026041 | Bacteria | 1064 |
| 465 | Ga0207678_10013503 | 3300026067 | Bacteria | 7170 |
| 466 | Ga0207678_10237683 | 3300026067 | Bacteria | 1560 |
| 467 | Ga0207708_10341101 | 3300026075 | Bacteria | 1227 |
| 468 | Ga0207702_10025199 | 3300026078 | Bacteria | 4936 |
| 469 | Ga0207702_10026475 | 3300026078 | Bacteria | 4814 |
| 470 | Ga0207702_10147988 | 3300026078 | Bacteria | 2133 |
| 471 | Ga0207641_10000133 | 3300026088 | Bacteria | 109199 |
| 472 | Ga0207641_10022535 | 3300026088 | Bacteria | 5183 |
| 473 | Ga0207641_10460278 | 3300026088 | Bacteria | 1231 |
| 474 | Ga0207641_10563222 | 3300026088 | Bacteria | 1112 |
| 475 | Ga0207648_10010253 | 3300026089 | Bacteria | 8899 |
| 476 | Ga0207648_10012892 | 3300026089 | Bacteria | 7806 |
| 477 | Ga0207648_10013112 | 3300026089 | Bacteria | 7729 |
| 478 | Ga0207648_10027821 | 3300026089 | Bacteria | 5016 |
| 479 | Ga0207648_10041074 | 3300026089 | Bacteria | 4063 |
| 480 | Ga0207648_10067242 | 3300026089 | Bacteria | 3125 |
| 481 | Ga0207648_10073681 | 3300026089 | Bacteria | 2976 |
| 482 | Ga0207648_10136340 | 3300026089 | Bacteria | 2162 |
| 483 | Ga0207648_10169059 | 3300026089 | Unclassified | 1932 |
| 484 | Ga0207676_10000697 | 3300026095 | Bacteria | 26479 |
| 485 | Ga0207676_10155745 | 3300026095 | Bacteria | 1974 |
| 486 | Ga0207674_10001630 | 3300026116 | Bacteria | 28871 |
| 487 | Ga0207674_10004031 | 3300026116 | Bacteria | 17828 |
| 488 | Ga0207674_10010211 | 3300026116 | Bacteria | 10664 |
| 489 | Ga0207674_10015744 | 3300026116 | Bacteria | 8296 |
| 490 | Ga0207674_10216902 | 3300026116 | Bacteria | 1862 |
| 491 | Ga0207675_100005430 | 3300026118 | Bacteria | 12213 |
| 492 | Ga0207675_100022342 | 3300026118 | Bacteria | 5891 |
| 493 | Ga0207675_100174885 | 3300026118 | Unclassified | 2054 |
| 494 | Ga0207683_10002013 | 3300026121 | Bacteria | 17984 |
| 495 | Ga0207683_10025467 | 3300026121 | Bacteria | 5105 |
| 496 | Ga0207683_10176207 | 3300026121 | Bacteria | 1938 |
| 497 | Ga0207698_10009340 | 3300026142 | Bacteria | 6249 |
| 498 | Ga0207698_10014863 | 3300026142 | Bacteria | 5190 |
| 499 | Ga0207698_10097006 | 3300026142 | Bacteria | 2431 |
| 500 | Ga0207698_10131542 | 3300026142 | Unclassified | 2139 |
| 501 | Ga0207428_10062495 | 3300027907 | Bacteria | 2944 |
| 502 | Ga0268266_10000026 | 3300028379 | Bacteria | 434485 |
| 503 | Ga0268266_10005379 | 3300028379 | Bacteria | 11960 |
| 504 | Ga0268266_10035267 | 3300028379 | Unclassified | 4255 |
| 505 | Ga0268264_10000019 | 3300028381 | Bacteria | 488112 |
| 506 | Ga0268264_10000054 | 3300028381 | Bacteria | 317048 |
| 507 | Ga0268264_10003975 | 3300028381 | Bacteria | 12651 |
| 508 | Ga0268264_10005188 | 3300028381 | Bacteria | 11030 |
| 509 | Ga0268264_10008390 | 3300028381 | Bacteria | 8589 |
| 510 | Ga0268264_10008474 | 3300028381 | Bacteria | 8550 |
| 511 | Ga0268264_10008570 | 3300028381 | Bacteria | 8500 |
| 512 | Ga0268264_10008865 | 3300028381 | Bacteria | 8337 |
| 513 | Ga0268264_10107627 | 3300028381 | Bacteria | 2436 |
| 514 | Ga0268264_10350200 | 3300028381 | Bacteria | 1406 |
| 515 | Ga0268264_10795965 | 3300028381 | Bacteria | 944 |
| 516 | Ga0307511_10000228 | 3300030521 | Bacteria | 57237 |
| 517 | Ga0265327_10031686 | 3300031251 | Bacteria | 2967 |
| 518 | Ga0307513_10112285 | 3300031456 | Bacteria | 2716 |
| 519 | Ga0307513_10206813 | 3300031456 | Bacteria | 1798 |
| 520 | Ga0307509_10015498 | 3300031507 | Bacteria | 8889 |
| 521 | Ga0307516_10002314 | 3300031730 | Bacteria | 25651 |
| 522 | Ga0307405_10005405 | 3300031731 | Bacteria | 6160 |
| 523 | Ga0307413_10008468 | 3300031824 | Bacteria | 4858 |
| 524 | Ga0307518_10139407 | 3300031838 | Bacteria | 1694 |
| 525 | Ga0307410_10133568 | 3300031852 | Bacteria | 1826 |
| 526 | Ga0307407_10103515 | 3300031903 | Bacteria | 1772 |
| 527 | Ga0307412_10061446 | 3300031911 | Bacteria | 2526 |
| 528 | Ga0307409_100062332 | 3300031995 | Bacteria | 2919 |
| 529 | Ga0307416_100060439 | 3300032002 | Bacteria | 3086 |
| 530 | Ga0307415_100035696 | 3300032126 | Bacteria | 3249 |
| 531 | Ga0307510_10017333 | 3300033180 | Bacteria | 8497 |
| 532 | Ga0373943_0182227 | 3300035170 | Bacteria | 1155 |
| 533 | Ga0373937_0006671 | 3300036401 | Bacteria | 9965 |
| 534 | Ga0395899_0017226 | 3300037312 | Bacteria | 5505 |
| 535 | Ga0395899_0174223 | 3300037312 | Unclassified | 1513 |
| 536 | Ga0395900_0059235 | 3300037418 | Bacteria | 3942 |
| 537 | Ga0395900_0124935 | 3300037418 | Unclassified | 2638 |
| 538 | Ga0395898_0013466 | 3300037466 | Bacteria | 8421 |
| 539 | Ga0395905_0070300 | 3300037471 | Unclassified | 3280 |
| 540 | Ga0395901_0028050 | 3300038443 | Bacteria | 5790 |
| 541 | Ga0436365_0333717 | 3300039437 | Bacteria | 2970 |
| 542 | Ga0436365_0927657 | 3300039437 | Bacteria | 1885 |
| 543 | Ga0466972_0000016 | 3300044658 | Bacteria | 208802 |
| 544 | Ga0466972_0009311 | 3300044658 | Bacteria | 4937 |
| 545 | Ga0466972_0019573 | 3300044658 | Bacteria | 3384 |
| 546 | Ga0466970_0003015 | 3300044765 | Bacteria | 8162 |
| 547 | Ga0495638_0033016 | 3300046460 | Bacteria | 3311 |
| 548 | Ga0495606_0003341 | 3300046507 | Bacteria | 17112 |
| 549 | Ga0495608_0067439 | 3300046511 | Bacteria | 2340 |
| 550 | Ga0495628_0022064 | 3300046516 | Bacteria | 5233 |
| 551 | Ga0495630_0011846 | 3300046517 | Bacteria | 6319 |
| 552 | Ga0495648_0002002 | 3300046524 | Bacteria | 19295 |
| 553 | Ga0495640_0251125 | 3300046533 | Bacteria | 1108 |
| 554 | Ga0495586_0009224 | 3300046535 | Bacteria | 5247 |
| 555 | Ga0495600_0133662 | 3300046809 | Bacteria | 1612 |
| 556 | Ga0495604_0290160 | 3300047317 | Bacteria | 1102 |
| 557 | Ga0495672_0038837 | 3300047320 | Unclassified | 2900 |
| 558 | Ga0495680_0037499 | 3300047322 | Bacteria | 3882 |
| 559 | Ga0495687_000031 | 3300047443 | Bacteria | 274659 |
| 560 | Ga0496101_0080185 | 3300048904 | Bacteria | 2411 |
| 561 | Ga0496110_0019814 | 3300048913 | Bacteria | 5669 |
| 562 | Ga0496114_0040216 | 3300048917 | Bacteria | 3870 |
| 563 | Ga0501290_003419 | 3300049513 | Bacteria | 2003 |
| 564 | Ga0501298_007964 | 3300049521 | Bacteria | 1770 |
| 565 | Ga0501034_0000017 | 3300049571 | Bacteria | 285938 |
| 566 | Ga0501034_0037661 | 3300049571 | Bacteria | 4898 |
| 567 | Ga0501037_0080762 | 3300049573 | Bacteria | 2358 |
| 568 | Ga0501037_0172262 | 3300049573 | Unclassified | 1538 |
| 569 | Ga0501038_0059187 | 3300049574 | Bacteria | 3282 |
| 570 | Ga0501039_0029118 | 3300049575 | Bacteria | 4253 |
| 571 | Ga0501043_0003072 | 3300049579 | Bacteria | 13875 |
| 572 | Ga0501047_0010118 | 3300049581 | Bacteria | 8917 |
| 573 | Ga0501047_0188923 | 3300049581 | Bacteria | 1924 |
| 574 | Ga0501070_0135800 | 3300049586 | Unclassified | 2031 |
| 575 | Ga0501199_001778 | 3300049650 | Bacteria | 1977 |
