F468683

General Info

Members Datasets Scaffolds Average Seq Length
607 241 605 284

Family's Representative Sequence

Representative Sequence 3300013102|Ga0157371_10000284|Ga0157371_1000028430
Length 337
Sequence MNPKSPFSNRRKTKNGFFWRFYRNNNFRITPKHVFPNLYLKKIVLNLIVNKKLQSTFQLLRFHFSFFLMPVYWFALSQVKNINWFNAILIFFILHLLVYPASNGYNSYMDRDTSSVGGIKNPKVPTKQLFYFTVVMDIIAVALSVIISYIFAIGIFFYILASRAYSYRKIRLKKYPVIGYLTVIIFQGAVTFFLVYHGSSGNHSFGIHVLPMVASALLIGGFYPLTQIYQHEEDRKDGVTSLSYLLGYKGTFIFTGIVYASAFIVLGWYFYLQIMFLDFIVLQIFMLPVIVYFFIWFKKVTKNNDEANFKNTMRMNILASACSNLGFITLLILKMFE

Samples

Sample ID Description Type Environment
1 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
2 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
11 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
12 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
13 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
14 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
104 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
105 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
106 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
110 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
162 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
165 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
166 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
167 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
168 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
169 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
170 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
171 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
172 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
173 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
174 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
175 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
176 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
177 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
178 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
179 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
180 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
182 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
183 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
184 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
185 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
186 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
187 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
188 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
189 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
190 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
191 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
192 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
193 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
194 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
195 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
196 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
197 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
198 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
199 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
200 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
201 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
202 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
203 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
204 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
205 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
206 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
207 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
214 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
215 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
216 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
217 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
218 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
219 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
220 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
221 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
222 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
223 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
224 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
225 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
226 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
227 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
228 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
229 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
230 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
232 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