| 576 | Ga0501201_003219 | 3300049651 | Bacteria | 1496 |
| 577 | Ga0501202_000819 | 3300049652 | Bacteria | 4691 |
| 578 | Ga0501202_004538 | 3300049652 | Bacteria | 2433 |
| 579 | Ga0501207_001587 | 3300049654 | Bacteria | 2855 |
| 580 | Ga0501217_003847 | 3300049661 | Bacteria | 3054 |
| 581 | Ga0501217_056499 | 3300049661 | Bacteria | 1038 |
| 582 | Ga0501222_001204 | 3300049662 | Bacteria | 3652 |
| 583 | Ga0501223_001850 | 3300049663 | Bacteria | 4780 |
| 584 | Ga0501240_002479 | 3300049673 | Bacteria | 1965 |
| 585 | Ga0501243_003490 | 3300049675 | Bacteria | 2329 |
| 586 | Ga0501252_001200 | 3300049682 | Bacteria | 2325 |
| 587 | Ga0501257_002646 | 3300049686 | Bacteria | 3780 |
| 588 | Ga0501257_030754 | 3300049686 | Bacteria | 1293 |
| 589 | Ga0501261_000533 | 3300049690 | Bacteria | 4847 |
| 590 | Ga0501219_000159 | 3300049703 | Bacteria | 12350 |
| 591 | Ga0501225_0005770 | 3300049705 | Bacteria | 3624 |
| 592 | Ga0501234_003320 | 3300049707 | Bacteria | 2528 |
| 593 | Ga0501266_006733 | 3300049763 | Bacteria | 1431 |
| 594 | Ga0501035_0016138 | 3300049822 | Bacteria | 6892 |
| 595 | Ga0501044_0048864 | 3300049823 | Unclassified | 4368 |
| 596 | Ga0501284_00018 | 3300050005 | Bacteria | 93729 |
| 597 | nmdc:mga06r32_200583_c1 | 3300050510 | Bacteria | 1983 |
| 598 | nmdc:mga08y16_201809_c1 | 3300050511 | Unclassified | 2061 |
| 599 | Ga0500583_0024874 | 3300053092 | Bacteria | 2547 |
| 600 | Ga0500652_005381 | 3300053131 | Bacteria | 4026 |
| 601 | Ga0500568_0024438 | 3300053139 | Bacteria | 2559 |
| 602 | Ga0500616_0006698 | 3300053153 | Bacteria | 7477 |
| 603 | Ga0500616_0026690 | 3300053153 | Unclassified | 3195 |
| 604 | Ga0500622_0000926 | 3300053156 | Bacteria | 24930 |
| 605 | Ga0500636_0053601 | 3300053177 | Bacteria | 2367 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013307 | Ga0157372_10299321 | Ga0157372_102993212 | 252 |
| 2 | 3300005458 | Ga0070681_10208487 | Ga0070681_102084872 | 253 |
| 3 | 3300026041 | Ga0207639_10081393 | Ga0207639_100813932 | 258 |
| 4 | 3300026116 | Ga0207674_10015744 | Ga0207674_100157444 | 258 |
| 5 | 3300005366 | Ga0070659_100087565 | Ga0070659_1000875652 | 259 |
| 6 | 3300025932 | Ga0207690_10011163 | Ga0207690_100111632 | 259 |
| 7 | 3300046533 | Ga0495640_0251125 | Ga0495640_0251125_194_973 | 259 |
| 8 | 3300005330 | Ga0070690_100278511 | Ga0070690_1002785111 | 260 |
| 9 | 3300005334 | Ga0068869_100372887 | Ga0068869_1003728871 | 260 |
| 10 | 3300005335 | Ga0070666_10092331 | Ga0070666_100923312 | 260 |
| 11 | 3300005337 | Ga0070682_100002866 | Ga0070682_10000286614 | 260 |
| 12 | 3300005338 | Ga0068868_100082494 | Ga0068868_1000824941 | 260 |
| 13 | 3300005339 | Ga0070660_100037847 | Ga0070660_1000378473 | 260 |
| 14 | 3300005344 | Ga0070661_100047630 | Ga0070661_1000476301 | 260 |
| 15 | 3300005355 | Ga0070671_100221765 | Ga0070671_1002217652 | 260 |
| 16 | 3300005364 | Ga0070673_100207215 | Ga0070673_1002072152 | 260 |
| 17 | 3300005366 | Ga0070659_100028329 | Ga0070659_1000283295 | 260 |
| 18 | 3300005457 | Ga0070662_100002199 | Ga0070662_1000021993 | 260 |
| 19 | 3300005530 | Ga0070679_100321858 | Ga0070679_1003218581 | 260 |
| 20 | 3300005535 | Ga0070684_100281219 | Ga0070684_1002812191 | 260 |
| 21 | 3300005563 | Ga0068855_100079040 | Ga0068855_1000790402 | 260 |
| 22 | 3300005614 | Ga0068856_100050966 | Ga0068856_1000509662 | 260 |
| 23 | 3300005616 | Ga0068852_100060810 | Ga0068852_1000608102 | 260 |
| 24 | 3300013100 | Ga0157373_10031382 | Ga0157373_100313824 | 260 |
| 25 | 3300013102 | Ga0157371_10158586 | Ga0157371_101585862 | 260 |
| 26 | 3300013296 | Ga0157374_10051644 | Ga0157374_100516442 | 260 |
| 27 | 3300013297 | Ga0157378_10010672 | Ga0157378_100106727 | 260 |
| 28 | 3300013307 | Ga0157372_10223170 | Ga0157372_102231702 | 260 |
| 29 | 3300025919 | Ga0207657_10009181 | Ga0207657_100091816 | 260 |
| 30 | 3300025920 | Ga0207649_10021026 | Ga0207649_100210261 | 260 |
| 31 | 3300025933 | Ga0207706_10007275 | Ga0207706_100072756 | 260 |
| 32 | 3300025949 | Ga0207667_10175197 | Ga0207667_101751972 | 260 |
| 33 | 3300026078 | Ga0207702_10147988 | Ga0207702_101479882 | 260 |
| 34 | 3300026095 | Ga0207676_10155745 | Ga0207676_101557451 | 260 |
| 35 | 3300049682 | Ga0501252_001200 | Ga0501252_001200_36_821 | 261 |
| 36 | 3300001979 | JGI24740J21852_10000409 | JGI24740J21852_1000040920 | 263 |
| 37 | 3300002738 | JGI25154J39366_1000031 | JGI25154J39366_100003114 | 263 |
| 38 | 3300003215 | JGI25153J46596_10005563 | JGI25153J46596_100055633 | 263 |
| 39 | 3300003323 | rootH1_10123253 | rootH1_101232535 | 263 |
| 40 | 3300003354 | JGI25160J50197_1006108 | JGI25160J50197_10061083 | 263 |
| 41 | 3300013102 | Ga0157371_10016390 | Ga0157371_100163905 | 263 |
| 42 | 3300025246 | Ga0209646_1000009 | Ga0209646_1000009286 | 263 |
| 43 | 3300025250 | Ga0209026_1000396 | Ga0209026_100039634 | 263 |
| 44 | 3300025302 | Ga0207426_1000339 | Ga0207426_100033924 | 263 |
| 45 | 3300053131 | Ga0500652_005381 | Ga0500652_005381_2007_2870 | 263 |
| 46 | 3300053139 | Ga0500568_0024438 | Ga0500568_0024438_1351_2214 | 263 |
| 47 | 3300025913 | Ga0207695_10059033 | Ga0207695_100590334 | 268 |
| 48 | 3300025949 | Ga0207667_10045123 | Ga0207667_100451233 | 268 |
| 49 | 3300026023 | Ga0207677_10280466 | Ga0207677_102804662 | 268 |
| 50 | 3300026089 | Ga0207648_10136340 | Ga0207648_101363402 | 268 |
| 51 | 3300005353 | Ga0070669_100449076 | Ga0070669_1004490761 | 269 |
| 52 | 3300005367 | Ga0070667_100007822 | Ga0070667_1000078225 | 269 |
| 53 | 3300005842 | Ga0068858_100538290 | Ga0068858_1005382902 | 269 |
| 54 | 3300005844 | Ga0068862_100052368 | Ga0068862_1000523681 | 269 |
| 55 | 3300006237 | Ga0097621_100000499 | Ga0097621_10000049916 | 269 |
| 56 | 3300006358 | Ga0068871_100002567 | Ga0068871_1000025679 | 269 |
| 57 | 3300006881 | Ga0068865_100208891 | Ga0068865_1002088911 | 269 |
| 58 | 3300009177 | Ga0105248_10022859 | Ga0105248_100228598 | 269 |
| 59 | 3300009551 | Ga0105238_10041527 | Ga0105238_100415272 | 269 |
| 60 | 3300013105 | Ga0157369_10082252 | Ga0157369_100822523 | 269 |
| 61 | 3300013297 | Ga0157378_10012828 | Ga0157378_100128283 | 269 |
| 62 | 3300013306 | Ga0163162_10001523 | Ga0163162_1000152312 | 269 |
| 63 | 3300013307 | Ga0157372_10018758 | Ga0157372_100187583 | 269 |
| 64 | 3300013307 | Ga0157372_10113180 | Ga0157372_101131802 | 269 |
| 65 | 3300013307 | Ga0157372_10195909 | Ga0157372_101959092 | 269 |
| 66 | 3300013307 | Ga0157372_10201832 | Ga0157372_102018323 | 269 |
| 67 | 3300013308 | Ga0157375_10000686 | Ga0157375_1000068619 | 269 |
| 68 | 3300014325 | Ga0163163_10495187 | Ga0163163_104951871 | 269 |
| 69 | 3300014968 | Ga0157379_10011127 | Ga0157379_100111275 | 269 |
| 70 | 3300014969 | Ga0157376_10001139 | Ga0157376_100011398 | 269 |
| 71 | 3300014969 | Ga0157376_10394225 | Ga0157376_103942252 | 269 |
| 72 | 3300017792 | Ga0163161_10034025 | Ga0163161_100340252 | 269 |
| 73 | 3300025903 | Ga0207680_10076151 | Ga0207680_100761512 | 269 |
| 74 | 3300025931 | Ga0207644_10008911 | Ga0207644_100089114 | 269 |
| 75 | 3300025941 | Ga0207711_10324337 | Ga0207711_103243372 | 269 |
| 76 | 3300025986 | Ga0207658_10008025 | Ga0207658_100080252 | 269 |
| 77 | 3300026035 | Ga0207703_10579352 | Ga0207703_105793522 | 269 |
| 78 | 3300026089 | Ga0207648_10169059 | Ga0207648_101690592 | 269 |
| 79 | 3300037312 | Ga0395899_0174223 | Ga0395899_0174223_528_1337 | 269 |
| 80 | 3300037418 | Ga0395900_0124935 | Ga0395900_0124935_1774_2583 | 269 |
| 81 | 3300048904 | Ga0496101_0080185 | Ga0496101_0080185_69_878 | 269 |
| 82 | 3300048917 | Ga0496114_0040216 | Ga0496114_0040216_2388_3197 | 269 |
| 83 | 3300049586 | Ga0501070_0135800 | Ga0501070_0135800_414_1223 | 269 |
| 84 | 3300049823 | Ga0501044_0048864 | Ga0501044_0048864_2172_2981 | 269 |
| 85 | 3300005457 | Ga0070662_100210733 | Ga0070662_1002107332 | 270 |
| 86 | 3300009094 | Ga0111539_10073279 | Ga0111539_100732794 | 270 |
| 87 | 3300025934 | Ga0207686_10245279 | Ga0207686_102452791 | 270 |
| 88 | 3300050511 | nmdc:mga08y16_201809_c1 | nmdc:mga08y16_201809_c1_406_1284 | 270 |
| 89 | 3300005337 | Ga0070682_100181005 | Ga0070682_1001810052 | 271 |
| 90 | 3300025921 | Ga0207652_10236324 | Ga0207652_102363242 | 271 |
| 91 | 3300026075 | Ga0207708_10341101 | Ga0207708_103411012 | 271 |
| 92 | 3300027907 | Ga0207428_10062495 | Ga0207428_100624954 | 271 |
| 93 | 3300013307 | Ga0157372_10563121 | Ga0157372_105631211 | 272 |
| 94 | 3300021384 | Ga0213876_10037551 | Ga0213876_100375512 | 272 |
| 95 | 3300039437 | Ga0436365_0333717 | Ga0436365_0333717_350_1252 | 272 |
| 96 | 3300049521 | Ga0501298_007964 | Ga0501298_007964_898_1719 | 273 |
| 97 | iso_pu_bacteria | 2911138879 | 2911143797 | 273 |
| 98 | 3300025904 | Ga0207647_10027231 | Ga0207647_100272311 | 274 |
| 99 | 3300025909 | Ga0207705_10043803 | Ga0207705_100438032 | 274 |
| 100 | 3300003320 | rootH2_10009982 | rootH2_1000998217 | 275 |
| 101 | 3300005327 | Ga0070658_10160350 | Ga0070658_101603501 | 275 |
| 102 | 3300005336 | Ga0070680_100008782 | Ga0070680_1000087824 | 275 |
| 103 | 3300005339 | Ga0070660_100048944 | Ga0070660_1000489442 | 275 |
| 104 | 3300005457 | Ga0070662_100130026 | Ga0070662_1001300263 | 275 |
| 105 | 3300005530 | Ga0070679_100026672 | Ga0070679_1000266722 | 275 |
| 106 | 3300005539 | Ga0068853_100010908 | Ga0068853_1000109084 | 275 |
| 107 | 3300005563 | Ga0068855_100031575 | Ga0068855_1000315752 | 275 |
| 108 | 3300005577 | Ga0068857_100219479 | Ga0068857_1002194792 | 275 |
| 109 | 3300025919 | Ga0207657_10192301 | Ga0207657_101923012 | 275 |
| 110 | 3300025921 | Ga0207652_10016246 | Ga0207652_100162466 | 275 |
| 111 | 3300026041 | Ga0207639_10019277 | Ga0207639_100192775 | 275 |
| 112 | 3300026116 | Ga0207674_10010211 | Ga0207674_100102118 | 275 |
| 113 | 3300025917 | Ga0207660_10041338 | Ga0207660_100413384 | 276 |
| 114 | 3300003322 | rootL2_10145242 | rootL2_101452422 | 277 |
| 115 | 3300005355 | Ga0070671_100121363 | Ga0070671_1001213632 | 277 |
| 116 | 3300005364 | Ga0070673_100355710 | Ga0070673_1003557102 | 277 |
| 117 | 3300005535 | Ga0070684_100004469 | Ga0070684_1000044691 | 277 |
| 118 | 3300005577 | Ga0068857_100213959 | Ga0068857_1002139592 | 277 |
| 119 | 3300005834 | Ga0068851_10073973 | Ga0068851_100739732 | 277 |
| 120 | 3300049571 | Ga0501034_0000017 | Ga0501034_0000017_52889_53731 | 277 |
| 121 | 3300005564 | Ga0070664_100366106 | Ga0070664_1003661062 | 278 |
| 122 | 3300005616 | Ga0068852_100044179 | Ga0068852_1000441793 | 278 |
| 123 | 3300005618 | Ga0068864_100480800 | Ga0068864_1004808001 | 278 |
| 124 | 3300005834 | Ga0068851_10063590 | Ga0068851_100635902 | 278 |
| 125 | 3300025321 | Ga0207656_10023113 | Ga0207656_100231131 | 278 |
| 126 | 3300025321 | Ga0207656_10050990 | Ga0207656_100509902 | 278 |
| 127 | 3300025921 | Ga0207652_10035250 | Ga0207652_100352505 | 278 |
| 128 | 3300025931 | Ga0207644_10044110 | Ga0207644_100441104 | 278 |
| 129 | 3300025942 | Ga0207689_10213690 | Ga0207689_102136901 | 278 |
| 130 | 3300025960 | Ga0207651_10240143 | Ga0207651_102401432 | 278 |
| 131 | 3300026142 | Ga0207698_10097006 | Ga0207698_100970062 | 278 |
| 132 | 3300003354 | JGI25160J50197_1000941 | JGI25160J50197_10009417 | 279 |
| 133 | 3300005459 | Ga0068867_100080730 | Ga0068867_1000807302 | 279 |
| 134 | 3300006358 | Ga0068871_100535463 | Ga0068871_1005354631 | 279 |
| 135 | 3300009174 | Ga0105241_10295272 | Ga0105241_102952723 | 279 |
| 136 | 3300013296 | Ga0157374_10000260 | Ga0157374_1000026034 | 279 |
| 137 | 3300025302 | Ga0207426_1000211 | Ga0207426_100021123 | 279 |
| 138 | 3300025919 | Ga0207657_10340403 | Ga0207657_103404031 | 279 |
| 139 | 3300026089 | Ga0207648_10067242 | Ga0207648_100672422 | 279 |
| 140 | 3300049573 | Ga0501037_0172262 | Ga0501037_0172262_426_1265 | 279 |
| 141 | 3300009174 | Ga0105241_10251282 | Ga0105241_102512822 | 281 |
| 142 | 3300025911 | Ga0207654_10306619 | Ga0207654_103066192 | 281 |
| 143 | 3300031730 | Ga0307516_10002314 | Ga0307516_1000231410 | 281 |
| 144 | 3300035170 | Ga0373943_0182227 | Ga0373943_0182227_74_937 | 281 |
| 145 | 3300003316 | rootH1_10070184 | rootH1_100701842 | 282 |
| 146 | 3300005616 | Ga0068852_100156239 | Ga0068852_1001562392 | 282 |
| 147 | 3300005844 | Ga0068862_100241903 | Ga0068862_1002419032 | 282 |
| 148 | 3300009553 | Ga0105249_10339243 | Ga0105249_103392432 | 282 |
| 149 | 3300013306 | Ga0163162_10001336 | Ga0163162_100013364 | 282 |
| 150 | 3300026142 | Ga0207698_10131542 | Ga0207698_101315422 | 282 |
| 151 | 3300028381 | Ga0268264_10000019 | Ga0268264_10000019209 | 282 |
| 152 | 3300028381 | Ga0268264_10000054 | Ga0268264_10000054161 | 282 |
| 153 | 3300044658 | Ga0466972_0009311 | Ga0466972_0009311_3814_4671 | 282 |
| 154 | 3300046460 | Ga0495638_0033016 | Ga0495638_0033016_505_1356 | 282 |
| 155 | 3300046524 | Ga0495648_0002002 | Ga0495648_0002002_11901_12752 | 282 |
| 156 | 3300047443 | Ga0495687_000031 | Ga0495687_000031_127441_128292 | 282 |
| 157 | 3300053092 | Ga0500583_0024874 | Ga0500583_0024874_354_1205 | 282 |
| 158 | 3300053156 | Ga0500622_0000926 | Ga0500622_0000926_20673_21524 | 282 |
| 159 | 3300003320 | rootH2_10076618 | rootH2_100766182 | 283 |
| 160 | 3300005535 | Ga0070684_100507321 | Ga0070684_1005073211 | 283 |
| 161 | 3300009093 | Ga0105240_10000472 | Ga0105240_100004724 | 283 |
| 162 | 3300009174 | Ga0105241_10006485 | Ga0105241_100064854 | 283 |
| 163 | 3300009551 | Ga0105238_10002017 | Ga0105238_1000201712 | 283 |
| 164 | 3300013104 | Ga0157370_10157853 | Ga0157370_101578532 | 283 |