233 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
234 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
235 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
236 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
237 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
238 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
239 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
240 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
241 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.67
Metatranscriptomes 0
Isolates 0.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.95
Nodule 0
Rhizoplane 0.49
Rhizosphere 91.76
Stem 0
Stem Tuber 0
Unclassified 3.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARcpr5yngRDRAFT_c003927 3300000043 Bacteria 1431
2 JGI24740J21852_10000409 3300001979 Bacteria 18403
3 JGI25154J39366_1000031 3300002738 Bacteria 190814
4 JGI25153J46596_10005563 3300003215 Bacteria 6586
5 JGI25153J46596_10009336 3300003215 Unclassified 4578
6 rootH1_10028021 3300003316 Bacteria 3452
7 rootH1_10070184 3300003316 Unclassified 2366
8 rootH2_10009982 3300003320 Bacteria 25986
9 rootH2_10076618 3300003320 Bacteria 3411
10 rootL2_10028177 3300003322 Bacteria 2048
11 rootL2_10145242 3300003322 Bacteria 2359
12 rootL2_10247536 3300003322 Bacteria 1132
13 rootH1_10116572 3300003323 Bacteria 3812
14 rootH1_10123253 3300003323 Bacteria 5109
15 JGI25160J50197_1000941 3300003354 Bacteria 15269
16 JGI25160J50197_1006108 3300003354 Bacteria 4913
17 Ga0055526_1012091 3300003771 Bacteria 3808
18 Ga0055528_1001378 3300003790 Bacteria 14923
19 Ga0055530_10002564 3300003791 Bacteria 11538
20 Ga0055543_1018775 3300004625 Bacteria 1286
21 Ga0065165_1002242 3300005262 Bacteria 17168
22 Ga0070658_10001648 3300005327 Bacteria 18875
23 Ga0070658_10081792 3300005327 Bacteria 2653
24 Ga0070658_10160350 3300005327 Bacteria 1887
25 Ga0070676_10000489 3300005328 Bacteria 18890
26 Ga0070676_10004865 3300005328 Bacteria 7113
27 Ga0070676_10005268 3300005328 Bacteria 6876
28 Ga0070676_10400885 3300005328 Bacteria 954
29 Ga0070683_100040688 3300005329 Bacteria 4274
30 Ga0070690_100047878 3300005330 Bacteria 2721
31 Ga0070690_100278511 3300005330 Bacteria 1192
32 Ga0070670_100053373 3300005331 Unclassified 3471
33 Ga0070670_100058021 3300005331 Bacteria 3323
34 Ga0070677_10042946 3300005333 Unclassified 1793
35 Ga0068869_100011325 3300005334 Bacteria 5844
36 Ga0068869_100071604 3300005334 Unclassified 2567
37 Ga0068869_100108650 3300005334 Unclassified 2108
38 Ga0068869_100372887 3300005334 Bacteria 1168
39 Ga0070666_10000031 3300005335 Bacteria 132089
40 Ga0070666_10092331 3300005335 Bacteria 2081
41 Ga0070680_100005567 3300005336 Bacteria 9537
42 Ga0070680_100008782 3300005336 Bacteria 7752
43 Ga0070682_100002866 3300005337 Bacteria 9563
44 Ga0070682_100181005 3300005337 Bacteria 1472
45 Ga0070682_100278342 3300005337 Bacteria 1218
46 Ga0068868_100000187 3300005338 Bacteria 41327
47 Ga0068868_100000427 3300005338 Bacteria 28309
48 Ga0068868_100003257 3300005338 Bacteria 11304
49 Ga0068868_100082494 3300005338 Bacteria 2578
50 Ga0068868_100128787 3300005338 Bacteria 2070
51 Ga0068868_100148261 3300005338 Bacteria 1930
52 Ga0070660_100001959 3300005339 Bacteria 14198
53 Ga0070660_100013641 3300005339 Bacteria 5839
54 Ga0070660_100037847 3300005339 Bacteria 3658
55 Ga0070660_100048944 3300005339 Bacteria 3247
56 Ga0070691_10006430 3300005341 Bacteria 5370
57 Ga0070691_10088105 3300005341 Bacteria 1527
58 Ga0070661_100002315 3300005344 Bacteria 13085
59 Ga0070661_100047630 3300005344 Bacteria 3138
60 Ga0070661_100209652 3300005344 Bacteria 1491
61 Ga0070692_10087061 3300005345 Bacteria 1692
62 Ga0070668_100003714 3300005347 Bacteria 11263
63 Ga0070668_100027163 3300005347 Bacteria 4344
64 Ga0070668_100313498 3300005347 Bacteria 1319
65 Ga0070669_100449076 3300005353 Bacteria 1062
66 Ga0070675_100035460 3300005354 Unclassified 4054
67 Ga0070675_100064519 3300005354 Bacteria 3028
68 Ga0070675_100110972 3300005354 Bacteria 2320
69 Ga0070671_100121363 3300005355 Bacteria 2200
70 Ga0070671_100221765 3300005355 Bacteria 1604
71 Ga0070671_100238505 3300005355 Bacteria 1544
72 Ga0070674_100007803 3300005356 Bacteria 6327
73 Ga0070674_100339814 3300005356 Bacteria 1209
74 Ga0070673_100000124 3300005364 Bacteria 35840
75 Ga0070673_100022372 3300005364 Unclassified 4600
76 Ga0070673_100070512 3300005364 Bacteria 2805
77 Ga0070673_100207215 3300005364 Bacteria 1691
78 Ga0070673_100346412 3300005364 Bacteria 1318
79 Ga0070673_100355710 3300005364 Bacteria 1301
80 Ga0070659_100003555 3300005366 Bacteria 11096
81 Ga0070659_100028329 3300005366 Bacteria 4324
82 Ga0070659_100087565 3300005366 Bacteria 2493