| 165 | 3300013307 | Ga0157372_10234475 | Ga0157372_102344752 | 283 |
| 166 | 3300025913 | Ga0207695_10001688 | Ga0207695_1000168829 | 283 |
| 167 | 3300025914 | Ga0207671_10011870 | Ga0207671_100118702 | 283 |
| 168 | 3300030521 | Ga0307511_10000228 | Ga0307511_1000022812 | 283 |
| 169 | iso_pu_bacteria | 8003151029 | 8003156874 | 283 |
| 170 | 3300005327 | Ga0070658_10001648 | Ga0070658_100016484 | 284 |
| 171 | 3300005328 | Ga0070676_10000489 | Ga0070676_1000048914 | 284 |
| 172 | 3300005334 | Ga0068869_100071604 | Ga0068869_1000716042 | 284 |
| 173 | 3300005338 | Ga0068868_100000187 | Ga0068868_10000018729 | 284 |
| 174 | 3300005347 | Ga0070668_100003714 | Ga0070668_1000037142 | 284 |
| 175 | 3300005354 | Ga0070675_100110972 | Ga0070675_1001109722 | 284 |
| 176 | 3300005364 | Ga0070673_100000124 | Ga0070673_10000012412 | 284 |
| 177 | 3300005367 | Ga0070667_100000980 | Ga0070667_10000098012 | 284 |
| 178 | 3300005457 | Ga0070662_100010835 | Ga0070662_1000108352 | 284 |
| 179 | 3300005458 | Ga0070681_10147631 | Ga0070681_101476312 | 284 |
| 180 | 3300005459 | Ga0068867_100002368 | Ga0068867_1000023686 | 284 |
| 181 | 3300005539 | Ga0068853_100002569 | Ga0068853_1000025694 | 284 |
| 182 | 3300005543 | Ga0070672_100000105 | Ga0070672_10000010525 | 284 |
| 183 | 3300005548 | Ga0070665_100000018 | Ga0070665_100000018146 | 284 |
| 184 | 3300005548 | Ga0070665_100000635 | Ga0070665_10000063525 | 284 |
| 185 | 3300005563 | Ga0068855_100097871 | Ga0068855_1000978712 | 284 |
| 186 | 3300005564 | Ga0070664_100083437 | Ga0070664_1000834372 | 284 |
| 187 | 3300005616 | Ga0068852_100098181 | Ga0068852_1000981812 | 284 |
| 188 | 3300005618 | Ga0068864_100001254 | Ga0068864_1000012545 | 284 |
| 189 | 3300005719 | Ga0068861_100422216 | Ga0068861_1004222161 | 284 |
| 190 | 3300005834 | Ga0068851_10000475 | Ga0068851_1000047514 | 284 |
| 191 | 3300005841 | Ga0068863_100005370 | Ga0068863_1000053702 | 284 |
| 192 | 3300005843 | Ga0068860_100001418 | Ga0068860_10000141814 | 284 |
| 193 | 3300006237 | Ga0097621_100007453 | Ga0097621_1000074532 | 284 |
| 194 | 3300006881 | Ga0068865_100001094 | Ga0068865_1000010949 | 284 |
| 195 | 3300009093 | Ga0105240_10154276 | Ga0105240_101542762 | 284 |
| 196 | 3300009101 | Ga0105247_10033980 | Ga0105247_100339802 | 284 |
| 197 | 3300009148 | Ga0105243_10589518 | Ga0105243_105895181 | 284 |
| 198 | 3300009177 | Ga0105248_10151001 | Ga0105248_101510012 | 284 |
| 199 | 3300009545 | Ga0105237_10415685 | Ga0105237_104156852 | 284 |
| 200 | 3300009553 | Ga0105249_10085265 | Ga0105249_100852652 | 284 |
| 201 | 3300013102 | Ga0157371_10208211 | Ga0157371_102082112 | 284 |
| 202 | 3300013296 | Ga0157374_10002980 | Ga0157374_100029802 | 284 |
| 203 | 3300013297 | Ga0157378_10013251 | Ga0157378_100132512 | 284 |
| 204 | 3300013306 | Ga0163162_10000312 | Ga0163162_1000031225 | 284 |
| 205 | 3300013307 | Ga0157372_10094440 | Ga0157372_100944402 | 284 |
| 206 | 3300013307 | Ga0157372_10410828 | Ga0157372_104108282 | 284 |
| 207 | 3300013308 | Ga0157375_10002871 | Ga0157375_1000287114 | 284 |
| 208 | 3300014325 | Ga0163163_10000346 | Ga0163163_1000034627 | 284 |
| 209 | 3300014968 | Ga0157379_10000242 | Ga0157379_1000024211 | 284 |
| 210 | 3300025907 | Ga0207645_10001794 | Ga0207645_100017942 | 284 |
| 211 | 3300025913 | Ga0207695_10106388 | Ga0207695_101063882 | 284 |
| 212 | 3300025933 | Ga0207706_10061177 | Ga0207706_100611772 | 284 |
| 213 | 3300025938 | Ga0207704_10000562 | Ga0207704_100005622 | 284 |
| 214 | 3300025940 | Ga0207691_10000012 | Ga0207691_1000001261 | 284 |
| 215 | 3300025949 | Ga0207667_10034450 | Ga0207667_100344505 | 284 |
| 216 | 3300025960 | Ga0207651_10000216 | Ga0207651_100002162 | 284 |
| 217 | 3300025961 | Ga0207712_10010440 | Ga0207712_100104403 | 284 |
| 218 | 3300025972 | Ga0207668_10001361 | Ga0207668_100013614 | 284 |
| 219 | 3300025986 | Ga0207658_10000374 | Ga0207658_1000037430 | 284 |
| 220 | 3300026023 | Ga0207677_10000984 | Ga0207677_100009842 | 284 |
| 221 | 3300026041 | Ga0207639_10002390 | Ga0207639_100023908 | 284 |
| 222 | 3300026088 | Ga0207641_10022535 | Ga0207641_100225353 | 284 |
| 223 | 3300026088 | Ga0207641_10460278 | Ga0207641_104602782 | 284 |
| 224 | 3300026089 | Ga0207648_10010253 | Ga0207648_100102533 | 284 |
| 225 | 3300026095 | Ga0207676_10000697 | Ga0207676_100006975 | 284 |
| 226 | 3300026118 | Ga0207675_100022342 | Ga0207675_1000223423 | 284 |
| 227 | 3300026142 | Ga0207698_10009340 | Ga0207698_100093402 | 284 |
| 228 | 3300028379 | Ga0268266_10000026 | Ga0268266_10000026215 | 284 |
| 229 | 3300028379 | Ga0268266_10005379 | Ga0268266_1000537912 | 284 |
| 230 | 3300028381 | Ga0268264_10003975 | Ga0268264_100039753 | 284 |
| 231 | 3300028381 | Ga0268264_10005188 | Ga0268264_100051887 | 284 |
| 232 | 3300053153 | Ga0500616_0026690 | Ga0500616_0026690_1141_1998 | 284 |
| 233 | 3300009545 | Ga0105237_10360118 | Ga0105237_103601181 | 285 |
| 234 | 3300013100 | Ga0157373_10164397 | Ga0157373_101643972 | 285 |
| 235 | 3300013307 | Ga0157372_10023974 | Ga0157372_100239742 | 285 |
| 236 | 3300025914 | Ga0207671_10236354 | Ga0207671_102363542 | 285 |
| 237 | 3300025925 | Ga0207650_10002954 | Ga0207650_100029542 | 285 |
| 238 | 3300025931 | Ga0207644_10041431 | Ga0207644_100414313 | 285 |
| 239 | 3300031731 | Ga0307405_10005405 | Ga0307405_100054058 | 285 |
| 240 | 3300031824 | Ga0307413_10008468 | Ga0307413_100084685 | 285 |
| 241 | 3300031852 | Ga0307410_10133568 | Ga0307410_101335682 | 285 |
| 242 | 3300031903 | Ga0307407_10103515 | Ga0307407_101035152 | 285 |
| 243 | 3300031911 | Ga0307412_10061446 | Ga0307412_100614462 | 285 |
| 244 | 3300031995 | Ga0307409_100062332 | Ga0307409_1000623322 | 285 |
| 245 | 3300032002 | Ga0307416_100060439 | Ga0307416_1000604392 | 285 |
| 246 | 3300032126 | Ga0307415_100035696 | Ga0307415_1000356962 | 285 |
| 247 | 3300033180 | Ga0307510_10017333 | Ga0307510_100173339 | 285 |
| 248 | 3300046507 | Ga0495606_0003341 | Ga0495606_0003341_11391_12284 | 285 |
| 249 | 3300049650 | Ga0501199_001778 | Ga0501199_001778_1078_1935 | 285 |
| 250 | 3300049652 | Ga0501202_004538 | Ga0501202_004538_1491_2348 | 285 |
| 251 | 3300049654 | Ga0501207_001587 | Ga0501207_001587_1054_1911 | 285 |
| 252 | 3300049661 | Ga0501217_003847 | Ga0501217_003847_1415_2272 | 285 |
| 253 | 3300049686 | Ga0501257_030754 | Ga0501257_030754_364_1221 | 285 |
| 254 | 3300005328 | Ga0070676_10004865 | Ga0070676_100048653 | 286 |
| 255 | 3300005328 | Ga0070676_10400885 | Ga0070676_104008851 | 286 |
| 256 | 3300005331 | Ga0070670_100053373 | Ga0070670_1000533732 | 286 |
| 257 | 3300005333 | Ga0070677_10042946 | Ga0070677_100429462 | 286 |
| 258 | 3300005334 | Ga0068869_100108650 | Ga0068869_1001086501 | 286 |
| 259 | 3300005335 | Ga0070666_10000031 | Ga0070666_1000003140 | 286 |
| 260 | 3300005338 | Ga0068868_100003257 | Ga0068868_1000032576 | 286 |
| 261 | 3300005338 | Ga0068868_100148261 | Ga0068868_1001482612 | 286 |
| 262 | 3300005341 | Ga0070691_10088105 | Ga0070691_100881052 | 286 |
| 263 | 3300005347 | Ga0070668_100027163 | Ga0070668_1000271631 | 286 |
| 264 | 3300005354 | Ga0070675_100035460 | Ga0070675_1000354602 | 286 |
| 265 | 3300005356 | Ga0070674_100007803 | Ga0070674_1000078032 | 286 |
| 266 | 3300005364 | Ga0070673_100070512 | Ga0070673_1000705124 | 286 |
| 267 | 3300005367 | Ga0070667_100011432 | Ga0070667_1000114328 | 286 |
| 268 | 3300005367 | Ga0070667_100174060 | Ga0070667_1001740602 | 286 |
| 269 | 3300005438 | Ga0070701_10095774 | Ga0070701_100957742 | 286 |
| 270 | 3300005456 | Ga0070678_100007411 | Ga0070678_1000074114 | 286 |
| 271 | 3300005459 | Ga0068867_100066748 | Ga0068867_1000667483 | 286 |
| 272 | 3300005466 | Ga0070685_10076045 | Ga0070685_100760451 | 286 |
| 273 | 3300005466 | Ga0070685_10302072 | Ga0070685_103020722 | 286 |
| 274 | 3300005539 | Ga0068853_100231375 | Ga0068853_1002313751 | 286 |
| 275 | 3300005539 | Ga0068853_100259861 | Ga0068853_1002598611 | 286 |
| 276 | 3300005543 | Ga0070672_100096093 | Ga0070672_1000960932 | 286 |
| 277 | 3300005543 | Ga0070672_100291040 | Ga0070672_1002910402 | 286 |
| 278 | 3300005544 | Ga0070686_100001965 | Ga0070686_1000019658 | 286 |
| 279 | 3300005548 | Ga0070665_100076193 | Ga0070665_1000761934 | 286 |
| 280 | 3300005563 | Ga0068855_100019495 | Ga0068855_1000194958 | 286 |
| 281 | 3300005564 | Ga0070664_100380197 | Ga0070664_1003801971 | 286 |
| 282 | 3300005577 | Ga0068857_100000287 | Ga0068857_10000028721 | 286 |
| 283 | 3300005578 | Ga0068854_100026109 | Ga0068854_1000261092 | 286 |
| 284 | 3300005614 | Ga0068856_100044643 | Ga0068856_1000446432 | 286 |
| 285 | 3300005616 | Ga0068852_100008024 | Ga0068852_1000080246 | 286 |
| 286 | 3300005617 | Ga0068859_100000045 | Ga0068859_100000045100 | 286 |
| 287 | 3300005617 | Ga0068859_100026115 | Ga0068859_1000261157 | 286 |
| 288 | 3300005617 | Ga0068859_100049476 | Ga0068859_1000494762 | 286 |
| 289 | 3300005617 | Ga0068859_100220111 | Ga0068859_1002201112 | 286 |
| 290 | 3300005618 | Ga0068864_100001485 | Ga0068864_10000148516 | 286 |
| 291 | 3300005719 | Ga0068861_100201581 | Ga0068861_1002015812 | 286 |
| 292 | 3300005834 | Ga0068851_10008746 | Ga0068851_100087463 | 286 |
| 293 | 3300005841 | Ga0068863_100002352 | Ga0068863_10000235215 | 286 |
| 294 | 3300005842 | Ga0068858_100003543 | Ga0068858_1000035435 | 286 |
| 295 | 3300005842 | Ga0068858_100476066 | Ga0068858_1004760661 | 286 |
| 296 | 3300005843 | Ga0068860_100008301 | Ga0068860_1000083014 | 286 |
| 297 | 3300005843 | Ga0068860_100018642 | Ga0068860_1000186423 | 286 |
| 298 | 3300005843 | Ga0068860_100039499 | Ga0068860_1000394994 | 286 |
| 299 | 3300005843 | Ga0068860_100076409 | Ga0068860_1000764093 | 286 |
| 300 | 3300005843 | Ga0068860_100576537 | Ga0068860_1005765371 | 286 |
| 301 | 3300006237 | Ga0097621_100035931 | Ga0097621_1000359312 | 286 |
| 302 | 3300006358 | Ga0068871_100008100 | Ga0068871_1000081004 | 286 |
| 303 | 3300006358 | Ga0068871_100228898 | Ga0068871_1002288982 | 286 |
| 304 | 3300006871 | Ga0075434_100009056 | Ga0075434_1000090566 | 286 |
| 305 | 3300006881 | Ga0068865_100006917 | Ga0068865_1000069174 | 286 |
| 306 | 3300006881 | Ga0068865_100016931 | Ga0068865_1000169315 | 286 |
| 307 | 3300006931 | Ga0097620_100000045 | Ga0097620_10000004540 | 286 |
| 308 | 3300006931 | Ga0097620_100026115 | Ga0097620_1000261157 | 286 |
| 309 | 3300006931 | Ga0097620_100049476 | Ga0097620_1000494762 | 286 |
| 310 | 3300006931 | Ga0097620_100220098 | Ga0097620_1002200982 | 286 |
| 311 | 3300009093 | Ga0105240_10019870 | Ga0105240_100198703 | 286 |
| 312 | 3300009093 | Ga0105240_10022478 | Ga0105240_100224788 | 286 |
| 313 | 3300009093 | Ga0105240_10097824 | Ga0105240_100978241 | 286 |
| 314 | 3300009101 | Ga0105247_10003520 | Ga0105247_1000352011 | 286 |
| 315 | 3300009148 | Ga0105243_10109968 | Ga0105243_101099682 | 286 |
| 316 | 3300009174 | Ga0105241_10001733 | Ga0105241_100017333 | 286 |
| 317 | 3300009174 | Ga0105241_10068382 | Ga0105241_100683822 | 286 |
| 318 | 3300009174 | Ga0105241_10219785 | Ga0105241_102197852 | 286 |
| 319 | 3300009176 | Ga0105242_10010544 | Ga0105242_100105446 | 286 |
| 320 | 3300009176 | Ga0105242_10020808 | Ga0105242_100208084 | 286 |
| 321 | 3300009545 | Ga0105237_10001767 | Ga0105237_1000176721 | 286 |
| 322 | 3300009545 | Ga0105237_10054400 | Ga0105237_100544002 | 286 |
| 323 | 3300009545 | Ga0105237_10060266 | Ga0105237_100602663 | 286 |
| 324 | 3300009545 | Ga0105237_10317901 | Ga0105237_103179011 | 286 |
| 325 | 3300009551 | Ga0105238_10159680 | Ga0105238_101596801 | 286 |
| 326 | 3300009553 | Ga0105249_10011083 | Ga0105249_100110834 | 286 |
| 327 | 3300010375 | Ga0105239_10001180 | Ga0105239_100011804 | 286 |
| 328 | 3300013100 | Ga0157373_10067784 | Ga0157373_100677842 | 286 |
| 329 | 3300013104 | Ga0157370_10009358 | Ga0157370_100093588 | 286 |
| 330 | 3300013105 | Ga0157369_10073809 | Ga0157369_100738093 | 286 |
| 331 | 3300013296 | Ga0157374_10027083 | Ga0157374_100270835 | 286 |
| 332 | 3300013297 | Ga0157378_10003039 | Ga0157378_100030393 | 286 |
| 333 | 3300013297 | Ga0157378_10071685 | Ga0157378_100716852 | 286 |
| 334 | 3300013306 | Ga0163162_10004258 | Ga0163162_1000425811 | 286 |
| 335 | 3300013306 | Ga0163162_10074114 | Ga0163162_100741142 | 286 |
| 336 | 3300013307 | Ga0157372_10000741 | Ga0157372_100007414 | 286 |
| 337 | 3300014325 | Ga0163163_10135642 | Ga0163163_101356423 | 286 |
| 338 | 3300014968 | Ga0157379_10052461 | Ga0157379_100524613 | 286 |
| 339 | 3300014968 | Ga0157379_10179209 | Ga0157379_101792092 | 286 |
| 340 | 3300014969 | Ga0157376_10085547 | Ga0157376_100855472 | 286 |
| 341 | 3300014969 | Ga0157376_10192255 | Ga0157376_101922552 | 286 |
| 342 | 3300025901 | Ga0207688_10030435 | Ga0207688_100304352 | 286 |
| 343 | 3300025903 | Ga0207680_10000141 | Ga0207680_1000014127 | 286 |
| 344 | 3300025904 | Ga0207647_10002819 | Ga0207647_100028195 | 286 |
| 345 | 3300025907 | Ga0207645_10054686 | Ga0207645_100546861 | 286 |
| 346 | 3300025911 | Ga0207654_10057810 | Ga0207654_100578102 | 286 |
| 347 | 3300025911 | Ga0207654_10271483 | Ga0207654_102714832 | 286 |
| 348 | 3300025913 | Ga0207695_10028517 | Ga0207695_100285176 | 286 |
| 349 | 3300025913 | Ga0207695_10064026 | Ga0207695_100640263 | 286 |
| 350 | 3300025914 | Ga0207671_10011688 | Ga0207671_100116883 | 286 |
| 351 | 3300025914 | Ga0207671_10142434 | Ga0207671_101424342 | 286 |
| 352 | 3300025914 | Ga0207671_10209971 | Ga0207671_102099711 | 286 |
| 353 | 3300025923 | Ga0207681_10017517 | Ga0207681_100175173 | 286 |