83 Ga0070659_100328513 3300005366 Bacteria 1279
84 Ga0070667_100000980 3300005367 Bacteria 26248
85 Ga0070667_100007822 3300005367 Bacteria 8866
86 Ga0070667_100011432 3300005367 Bacteria 7340
87 Ga0070667_100174060 3300005367 Unclassified 1901
88 Ga0070701_10095774 3300005438 Bacteria 1635
89 Ga0070701_10302166 3300005438 Bacteria 984
90 Ga0070663_100547125 3300005455 Bacteria 967
91 Ga0070678_100007411 3300005456 Bacteria 6505
92 Ga0070678_100057194 3300005456 Bacteria 2856
93 Ga0070678_100308276 3300005456 Bacteria 1348
94 Ga0070662_100002199 3300005457 Bacteria 11964
95 Ga0070662_100009734 3300005457 Bacteria 6292
96 Ga0070662_100010835 3300005457 Bacteria 6003
97 Ga0070662_100011948 3300005457 Bacteria 5742
98 Ga0070662_100130026 3300005457 Bacteria 1940
99 Ga0070662_100210733 3300005457 Bacteria 1546
100 Ga0070662_100473921 3300005457 Unclassified 1041
101 Ga0070681_10023031 3300005458 Bacteria 6262
102 Ga0070681_10077245 3300005458 Bacteria 3288
103 Ga0070681_10147631 3300005458 Unclassified 2279
104 Ga0070681_10208487 3300005458 Bacteria 1871
105 Ga0068867_100002368 3300005459 Bacteria 13255
106 Ga0068867_100003400 3300005459 Bacteria 11202
107 Ga0068867_100028878 3300005459 Bacteria 3994
108 Ga0068867_100066748 3300005459 Unclassified 2680
109 Ga0068867_100080730 3300005459 Bacteria 2450
110 Ga0070685_10049557 3300005466 Bacteria 2423
111 Ga0070685_10076045 3300005466 Bacteria 2002
112 Ga0070685_10302072 3300005466 Bacteria 1079
113 Ga0070707_100351801 3300005468 Bacteria 1431
114 Ga0070679_100003309 3300005530 Bacteria 14759
115 Ga0070679_100026672 3300005530 Bacteria 5681
116 Ga0070679_100321858 3300005530 Bacteria 1496
117 Ga0070684_100001198 3300005535 Bacteria 18634
118 Ga0070684_100004469 3300005535 Bacteria 10650
119 Ga0070684_100049157 3300005535 Bacteria 3659
120 Ga0070684_100281219 3300005535 Bacteria 1524
121 Ga0070684_100507321 3300005535 Unclassified 1117
122 Ga0068853_100002569 3300005539 Bacteria 13648
123 Ga0068853_100002879 3300005539 Bacteria 13060
124 Ga0068853_100010908 3300005539 Bacteria 7363
125 Ga0068853_100231375 3300005539 Unclassified 1691
126 Ga0068853_100259861 3300005539 Bacteria 1596
127 Ga0068853_100635687 3300005539 Bacteria 1015
128 Ga0070672_100000105 3300005543 Bacteria 41868
129 Ga0070672_100096093 3300005543 Bacteria 2397
130 Ga0070672_100114098 3300005543 Bacteria 2205
131 Ga0070672_100291040 3300005543 Bacteria 1383
132 Ga0070686_100001965 3300005544 Bacteria 11413
133 Ga0070693_100004189 3300005547 Bacteria 6810
134 Ga0070665_100000018 3300005548 Bacteria 434118
135 Ga0070665_100000635 3300005548 Bacteria 47836
136 Ga0070665_100076193 3300005548 Unclassified 3361
137 Ga0070665_100130947 3300005548 Bacteria 2511
138 Ga0068855_100007383 3300005563 Bacteria 13306
139 Ga0068855_100019495 3300005563 Bacteria 8151
140 Ga0068855_100031575 3300005563 Bacteria 6325
141 Ga0068855_100045431 3300005563 Bacteria 5196
142 Ga0068855_100079040 3300005563 Bacteria 3815
143 Ga0068855_100097871 3300005563 Unclassified 3380
144 Ga0068855_100144424 3300005563 Bacteria 2710
145 Ga0068855_100349166 3300005563 Bacteria 1630
146 Ga0070664_100006530 3300005564 Bacteria 9403
147 Ga0070664_100020320 3300005564 Bacteria 5467
148 Ga0070664_100083437 3300005564 Bacteria 2757
149 Ga0070664_100270073 3300005564 Bacteria 1532
150 Ga0070664_100366106 3300005564 Bacteria 1313
151 Ga0070664_100380197 3300005564 Bacteria 1289
152 Ga0068857_100000287 3300005577 Bacteria 34776
153 Ga0068857_100007841 3300005577 Bacteria 9207
154 Ga0068857_100011785 3300005577 Bacteria 7604
155 Ga0068857_100186221 3300005577 Bacteria 1890
156 Ga0068857_100213959 3300005577 Bacteria 1759
157 Ga0068857_100219479 3300005577 Bacteria 1736
158 Ga0068854_100010687 3300005578 Bacteria 5958
159 Ga0068854_100026109 3300005578 Bacteria 4012
160 Ga0068854_100309376 3300005578 Bacteria 1281
161 Ga0068856_100044643 3300005614 Bacteria 4363
162 Ga0068856_100050966 3300005614 Bacteria 4081
163 Ga0068856_100075596 3300005614 Bacteria 3336
164 Ga0068856_100126812 3300005614 Bacteria 2556
165 Ga0068852_100008024 3300005616 Bacteria 7745
166 Ga0068852_100031900 3300005616 Bacteria 4356
167 Ga0068852_100044179 3300005616 Bacteria 3782
168 Ga0068852_100060810 3300005616 Bacteria 3280
169 Ga0068852_100098181 3300005616 Unclassified 2637
170 Ga0068852_100156239 3300005616 Unclassified 2125
171 Ga0068852_100157821 3300005616 Unclassified 2115
172 Ga0068859_100000045 3300005617 Bacteria 143607
173 Ga0068859_100026115 3300005617 Bacteria 5858
174 Ga0068859_100049476 3300005617 Bacteria 4221
175 Ga0068859_100220111 3300005617 Bacteria 1986
176 Ga0068859_100475765 3300005617 Bacteria 1345
177 Ga0068864_100001254 3300005618 Bacteria 21079