| 354 | 3300025923 | Ga0207681_10325805 | Ga0207681_103258052 | 286 |
| 355 | 3300025925 | Ga0207650_10288149 | Ga0207650_102881492 | 286 |
| 356 | 3300025927 | Ga0207687_10137272 | Ga0207687_101372721 | 286 |
| 357 | 3300025931 | Ga0207644_10036096 | Ga0207644_100360963 | 286 |
| 358 | 3300025934 | Ga0207686_10050058 | Ga0207686_100500582 | 286 |
| 359 | 3300025937 | Ga0207669_10096141 | Ga0207669_100961412 | 286 |
| 360 | 3300025940 | Ga0207691_10004759 | Ga0207691_100047594 | 286 |
| 361 | 3300025940 | Ga0207691_10088274 | Ga0207691_100882743 | 286 |
| 362 | 3300025940 | Ga0207691_10216348 | Ga0207691_102163482 | 286 |
| 363 | 3300025942 | Ga0207689_10008936 | Ga0207689_100089362 | 286 |
| 364 | 3300025942 | Ga0207689_10018137 | Ga0207689_100181371 | 286 |
| 365 | 3300025942 | Ga0207689_10030002 | Ga0207689_100300023 | 286 |
| 366 | 3300025942 | Ga0207689_10070533 | Ga0207689_100705332 | 286 |
| 367 | 3300025949 | Ga0207667_10000643 | Ga0207667_1000064311 | 286 |
| 368 | 3300025960 | Ga0207651_10354520 | Ga0207651_103545202 | 286 |
| 369 | 3300025972 | Ga0207668_10054223 | Ga0207668_100542232 | 286 |
| 370 | 3300025981 | Ga0207640_10015769 | Ga0207640_100157691 | 286 |
| 371 | 3300025986 | Ga0207658_10033838 | Ga0207658_100338382 | 286 |
| 372 | 3300025986 | Ga0207658_10050631 | Ga0207658_100506313 | 286 |
| 373 | 3300026023 | Ga0207677_10092119 | Ga0207677_100921192 | 286 |
| 374 | 3300026035 | Ga0207703_10035352 | Ga0207703_100353522 | 286 |
| 375 | 3300026035 | Ga0207703_10278392 | Ga0207703_102783922 | 286 |
| 376 | 3300026041 | Ga0207639_10158079 | Ga0207639_101580792 | 286 |
| 377 | 3300026041 | Ga0207639_10545805 | Ga0207639_105458051 | 286 |
| 378 | 3300026078 | Ga0207702_10025199 | Ga0207702_100251993 | 286 |
| 379 | 3300026088 | Ga0207641_10000133 | Ga0207641_1000013385 | 286 |
| 380 | 3300026089 | Ga0207648_10012892 | Ga0207648_100128925 | 286 |
| 381 | 3300026089 | Ga0207648_10027821 | Ga0207648_100278214 | 286 |
| 382 | 3300026116 | Ga0207674_10001630 | Ga0207674_1000163010 | 286 |
| 383 | 3300026118 | Ga0207675_100005430 | Ga0207675_1000054302 | 286 |
| 384 | 3300026118 | Ga0207675_100174885 | Ga0207675_1001748852 | 286 |
| 385 | 3300026121 | Ga0207683_10002013 | Ga0207683_1000201312 | 286 |
| 386 | 3300026142 | Ga0207698_10014863 | Ga0207698_100148635 | 286 |
| 387 | 3300028379 | Ga0268266_10035267 | Ga0268266_100352674 | 286 |
| 388 | 3300028381 | Ga0268264_10008390 | Ga0268264_100083906 | 286 |
| 389 | 3300028381 | Ga0268264_10008570 | Ga0268264_100085704 | 286 |
| 390 | 3300028381 | Ga0268264_10008865 | Ga0268264_100088654 | 286 |
| 391 | 3300028381 | Ga0268264_10107627 | Ga0268264_101076273 | 286 |
| 392 | 3300031456 | Ga0307513_10206813 | Ga0307513_102068132 | 286 |
| 393 | 3300044658 | Ga0466972_0000016 | Ga0466972_0000016_50292_51221 | 286 |
| 394 | 3300044765 | Ga0466970_0003015 | Ga0466970_0003015_3305_4234 | 286 |
| 395 | 3300047320 | Ga0495672_0038837 | Ga0495672_0038837_81_944 | 286 |
| 396 | 3300049513 | Ga0501290_003419 | Ga0501290_003419_1065_1925 | 286 |
| 397 | 3300049651 | Ga0501201_003219 | Ga0501201_003219_55_915 | 286 |
| 398 | 3300049652 | Ga0501202_000819 | Ga0501202_000819_3133_3993 | 286 |
| 399 | 3300049661 | Ga0501217_056499 | Ga0501217_056499_38_898 | 286 |
| 400 | 3300049662 | Ga0501222_001204 | Ga0501222_001204_1358_2218 | 286 |
| 401 | 3300049663 | Ga0501223_001850 | Ga0501223_001850_1455_2315 | 286 |
| 402 | 3300049673 | Ga0501240_002479 | Ga0501240_002479_923_1783 | 286 |
| 403 | 3300049675 | Ga0501243_003490 | Ga0501243_003490_57_917 | 286 |
| 404 | 3300049686 | Ga0501257_002646 | Ga0501257_002646_1135_1995 | 286 |
| 405 | 3300049690 | Ga0501261_000533 | Ga0501261_000533_3021_3881 | 286 |
| 406 | 3300049703 | Ga0501219_000159 | Ga0501219_000159_474_1406 | 286 |
| 407 | 3300049705 | Ga0501225_0005770 | Ga0501225_0005770_2279_3139 | 286 |
| 408 | 3300049707 | Ga0501234_003320 | Ga0501234_003320_80_940 | 286 |
| 409 | 3300049763 | Ga0501266_006733 | Ga0501266_006733_536_1396 | 286 |
| 410 | 3300050005 | Ga0501284_00018 | Ga0501284_00018_72050_72982 | 286 |
| 411 | 3300053177 | Ga0500636_0053601 | Ga0500636_0053601_1472_2332 | 286 |
| 412 | 3300000043 | ARcpr5yngRDRAFT_c003927 | ARcpr5yngRDRAFT_0039272 | 287 |
| 413 | 3300003215 | JGI25153J46596_10009336 | JGI25153J46596_100093364 | 287 |
| 414 | 3300003316 | rootH1_10028021 | rootH1_100280213 | 287 |
| 415 | 3300003322 | rootL2_10028177 | rootL2_100281772 | 287 |
| 416 | 3300003322 | rootL2_10247536 | rootL2_102475361 | 287 |
| 417 | 3300003323 | rootH1_10116572 | rootH1_101165722 | 287 |
| 418 | 3300003771 | Ga0055526_1012091 | Ga0055526_10120914 | 287 |
| 419 | 3300003790 | Ga0055528_1001378 | Ga0055528_10013787 | 287 |
| 420 | 3300003791 | Ga0055530_10002564 | Ga0055530_100025648 | 287 |
| 421 | 3300004625 | Ga0055543_1018775 | Ga0055543_10187751 | 287 |
| 422 | 3300005262 | Ga0065165_1002242 | Ga0065165_10022422 | 287 |
| 423 | 3300005327 | Ga0070658_10081792 | Ga0070658_100817922 | 287 |
| 424 | 3300005328 | Ga0070676_10005268 | Ga0070676_100052685 | 287 |
| 425 | 3300005329 | Ga0070683_100040688 | Ga0070683_1000406882 | 287 |
| 426 | 3300005330 | Ga0070690_100047878 | Ga0070690_1000478781 | 287 |
| 427 | 3300005331 | Ga0070670_100058021 | Ga0070670_1000580214 | 287 |
| 428 | 3300005334 | Ga0068869_100011325 | Ga0068869_1000113252 | 287 |
| 429 | 3300005336 | Ga0070680_100005567 | Ga0070680_1000055674 | 287 |
| 430 | 3300005337 | Ga0070682_100278342 | Ga0070682_1002783422 | 287 |
| 431 | 3300005338 | Ga0068868_100000427 | Ga0068868_10000042716 | 287 |
| 432 | 3300005338 | Ga0068868_100128787 | Ga0068868_1001287872 | 287 |
| 433 | 3300005339 | Ga0070660_100001959 | Ga0070660_10000195913 | 287 |
| 434 | 3300005339 | Ga0070660_100013641 | Ga0070660_1000136413 | 287 |
| 435 | 3300005341 | Ga0070691_10006430 | Ga0070691_100064302 | 287 |
| 436 | 3300005344 | Ga0070661_100002315 | Ga0070661_1000023154 | 287 |
| 437 | 3300005344 | Ga0070661_100209652 | Ga0070661_1002096522 | 287 |
| 438 | 3300005345 | Ga0070692_10087061 | Ga0070692_100870613 | 287 |
| 439 | 3300005347 | Ga0070668_100313498 | Ga0070668_1003134981 | 287 |
| 440 | 3300005354 | Ga0070675_100064519 | Ga0070675_1000645192 | 287 |
| 441 | 3300005355 | Ga0070671_100238505 | Ga0070671_1002385051 | 287 |
| 442 | 3300005356 | Ga0070674_100339814 | Ga0070674_1003398142 | 287 |
| 443 | 3300005364 | Ga0070673_100022372 | Ga0070673_1000223722 | 287 |
| 444 | 3300005364 | Ga0070673_100346412 | Ga0070673_1003464122 | 287 |
| 445 | 3300005366 | Ga0070659_100003555 | Ga0070659_1000035558 | 287 |
| 446 | 3300005366 | Ga0070659_100328513 | Ga0070659_1003285132 | 287 |
| 447 | 3300005438 | Ga0070701_10302166 | Ga0070701_103021661 | 287 |
| 448 | 3300005455 | Ga0070663_100547125 | Ga0070663_1005471251 | 287 |
| 449 | 3300005456 | Ga0070678_100057194 | Ga0070678_1000571942 | 287 |
| 450 | 3300005456 | Ga0070678_100308276 | Ga0070678_1003082761 | 287 |
| 451 | 3300005457 | Ga0070662_100009734 | Ga0070662_1000097343 | 287 |
| 452 | 3300005457 | Ga0070662_100011948 | Ga0070662_1000119485 | 287 |
| 453 | 3300005457 | Ga0070662_100473921 | Ga0070662_1004739212 | 287 |
| 454 | 3300005458 | Ga0070681_10023031 | Ga0070681_100230312 | 287 |
| 455 | 3300005458 | Ga0070681_10077245 | Ga0070681_100772454 | 287 |
| 456 | 3300005459 | Ga0068867_100003400 | Ga0068867_1000034005 | 287 |
| 457 | 3300005459 | Ga0068867_100028878 | Ga0068867_1000288781 | 287 |
| 458 | 3300005466 | Ga0070685_10049557 | Ga0070685_100495574 | 287 |
| 459 | 3300005468 | Ga0070707_100351801 | Ga0070707_1003518012 | 287 |
| 460 | 3300005530 | Ga0070679_100003309 | Ga0070679_10000330914 | 287 |
| 461 | 3300005535 | Ga0070684_100001198 | Ga0070684_10000119812 | 287 |
| 462 | 3300005535 | Ga0070684_100049157 | Ga0070684_1000491575 | 287 |
| 463 | 3300005539 | Ga0068853_100002879 | Ga0068853_10000287914 | 287 |
| 464 | 3300005539 | Ga0068853_100635687 | Ga0068853_1006356871 | 287 |
| 465 | 3300005543 | Ga0070672_100114098 | Ga0070672_1001140983 | 287 |
| 466 | 3300005547 | Ga0070693_100004189 | Ga0070693_1000041893 | 287 |
| 467 | 3300005548 | Ga0070665_100130947 | Ga0070665_1001309472 | 287 |
| 468 | 3300005563 | Ga0068855_100007383 | Ga0068855_1000073837 | 287 |
| 469 | 3300005563 | Ga0068855_100045431 | Ga0068855_1000454313 | 287 |
| 470 | 3300005563 | Ga0068855_100144424 | Ga0068855_1001444242 | 287 |
| 471 | 3300005563 | Ga0068855_100349166 | Ga0068855_1003491662 | 287 |
| 472 | 3300005564 | Ga0070664_100006530 | Ga0070664_1000065303 | 287 |
| 473 | 3300005564 | Ga0070664_100020320 | Ga0070664_1000203204 | 287 |
| 474 | 3300005564 | Ga0070664_100270073 | Ga0070664_1002700732 | 287 |
| 475 | 3300005577 | Ga0068857_100007841 | Ga0068857_1000078413 | 287 |
| 476 | 3300005577 | Ga0068857_100011785 | Ga0068857_1000117855 | 287 |
| 477 | 3300005577 | Ga0068857_100186221 | Ga0068857_1001862212 | 287 |
| 478 | 3300005578 | Ga0068854_100010687 | Ga0068854_1000106872 | 287 |
| 479 | 3300005578 | Ga0068854_100309376 | Ga0068854_1003093761 | 287 |
| 480 | 3300005614 | Ga0068856_100075596 | Ga0068856_1000755962 | 287 |
| 481 | 3300005614 | Ga0068856_100126812 | Ga0068856_1001268121 | 287 |
| 482 | 3300005616 | Ga0068852_100031900 | Ga0068852_1000319002 | 287 |
| 483 | 3300005616 | Ga0068852_100157821 | Ga0068852_1001578212 | 287 |
| 484 | 3300005617 | Ga0068859_100475765 | Ga0068859_1004757651 | 287 |
| 485 | 3300005618 | Ga0068864_100161078 | Ga0068864_1001610782 | 287 |
| 486 | 3300005718 | Ga0068866_10070600 | Ga0068866_100706002 | 287 |
| 487 | 3300005841 | Ga0068863_100083560 | Ga0068863_1000835602 | 287 |
| 488 | 3300005841 | Ga0068863_100561491 | Ga0068863_1005614911 | 287 |
| 489 | 3300005841 | Ga0068863_100595920 | Ga0068863_1005959201 | 287 |
| 490 | 3300005843 | Ga0068860_100220951 | Ga0068860_1002209512 | 287 |
| 491 | 3300006195 | Ga0075366_10077696 | Ga0075366_100776962 | 287 |
| 492 | 3300006195 | Ga0075366_10086190 | Ga0075366_100861903 | 287 |
| 493 | 3300006237 | Ga0097621_100193579 | Ga0097621_1001935792 | 287 |
| 494 | 3300006358 | Ga0068871_100131671 | Ga0068871_1001316712 | 287 |
| 495 | 3300006844 | Ga0075428_100023898 | Ga0075428_1000238984 | 287 |
| 496 | 3300006846 | Ga0075430_100018099 | Ga0075430_1000180993 | 287 |
| 497 | 3300006880 | Ga0075429_100014092 | Ga0075429_1000140923 | 287 |
| 498 | 3300006931 | Ga0097620_100475764 | Ga0097620_1004757642 | 287 |
| 499 | 3300009093 | Ga0105240_10009860 | Ga0105240_100098608 | 287 |
| 500 | 3300009174 | Ga0105241_10000985 | Ga0105241_100009854 | 287 |
| 501 | 3300009174 | Ga0105241_10006681 | Ga0105241_100066814 | 287 |
| 502 | 3300009176 | Ga0105242_10564478 | Ga0105242_105644781 | 287 |
| 503 | 3300013100 | Ga0157373_10009844 | Ga0157373_100098443 | 287 |
| 504 | 3300013102 | Ga0157371_10000284 | Ga0157371_1000028430 | 287 |
| 505 | 3300013102 | Ga0157371_10000725 | Ga0157371_1000072518 | 287 |
| 506 | 3300013102 | Ga0157371_10032796 | Ga0157371_100327962 | 287 |
| 507 | 3300013104 | Ga0157370_10004751 | Ga0157370_100047515 | 287 |
| 508 | 3300013104 | Ga0157370_10021147 | Ga0157370_100211475 | 287 |
| 509 | 3300013296 | Ga0157374_10079023 | Ga0157374_100790232 | 287 |
| 510 | 3300013297 | Ga0157378_10328610 | Ga0157378_103286102 | 287 |
| 511 | 3300013306 | Ga0163162_10022439 | Ga0163162_100224392 | 287 |
| 512 | 3300013306 | Ga0163162_10074490 | Ga0163162_100744902 | 287 |
| 513 | 3300013307 | Ga0157372_10167842 | Ga0157372_101678422 | 287 |
| 514 | 3300013307 | Ga0157372_10186876 | Ga0157372_101868762 | 287 |
| 515 | 3300013307 | Ga0157372_10211924 | Ga0157372_102119242 | 287 |
| 516 | 3300013307 | Ga0157372_10245818 | Ga0157372_102458182 | 287 |
| 517 | 3300013308 | Ga0157375_10010009 | Ga0157375_100100093 | 287 |
| 518 | 3300013308 | Ga0157375_10478217 | Ga0157375_104782172 | 287 |
| 519 | 3300014745 | Ga0157377_10017063 | Ga0157377_100170634 | 287 |
| 520 | 3300014968 | Ga0157379_10032372 | Ga0157379_100323723 | 287 |
| 521 | 3300017792 | Ga0163161_10128416 | Ga0163161_101284162 | 287 |
| 522 | 3300025273 | Ga0209673_1000016 | Ga0209673_100001665 | 287 |
| 523 | 3300025295 | Ga0209564_1004934 | Ga0209564_10049345 | 287 |
| 524 | 3300025298 | Ga0209050_1000124 | Ga0209050_1000124114 | 287 |
| 525 | 3300025304 | Ga0209257_1000658 | Ga0209257_10006585 | 287 |
| 526 | 3300025315 | Ga0207697_10009658 | Ga0207697_100096583 | 287 |
| 527 | 3300025899 | Ga0207642_10054151 | Ga0207642_100541512 | 287 |
| 528 | 3300025907 | Ga0207645_10040449 | Ga0207645_100404493 | 287 |
| 529 | 3300025909 | Ga0207705_10007257 | Ga0207705_100072575 | 287 |
| 530 | 3300025913 | Ga0207695_10004070 | Ga0207695_1000407014 | 287 |
| 531 | 3300025917 | Ga0207660_10005510 | Ga0207660_100055107 | 287 |
| 532 | 3300025919 | Ga0207657_10023896 | Ga0207657_100238962 | 287 |
| 533 | 3300025919 | Ga0207657_10134061 | Ga0207657_101340611 | 287 |
| 534 | 3300025920 | Ga0207649_10026846 | Ga0207649_100268464 | 287 |
| 535 | 3300025921 | Ga0207652_10000045 | Ga0207652_1000004551 | 287 |
| 536 | 3300025921 | Ga0207652_10000214 | Ga0207652_100002142 | 287 |
| 537 | 3300025921 | Ga0207652_10008710 | Ga0207652_100087102 | 287 |
| 538 | 3300025923 | Ga0207681_10011577 | Ga0207681_100115774 | 287 |
| 539 | 3300025923 | Ga0207681_10280009 | Ga0207681_102800092 | 287 |
| 540 | 3300025926 | Ga0207659_10035806 | Ga0207659_100358063 | 287 |
| 541 | 3300025926 | Ga0207659_10096132 | Ga0207659_100961322 | 287 |