178 Ga0068864_100001485 3300005618 Bacteria 19316
179 Ga0068864_100161078 3300005618 Unclassified 2040
180 Ga0068864_100480800 3300005618 Bacteria 1192
181 Ga0068866_10070600 3300005718 Bacteria 1844
182 Ga0068861_100201581 3300005719 Unclassified 1670
183 Ga0068861_100422216 3300005719 Bacteria 1188
184 Ga0068851_10000475 3300005834 Bacteria 17677
185 Ga0068851_10008746 3300005834 Bacteria 4691
186 Ga0068851_10063590 3300005834 Bacteria 1895
187 Ga0068851_10073973 3300005834 Bacteria 1768
188 Ga0068863_100002352 3300005841 Bacteria 18798
189 Ga0068863_100005370 3300005841 Bacteria 12635
190 Ga0068863_100083560 3300005841 Bacteria 3026
191 Ga0068863_100561491 3300005841 Bacteria 1128
192 Ga0068863_100595920 3300005841 Bacteria 1093
193 Ga0068858_100003543 3300005842 Bacteria 15456
194 Ga0068858_100476066 3300005842 Bacteria 1205
195 Ga0068858_100538290 3300005842 Bacteria 1130
196 Ga0068860_100001418 3300005843 Bacteria 25953
197 Ga0068860_100008301 3300005843 Bacteria 10335
198 Ga0068860_100018642 3300005843 Bacteria 6750
199 Ga0068860_100039499 3300005843 Unclassified 4514
200 Ga0068860_100076409 3300005843 Unclassified 3185
201 Ga0068860_100220951 3300005843 Bacteria 1840
202 Ga0068860_100576537 3300005843 Bacteria 1129
203 Ga0068862_100052368 3300005844 Bacteria 3492
204 Ga0068862_100241903 3300005844 Bacteria 1641
205 Ga0075366_10077696 3300006195 Bacteria 1981
206 Ga0075366_10086190 3300006195 Bacteria 1879
207 Ga0097621_100000499 3300006237 Bacteria 27492
208 Ga0097621_100007453 3300006237 Bacteria 7827
209 Ga0097621_100035931 3300006237 Unclassified 3960
210 Ga0097621_100193579 3300006237 Bacteria 1762
211 Ga0068871_100002567 3300006358 Bacteria 12404
212 Ga0068871_100008100 3300006358 Bacteria 7544
213 Ga0068871_100131671 3300006358 Bacteria 2121
214 Ga0068871_100228898 3300006358 Bacteria 1613
215 Ga0068871_100535463 3300006358 Unclassified 1059
216 Ga0075428_100023898 3300006844 Bacteria 6763
217 Ga0075430_100018099 3300006846 Bacteria 5996
218 Ga0075434_100009056 3300006871 Bacteria 9272
219 Ga0075429_100014092 3300006880 Bacteria 6927
220 Ga0068865_100001094 3300006881 Bacteria 15637
221 Ga0068865_100006917 3300006881 Bacteria 6954
222 Ga0068865_100016931 3300006881 Bacteria 4677
223 Ga0068865_100208891 3300006881 Unclassified 1520
224 Ga0097620_100000045 3300006931 Bacteria 143607
225 Ga0097620_100026115 3300006931 Bacteria 5858
226 Ga0097620_100049476 3300006931 Bacteria 4221
227 Ga0097620_100220098 3300006931 Bacteria 1986
228 Ga0097620_100475764 3300006931 Bacteria 1345
229 Ga0105240_10000472 3300009093 Bacteria 74359
230 Ga0105240_10009860 3300009093 Bacteria 13483
231 Ga0105240_10019870 3300009093 Bacteria 8972
232 Ga0105240_10022478 3300009093 Bacteria 8358
233 Ga0105240_10097824 3300009093 Unclassified 3575
234 Ga0105240_10154276 3300009093 Unclassified 2733
235 Ga0111539_10073279 3300009094 Bacteria 4038
236 Ga0105247_10003520 3300009101 Bacteria 10181
237 Ga0105247_10033980 3300009101 Bacteria 3105
238 Ga0105243_10109968 3300009148 Bacteria 2304
239 Ga0105243_10589518 3300009148 Bacteria 1068
240 Ga0105241_10000985 3300009174 Bacteria 21588
241 Ga0105241_10001733 3300009174 Bacteria 16555
242 Ga0105241_10006485 3300009174 Bacteria 8628
243 Ga0105241_10006681 3300009174 Bacteria 8489
244 Ga0105241_10068382 3300009174 Bacteria 2752
245 Ga0105241_10219785 3300009174 Unclassified 1596
246 Ga0105241_10251282 3300009174 Bacteria 1499
247 Ga0105241_10295272 3300009174 Bacteria 1389
248 Ga0105242_10010544 3300009176 Bacteria 7096
249 Ga0105242_10020808 3300009176 Bacteria 5146
250 Ga0105242_10564478 3300009176 Unclassified 1093
251 Ga0105248_10022859 3300009177 Bacteria 6942
252 Ga0105248_10151001 3300009177 Bacteria 2621
253 Ga0105237_10001767 3300009545 Bacteria 27942
254 Ga0105237_10054400 3300009545 Bacteria 4010
255 Ga0105237_10060266 3300009545 Unclassified 3797
256 Ga0105237_10317901 3300009545 Bacteria 1560
257 Ga0105237_10360118 3300009545 Bacteria 1459
258 Ga0105237_10415685 3300009545 Bacteria 1350
259 Ga0105238_10002017 3300009551 Bacteria 20488
260 Ga0105238_10041527 3300009551 Bacteria 4658
261 Ga0105238_10159680 3300009551 Bacteria 2230
262 Ga0105249_10011083 3300009553 Bacteria 7922
263 Ga0105249_10085265 3300009553 Unclassified 2943
264 Ga0105249_10339243 3300009553 Bacteria 1519
265 Ga0105239_10001180 3300010375 Bacteria 35825
266 Ga0157373_10009844 3300013100 Bacteria 7047
267 Ga0157373_10031382 3300013100 Bacteria 3825
268 Ga0157373_10067784 3300013100 Bacteria 2523
269 Ga0157373_10164397 3300013100 Bacteria 1562
270 Ga0157371_10000284 3300013102 Bacteria 68549
271 Ga0157371_10000725 3300013102 Bacteria 38633
272 Ga0157371_10016390 3300013102 Bacteria 5531
273 Ga0157371_10032796 3300013102 Unclassified 3735
274 Ga0157371_10158586 3300013102 Bacteria 1615
275 Ga0157371_10208211 3300013102 Bacteria 1403
276 Ga0157370_10004751 3300013104 Bacteria 15462
277 Ga0157370_10009358 3300013104 Bacteria 10483
278 Ga0157370_10021147 3300013104 Bacteria 6488
279 Ga0157370_10157853 3300013104 Bacteria 2110
280 Ga0157369_10073809 3300013105 Bacteria 3659
281 Ga0157369_10082252 3300013105 Bacteria 3445
282 Ga0157374_10000260 3300013296 Bacteria 48732
283 Ga0157374_10002980 3300013296 Bacteria 14179
284 Ga0157374_10027083 3300013296 Bacteria 5166
285 Ga0157374_10051644 3300013296 Bacteria 3826
286 Ga0157374_10079023 3300013296 Bacteria 3116
287 Ga0157378_10003039 3300013297 Bacteria 14913
288 Ga0157378_10010672 3300013297 Bacteria 8026
289 Ga0157378_10012828 3300013297 Bacteria 7335
290 Ga0157378_10013251 3300013297 Bacteria 7209
291 Ga0157378_10071685 3300013297 Bacteria 3112
292 Ga0157378_10328610 3300013297 Bacteria 1487
293 Ga0163162_10000312 3300013306 Bacteria 45022
294 Ga0163162_10001336 3300013306 Bacteria 23007
295 Ga0163162_10001523 3300013306 Bacteria 21599
296 Ga0163162_10004258 3300013306 Bacteria 13763
297 Ga0163162_10022439 3300013306 Bacteria 6218
298 Ga0163162_10074114 3300013306 Bacteria 3462
299 Ga0163162_10074490 3300013306 Bacteria 3454
300 Ga0157372_10000741 3300013307 Bacteria 35589
301 Ga0157372_10018758 3300013307 Bacteria 7443
302 Ga0157372_10023974 3300013307 Bacteria 6620
303 Ga0157372_10094440 3300013307 Bacteria 3405
304 Ga0157372_10113180 3300013307 Bacteria 3110
305 Ga0157372_10167842 3300013307 Bacteria 2538
306 Ga0157372_10186876 3300013307 Bacteria 2399
307 Ga0157372_10195909 3300013307 Bacteria 2340
308 Ga0157372_10201832 3300013307 Bacteria 2303
309 Ga0157372_10211924 3300013307 Unclassified 2245
310 Ga0157372_10223170 3300013307 Bacteria 2184
311 Ga0157372_10234475 3300013307 Bacteria 2128
312 Ga0157372_10245818 3300013307 Unclassified 2076
313 Ga0157372_10299321 3300013307 Bacteria 1871
314 Ga0157372_10410828 3300013307 Unclassified 1577
315 Ga0157372_10563121 3300013307 Bacteria 1328
316 Ga0157375_10000686 3300013308 Bacteria 29989
317 Ga0157375_10002871 3300013308 Bacteria 14932
318 Ga0157375_10010009 3300013308 Bacteria 8337
319 Ga0157375_10478217 3300013308 Bacteria 1411
320 Ga0163163_10000346 3300014325 Bacteria 44619
321 Ga0163163_10135642 3300014325 Bacteria 2502
322 Ga0163163_10495187 3300014325 Bacteria 1284
323 Ga0157377_10017063 3300014745 Unclassified 3750
324 Ga0157379_10000242 3300014968 Bacteria 42795
325 Ga0157379_10011127 3300014968 Bacteria 7844
326 Ga0157379_10032372 3300014968 Bacteria 4662
327 Ga0157379_10052461 3300014968 Bacteria 3643
328 Ga0157379_10179209 3300014968 Bacteria 1914
329 Ga0157376_10001139 3300014969 Bacteria 17447
330 Ga0157376_10085547 3300014969 Unclassified 2717
331 Ga0157376_10192255 3300014969 Bacteria 1872
332 Ga0157376_10394225 3300014969 Bacteria 1337
333 Ga0163161_10034025 3300017792 Bacteria 3644
334 Ga0163161_10128416 3300017792 Bacteria 1910
335 Ga0213876_10037551 3300021384 Unclassified 2555
336 Ga0209646_1000009 3300025246 Bacteria 652154
337 Ga0209026_1000396 3300025250 Bacteria 38774
338 Ga0209673_1000016 3300025273 Bacteria 506202
339 Ga0209564_1004934 3300025295 Bacteria 7886
340 Ga0209050_1000124 3300025298 Bacteria 194022
341 Ga0207426_1000211 3300025302 Bacteria 137322
342 Ga0207426_1000339 3300025302 Bacteria 87978
343 Ga0209257_1000658 3300025304 Bacteria 54552
344 Ga0207697_10009658 3300025315 Unclassified 4156
345 Ga0207656_10023113 3300025321 Bacteria 2500
346 Ga0207656_10050990 3300025321 Bacteria 1789
347 Ga0207642_10054151 3300025899 Bacteria 1829
348 Ga0207688_10030435 3300025901 Unclassified 2976
349 Ga0207680_10000141 3300025903 Bacteria 34433
350 Ga0207680_10076151 3300025903 Bacteria 2095
351 Ga0207647_10002819 3300025904 Bacteria 13115
352 Ga0207647_10027231 3300025904 Bacteria 3729
353 Ga0207645_10001794 3300025907 Bacteria 17325
354 Ga0207645_10040449 3300025907 Bacteria 2985
355 Ga0207645_10054686 3300025907 Bacteria 2549
356 Ga0207705_10007257 3300025909 Bacteria 8155
357 Ga0207705_10043803 3300025909 Bacteria 3215
358 Ga0207654_10057810 3300025911 Bacteria 2255
359 Ga0207654_10271483 3300025911 Unclassified 1144
360 Ga0207654_10306619 3300025911 Bacteria 1081
361 Ga0207695_10001688 3300025913 Bacteria 35472
362 Ga0207695_10004070 3300025913 Bacteria 20110
363 Ga0207695_10028517 3300025913 Bacteria 6188
364 Ga0207695_10059033 3300025913 Bacteria 3980
365 Ga0207695_10064026 3300025913 Unclassified 3788
366 Ga0207695_10106388 3300025913 Unclassified 2791
367 Ga0207671_10011688 3300025914 Bacteria 7117
368 Ga0207671_10011870 3300025914 Bacteria 7049
369 Ga0207671_10142434 3300025914 Bacteria 1848
370 Ga0207671_10209971 3300025914 Bacteria 1522
371 Ga0207671_10236354 3300025914 Bacteria 1434
372 Ga0207660_10005510 3300025917 Bacteria 8222
373 Ga0207660_10041338 3300025917 Unclassified 3230
374 Ga0207657_10009181 3300025919 Bacteria 9972
375 Ga0207657_10023896 3300025919 Bacteria 5676
376 Ga0207657_10134061 3300025919 Bacteria 2028
377 Ga0207657_10192301 3300025919 Bacteria 1645
378 Ga0207657_10340403 3300025919 Bacteria 1184
379 Ga0207649_10021026 3300025920 Bacteria 3749
380 Ga0207649_10026846 3300025920 Bacteria 3372
381 Ga0207652_10000045 3300025921 Bacteria 125343
382 Ga0207652_10000214 3300025921 Bacteria 61294
383 Ga0207652_10008710 3300025921 Bacteria 8165
384 Ga0207652_10016246 3300025921 Bacteria 6073
385 Ga0207652_10035250 3300025921 Bacteria 4222
386 Ga0207652_10236324 3300025921 Bacteria 1647
387 Ga0207681_10011577 3300025923 Bacteria 5419
388 Ga0207681_10017517 3300025923 Unclassified 4499
389 Ga0207681_10280009 3300025923 Bacteria 1313
390 Ga0207681_10325805 3300025923 Bacteria 1223
391 Ga0207650_10002954 3300025925 Bacteria 11729
392 Ga0207650_10288149 3300025925 Bacteria 1338
393 Ga0207659_10035806 3300025926 Bacteria 3434
394 Ga0207659_10096132 3300025926 Bacteria 2223
395 Ga0207687_10137272 3300025927 Bacteria 1851
396 Ga0207644_10008911 3300025931 Bacteria 6573
397 Ga0207644_10036096 3300025931 Unclassified 3468
398 Ga0207644_10041431 3300025931 Bacteria 3258
399 Ga0207644_10044110 3300025931 Bacteria 3167
400 Ga0207644_10198329 3300025931 Bacteria 1582
401 Ga0207690_10011163 3300025932 Bacteria 5361
402 Ga0207706_10003994 3300025933 Bacteria 13976
403 Ga0207706_10007275 3300025933 Bacteria 10234
404 Ga0207706_10059068 3300025933 Bacteria 3378
405 Ga0207706_10061177 3300025933 Bacteria 3316
406 Ga0207686_10050058 3300025934 Unclassified 2597
407 Ga0207686_10245279 3300025934 Bacteria 1306
408 Ga0207670_10070587 3300025936 Bacteria 2413
409 Ga0207669_10096141 3300025937 Bacteria 1943
410 Ga0207704_10000562 3300025938 Bacteria 16547
411 Ga0207704_10187715 3300025938 Bacteria 1500
412 Ga0207691_10000012 3300025940 Bacteria 147942
413 Ga0207691_10004759 3300025940 Bacteria 13125
414 Ga0207691_10088274 3300025940 Unclassified 2781
415 Ga0207691_10108794 3300025940 Bacteria 2467
416 Ga0207691_10216348 3300025940 Unclassified 1662
417 Ga0207691_10224567 3300025940 Bacteria 1628
418 Ga0207711_10324337 3300025941 Unclassified 1424
419 Ga0207689_10008936 3300025942 Bacteria 8687
420 Ga0207689_10009466 3300025942 Bacteria 8410
421 Ga0207689_10018137 3300025942 Bacteria 5944
422 Ga0207689_10030002 3300025942 Bacteria 4534
423 Ga0207689_10070533 3300025942 Bacteria 2871
424 Ga0207689_10138065 3300025942 Unclassified 2007
425 Ga0207689_10213690 3300025942 Bacteria 1594
426 Ga0207661_10003108 3300025944 Bacteria 11489
427 Ga0207661_10152076 3300025944 Unclassified 2001
428 Ga0207679_10004210 3300025945 Bacteria 8939
429 Ga0207679_10017260 3300025945 Unclassified 4811
430 Ga0207667_10000643 3300025949 Bacteria 45271
431 Ga0207667_10034450 3300025949 Bacteria 5437
432 Ga0207667_10045123 3300025949 Bacteria 4669
433 Ga0207667_10083216 3300025949 Bacteria 3313
434 Ga0207667_10097434 3300025949 Unclassified 3035
435 Ga0207667_10132420 3300025949 Bacteria 2568
436 Ga0207667_10175197 3300025949 Bacteria 2204
437 Ga0207651_10000216 3300025960 Bacteria 24808
438 Ga0207651_10240143 3300025960 Bacteria 1476
439 Ga0207651_10354520 3300025960 Bacteria 1236
440 Ga0207712_10010440 3300025961 Bacteria 5896
441 Ga0207668_10001361 3300025972 Bacteria 14445
442 Ga0207668_10054223 3300025972 Bacteria 2782
443 Ga0207640_10015769 3300025981 Bacteria 4380
444 Ga0207640_10048773 3300025981 Bacteria 2739
445 Ga0207640_10109399 3300025981 Bacteria 1955
446 Ga0207658_10000374 3300025986 Bacteria 43784
447 Ga0207658_10008025 3300025986 Bacteria 7193
448 Ga0207658_10033838 3300025986 Unclassified 3648
449 Ga0207658_10050631 3300025986 Bacteria 3057
450 Ga0207658_10057016 3300025986 Bacteria 2901
451 Ga0207677_10000984 3300026023 Bacteria 15691
452 Ga0207677_10004993 3300026023 Bacteria 7161
453 Ga0207677_10018387 3300026023 Unclassified 4193
454 Ga0207677_10092119 3300026023 Unclassified 2206
455 Ga0207677_10280466 3300026023 Bacteria 1367
456 Ga0207703_10035352 3300026035 Bacteria 3970
457 Ga0207703_10278392 3300026035 Bacteria 1518
458 Ga0207703_10579352 3300026035 Bacteria 1060
459 Ga0207639_10002390 3300026041 Bacteria 12590
460 Ga0207639_10019277 3300026041 Bacteria 4863
461 Ga0207639_10081393 3300026041 Bacteria 2564
462 Ga0207639_10158079 3300026041 Bacteria 1907
463 Ga0207639_10396638 3300026041 Bacteria 1242
464 Ga0207639_10545805 3300026041 Bacteria 1064
465 Ga0207678_10013503 3300026067 Bacteria 7170
466 Ga0207678_10237683 3300026067 Bacteria 1560
467 Ga0207708_10341101 3300026075 Bacteria 1227
468 Ga0207702_10025199 3300026078 Bacteria 4936
469 Ga0207702_10026475 3300026078 Bacteria 4814
470 Ga0207702_10147988 3300026078 Bacteria 2133
471 Ga0207641_10000133 3300026088 Bacteria 109199
472 Ga0207641_10022535 3300026088 Bacteria 5183
473 Ga0207641_10460278 3300026088 Bacteria 1231
474 Ga0207641_10563222 3300026088 Bacteria 1112
475 Ga0207648_10010253 3300026089 Bacteria 8899
476 Ga0207648_10012892 3300026089 Bacteria 7806
477 Ga0207648_10013112 3300026089 Bacteria 7729
478 Ga0207648_10027821 3300026089 Bacteria 5016
479 Ga0207648_10041074 3300026089 Bacteria 4063
480 Ga0207648_10067242 3300026089 Bacteria 3125
481 Ga0207648_10073681 3300026089 Bacteria 2976
482 Ga0207648_10136340 3300026089 Bacteria 2162
483 Ga0207648_10169059 3300026089 Unclassified 1932
484 Ga0207676_10000697 3300026095 Bacteria 26479
485 Ga0207676_10155745 3300026095 Bacteria 1974
486 Ga0207674_10001630 3300026116 Bacteria 28871
487 Ga0207674_10004031 3300026116 Bacteria 17828
488 Ga0207674_10010211 3300026116 Bacteria 10664
489 Ga0207674_10015744 3300026116 Bacteria 8296
490 Ga0207674_10216902 3300026116 Bacteria 1862
491 Ga0207675_100005430 3300026118 Bacteria 12213
492 Ga0207675_100022342 3300026118 Bacteria 5891
493 Ga0207675_100174885 3300026118 Unclassified 2054
494 Ga0207683_10002013 3300026121 Bacteria 17984
495 Ga0207683_10025467 3300026121 Bacteria 5105
496 Ga0207683_10176207 3300026121 Bacteria 1938
497 Ga0207698_10009340 3300026142 Bacteria 6249
498 Ga0207698_10014863 3300026142 Bacteria 5190
499 Ga0207698_10097006 3300026142 Bacteria 2431
500 Ga0207698_10131542 3300026142 Unclassified 2139
501 Ga0207428_10062495 3300027907 Bacteria 2944
502 Ga0268266_10000026 3300028379 Bacteria 434485
503 Ga0268266_10005379 3300028379 Bacteria 11960
504 Ga0268266_10035267 3300028379 Unclassified 4255
505 Ga0268264_10000019 3300028381 Bacteria 488112
506 Ga0268264_10000054 3300028381 Bacteria 317048
507 Ga0268264_10003975 3300028381 Bacteria 12651
508 Ga0268264_10005188 3300028381 Bacteria 11030
509 Ga0268264_10008390 3300028381 Bacteria 8589
510 Ga0268264_10008474 3300028381 Bacteria 8550
511 Ga0268264_10008570 3300028381 Bacteria 8500
512 Ga0268264_10008865 3300028381 Bacteria 8337
513 Ga0268264_10107627 3300028381 Bacteria 2436
514 Ga0268264_10350200 3300028381 Bacteria 1406
515 Ga0268264_10795965 3300028381 Bacteria 944
516 Ga0307511_10000228 3300030521 Bacteria 57237
517 Ga0265327_10031686 3300031251 Bacteria 2967
518 Ga0307513_10112285 3300031456 Bacteria 2716
519 Ga0307513_10206813 3300031456 Bacteria 1798
520 Ga0307509_10015498 3300031507 Bacteria 8889
521 Ga0307516_10002314 3300031730 Bacteria 25651
522 Ga0307405_10005405 3300031731 Bacteria 6160
523 Ga0307413_10008468 3300031824 Bacteria 4858
524 Ga0307518_10139407 3300031838 Bacteria 1694
525 Ga0307410_10133568 3300031852 Bacteria 1826
526 Ga0307407_10103515 3300031903 Bacteria 1772
527 Ga0307412_10061446 3300031911 Bacteria 2526
528 Ga0307409_100062332 3300031995 Bacteria 2919
529 Ga0307416_100060439 3300032002 Bacteria 3086
530 Ga0307415_100035696 3300032126 Bacteria 3249
531 Ga0307510_10017333 3300033180 Bacteria 8497
532 Ga0373943_0182227 3300035170 Bacteria 1155
533 Ga0373937_0006671 3300036401 Bacteria 9965
534 Ga0395899_0017226 3300037312 Bacteria 5505
535 Ga0395899_0174223 3300037312 Unclassified 1513
536 Ga0395900_0059235 3300037418 Bacteria 3942
537 Ga0395900_0124935 3300037418 Unclassified 2638
538 Ga0395898_0013466 3300037466 Bacteria 8421
539 Ga0395905_0070300 3300037471 Unclassified 3280
540 Ga0395901_0028050 3300038443 Bacteria 5790
541 Ga0436365_0333717 3300039437 Bacteria 2970
542 Ga0436365_0927657 3300039437 Bacteria 1885
543 Ga0466972_0000016 3300044658 Bacteria 208802
544 Ga0466972_0009311 3300044658 Bacteria 4937
545 Ga0466972_0019573 3300044658 Bacteria 3384
546 Ga0466970_0003015 3300044765 Bacteria 8162
547 Ga0495638_0033016 3300046460 Bacteria 3311
548 Ga0495606_0003341 3300046507 Bacteria 17112
549 Ga0495608_0067439 3300046511 Bacteria 2340
550 Ga0495628_0022064 3300046516 Bacteria 5233
551 Ga0495630_0011846 3300046517 Bacteria 6319
552 Ga0495648_0002002 3300046524 Bacteria 19295
553 Ga0495640_0251125 3300046533 Bacteria 1108
554 Ga0495586_0009224 3300046535 Bacteria 5247
555 Ga0495600_0133662 3300046809 Bacteria 1612
556 Ga0495604_0290160 3300047317 Bacteria 1102
557 Ga0495672_0038837 3300047320 Unclassified 2900
558 Ga0495680_0037499 3300047322 Bacteria 3882
559 Ga0495687_000031 3300047443 Bacteria 274659
560 Ga0496101_0080185 3300048904 Bacteria 2411
561 Ga0496110_0019814 3300048913 Bacteria 5669
562 Ga0496114_0040216 3300048917 Bacteria 3870
563 Ga0501290_003419 3300049513 Bacteria 2003
564 Ga0501298_007964 3300049521 Bacteria 1770
565 Ga0501034_0000017 3300049571 Bacteria 285938
566 Ga0501034_0037661 3300049571 Bacteria 4898
567 Ga0501037_0080762 3300049573 Bacteria 2358
568 Ga0501037_0172262 3300049573 Unclassified 1538
569 Ga0501038_0059187 3300049574 Bacteria 3282
570 Ga0501039_0029118 3300049575 Bacteria 4253
571 Ga0501043_0003072 3300049579 Bacteria 13875
572 Ga0501047_0010118 3300049581 Bacteria 8917
573 Ga0501047_0188923 3300049581 Bacteria 1924
574 Ga0501070_0135800 3300049586 Unclassified 2031
575 Ga0501199_001778 3300049650 Bacteria 1977
576 Ga0501201_003219 3300049651 Bacteria 1496
577 Ga0501202_000819 3300049652 Bacteria 4691
578 Ga0501202_004538 3300049652 Bacteria 2433
579 Ga0501207_001587 3300049654 Bacteria 2855
580 Ga0501217_003847 3300049661 Bacteria 3054
581 Ga0501217_056499 3300049661 Bacteria 1038
582 Ga0501222_001204 3300049662 Bacteria 3652
583 Ga0501223_001850 3300049663 Bacteria 4780
584 Ga0501240_002479 3300049673 Bacteria 1965
585 Ga0501243_003490 3300049675 Bacteria 2329
586 Ga0501252_001200 3300049682 Bacteria 2325
587 Ga0501257_002646 3300049686 Bacteria 3780
588 Ga0501257_030754 3300049686 Bacteria 1293
589 Ga0501261_000533 3300049690 Bacteria 4847
590 Ga0501219_000159 3300049703 Bacteria 12350
591 Ga0501225_0005770 3300049705 Bacteria 3624
592 Ga0501234_003320 3300049707 Bacteria 2528
593 Ga0501266_006733 3300049763 Bacteria 1431
594 Ga0501035_0016138 3300049822 Bacteria 6892
595 Ga0501044_0048864 3300049823 Unclassified 4368
596 Ga0501284_00018 3300050005 Bacteria 93729
597 nmdc:mga06r32_200583_c1 3300050510 Bacteria 1983
598 nmdc:mga08y16_201809_c1 3300050511 Unclassified 2061
599 Ga0500583_0024874 3300053092 Bacteria 2547
600 Ga0500652_005381 3300053131 Bacteria 4026
601 Ga0500568_0024438 3300053139 Bacteria 2559
602 Ga0500616_0006698 3300053153 Bacteria 7477
603 Ga0500616_0026690 3300053153 Unclassified 3195
604 Ga0500622_0000926 3300053156 Bacteria 24930
605 Ga0500636_0053601 3300053177 Bacteria 2367

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013307 Ga0157372_10299321 Ga0157372_102993212 252
2 3300005458 Ga0070681_10208487 Ga0070681_102084872 253
3 3300026041 Ga0207639_10081393 Ga0207639_100813932 258
4 3300026116 Ga0207674_10015744 Ga0207674_100157444 258
5 3300005366 Ga0070659_100087565 Ga0070659_1000875652 259
6 3300025932 Ga0207690_10011163 Ga0207690_100111632 259
7 3300046533 Ga0495640_0251125 Ga0495640_0251125_194_973 259
8 3300005330 Ga0070690_100278511 Ga0070690_1002785111 260
9 3300005334 Ga0068869_100372887 Ga0068869_1003728871 260
10 3300005335 Ga0070666_10092331 Ga0070666_100923312 260
11 3300005337 Ga0070682_100002866 Ga0070682_10000286614 260
12 3300005338 Ga0068868_100082494 Ga0068868_1000824941 260
13 3300005339 Ga0070660_100037847 Ga0070660_1000378473 260
14 3300005344 Ga0070661_100047630 Ga0070661_1000476301 260
15 3300005355 Ga0070671_100221765 Ga0070671_1002217652 260
16 3300005364 Ga0070673_100207215 Ga0070673_1002072152 260
17 3300005366 Ga0070659_100028329 Ga0070659_1000283295 260
18 3300005457 Ga0070662_100002199 Ga0070662_1000021993 260
19 3300005530 Ga0070679_100321858 Ga0070679_1003218581 260
20 3300005535 Ga0070684_100281219 Ga0070684_1002812191 260
21 3300005563 Ga0068855_100079040 Ga0068855_1000790402 260
22 3300005614 Ga0068856_100050966 Ga0068856_1000509662 260
23 3300005616 Ga0068852_100060810 Ga0068852_1000608102 260
24 3300013100 Ga0157373_10031382 Ga0157373_100313824 260
25 3300013102 Ga0157371_10158586 Ga0157371_101585862 260
26 3300013296 Ga0157374_10051644 Ga0157374_100516442 260
27 3300013297 Ga0157378_10010672 Ga0157378_100106727 260
28 3300013307 Ga0157372_10223170 Ga0157372_102231702 260
29 3300025919 Ga0207657_10009181 Ga0207657_100091816 260
30 3300025920 Ga0207649_10021026 Ga0207649_100210261 260
31 3300025933 Ga0207706_10007275 Ga0207706_100072756 260
32 3300025949 Ga0207667_10175197 Ga0207667_101751972 260
33 3300026078 Ga0207702_10147988 Ga0207702_101479882 260
34 3300026095 Ga0207676_10155745 Ga0207676_101557451 260
35 3300049682 Ga0501252_001200 Ga0501252_001200_36_821 261
36 3300001979 JGI24740J21852_10000409 JGI24740J21852_1000040920 263
37 3300002738 JGI25154J39366_1000031 JGI25154J39366_100003114 263
38 3300003215 JGI25153J46596_10005563 JGI25153J46596_100055633 263
39 3300003323 rootH1_10123253 rootH1_101232535 263
40 3300003354 JGI25160J50197_1006108 JGI25160J50197_10061083 263
41 3300013102 Ga0157371_10016390 Ga0157371_100163905 263
42 3300025246 Ga0209646_1000009 Ga0209646_1000009286 263
43 3300025250 Ga0209026_1000396 Ga0209026_100039634 263
44 3300025302 Ga0207426_1000339 Ga0207426_100033924 263
45 3300053131 Ga0500652