| 542 | 3300025931 | Ga0207644_10198329 | Ga0207644_101983293 | 287 |
| 543 | 3300025933 | Ga0207706_10003994 | Ga0207706_100039945 | 287 |
| 544 | 3300025933 | Ga0207706_10059068 | Ga0207706_100590683 | 287 |
| 545 | 3300025936 | Ga0207670_10070587 | Ga0207670_100705872 | 287 |
| 546 | 3300025938 | Ga0207704_10187715 | Ga0207704_101877152 | 287 |
| 547 | 3300025940 | Ga0207691_10108794 | Ga0207691_101087942 | 287 |
| 548 | 3300025940 | Ga0207691_10224567 | Ga0207691_102245672 | 287 |
| 549 | 3300025942 | Ga0207689_10009466 | Ga0207689_100094666 | 287 |
| 550 | 3300025942 | Ga0207689_10138065 | Ga0207689_101380652 | 287 |
| 551 | 3300025944 | Ga0207661_10003108 | Ga0207661_100031087 | 287 |
| 552 | 3300025944 | Ga0207661_10152076 | Ga0207661_101520762 | 287 |
| 553 | 3300025945 | Ga0207679_10004210 | Ga0207679_100042101 | 287 |
| 554 | 3300025945 | Ga0207679_10017260 | Ga0207679_100172601 | 287 |
| 555 | 3300025949 | Ga0207667_10083216 | Ga0207667_100832162 | 287 |
| 556 | 3300025949 | Ga0207667_10097434 | Ga0207667_100974343 | 287 |
| 557 | 3300025949 | Ga0207667_10132420 | Ga0207667_101324203 | 287 |
| 558 | 3300025981 | Ga0207640_10048773 | Ga0207640_100487732 | 287 |
| 559 | 3300025981 | Ga0207640_10109399 | Ga0207640_101093992 | 287 |
| 560 | 3300025986 | Ga0207658_10057016 | Ga0207658_100570163 | 287 |
| 561 | 3300026023 | Ga0207677_10004993 | Ga0207677_100049932 | 287 |
| 562 | 3300026023 | Ga0207677_10018387 | Ga0207677_100183875 | 287 |
| 563 | 3300026041 | Ga0207639_10396638 | Ga0207639_103966381 | 287 |
| 564 | 3300026067 | Ga0207678_10013503 | Ga0207678_100135034 | 287 |
| 565 | 3300026067 | Ga0207678_10237683 | Ga0207678_102376832 | 287 |
| 566 | 3300026078 | Ga0207702_10026475 | Ga0207702_100264752 | 287 |
| 567 | 3300026088 | Ga0207641_10563222 | Ga0207641_105632222 | 287 |
| 568 | 3300026089 | Ga0207648_10013112 | Ga0207648_100131126 | 287 |
| 569 | 3300026089 | Ga0207648_10041074 | Ga0207648_100410743 | 287 |
| 570 | 3300026089 | Ga0207648_10073681 | Ga0207648_100736812 | 287 |
| 571 | 3300026116 | Ga0207674_10004031 | Ga0207674_1000403111 | 287 |
| 572 | 3300026116 | Ga0207674_10216902 | Ga0207674_102169021 | 287 |
| 573 | 3300026121 | Ga0207683_10025467 | Ga0207683_100254674 | 287 |
| 574 | 3300026121 | Ga0207683_10176207 | Ga0207683_101762072 | 287 |
| 575 | 3300028381 | Ga0268264_10008474 | Ga0268264_100084749 | 287 |
| 576 | 3300028381 | Ga0268264_10350200 | Ga0268264_103502002 | 287 |
| 577 | 3300028381 | Ga0268264_10795965 | Ga0268264_107959651 | 287 |
| 578 | 3300031251 | Ga0265327_10031686 | Ga0265327_100316866 | 287 |
| 579 | 3300031456 | Ga0307513_10112285 | Ga0307513_101122852 | 287 |
| 580 | 3300031507 | Ga0307509_10015498 | Ga0307509_100154986 | 287 |
| 581 | 3300031838 | Ga0307518_10139407 | Ga0307518_101394071 | 287 |
| 582 | 3300036401 | Ga0373937_0006671 | Ga0373937_0006671_933_1796 | 287 |
| 583 | 3300037312 | Ga0395899_0017226 | Ga0395899_0017226_4361_5233 | 287 |
| 584 | 3300037418 | Ga0395900_0059235 | Ga0395900_0059235_2739_3602 | 287 |
| 585 | 3300037466 | Ga0395898_0013466 | Ga0395898_0013466_3351_4223 | 287 |
| 586 | 3300037471 | Ga0395905_0070300 | Ga0395905_0070300_1670_2578 | 287 |
| 587 | 3300038443 | Ga0395901_0028050 | Ga0395901_0028050_1175_2047 | 287 |
| 588 | 3300039437 | Ga0436365_0927657 | Ga0436365_0927657_256_1131 | 287 |
| 589 | 3300044658 | Ga0466972_0019573 | Ga0466972_0019573_498_1361 | 287 |
| 590 | 3300046511 | Ga0495608_0067439 | Ga0495608_0067439_1319_2182 | 287 |
| 591 | 3300046516 | Ga0495628_0022064 | Ga0495628_0022064_3949_4812 | 287 |
| 592 | 3300046517 | Ga0495630_0011846 | Ga0495630_0011846_2524_3387 | 287 |
| 593 | 3300046535 | Ga0495586_0009224 | Ga0495586_0009224_1552_2415 | 287 |
| 594 | 3300046809 | Ga0495600_0133662 | Ga0495600_0133662_10_873 | 287 |
| 595 | 3300047317 | Ga0495604_0290160 | Ga0495604_0290160_196_1059 | 287 |
| 596 | 3300047322 | Ga0495680_0037499 | Ga0495680_0037499_2863_3726 | 287 |
| 597 | 3300048913 | Ga0496110_0019814 | Ga0496110_0019814_2368_3270 | 287 |
| 598 | 3300049571 | Ga0501034_0037661 | Ga0501034_0037661_345_1211 | 287 |
| 599 | 3300049573 | Ga0501037_0080762 | Ga0501037_0080762_685_1551 | 287 |
| 600 | 3300049574 | Ga0501038_0059187 | Ga0501038_0059187_1468_2334 | 287 |
| 601 | 3300049575 | Ga0501039_0029118 | Ga0501039_0029118_3206_4072 | 287 |
| 602 | 3300049579 | Ga0501043_0003072 | Ga0501043_0003072_6382_7248 | 287 |
| 603 | 3300049581 | Ga0501047_0010118 | Ga0501047_0010118_4780_5646 | 287 |
| 604 | 3300049581 | Ga0501047_0188923 | Ga0501047_0188923_566_1429 | 287 |
| 605 | 3300049822 | Ga0501035_0016138 | Ga0501035_0016138_159_1025 | 287 |
| 606 | 3300050510 | nmdc:mga06r32_200583_c1 | nmdc:mga06r32_200583_c1_89_952 | 287 |
| 607 | 3300053153 | Ga0500616_0006698 | Ga0500616_0006698_4505_5377 | 287 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4tq6-assembly1.cif.gz_A | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.7373 | 9 | 282 |
| 4tq4-assembly3.cif.gz_C | structure of a ubia homolog from archaeoglobus fulgidus bound to dmapp and mg2+ | 0.7294 | 5 | 282 |
| 4tq3-assembly1.cif.gz_A | structure of a ubia homolog from archaeoglobus fulgidus bound to gpp and mg2+ | 0.7266 | 5 | 282 |
| 4tq6-assembly1.cif.gz_A | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.7204 | 9 | 282 |
| 4tq3-assembly1.cif.gz_A | structure of a ubia homolog from archaeoglobus fulgidus bound to gpp and mg2+ | 0.7144 | 5 | 282 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_C6KSS3_382_506_1.20.120.1780 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);UbiA prenyltransferase | 0.8192 | 160 | 286 | 1.20.120.1780 |
| af_P0AGK1_170_289_1.20.120.1780 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);UbiA prenyltransferase | 0.8061 | 159 | 287 | 1.20.120.1780 |
| af_P0AGK1_170_289_1.20.120.1780 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);UbiA prenyltransferase | 0.8003 | 159 | 287 | 1.20.120.1780 |
| af_Q2FZM0_17_182_1.10.357.140 | Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase | 0.7832 | 9 | 149 | 1.10.357.140 |
| af_A0A0R0IQ72_105_369_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 0.7743 | 20 | 265 | 1.20.1070.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1G3J558-F1-model_v4 | Prenyltransferase | 0.998 | 2 | 287 |
GO:0016020
GO:0016765 |
| AF-G8TIE5-F1-model_v4 | UbiA prenyltransferase | 0.9977 | 1 | 287 |
GO:0016020
GO:0016765 |
| AF-A0A0C1IF90-F1-model_v4 | Prenyltransferase | 0.9977 | 1 | 287 |
GO:0016020
GO:0016765 |
| AF-A0A0C1IEE0-F1-model_v4 | UbiA prenyltransferase | 0.9968 | 1 | 287 |
GO:0016020
GO:0016765 |
| AF-A0A1G3J558-F1-model_v4 | Prenyltransferase | 0.9946 | 2 | 287 |
GO:0016020
GO:0016765 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar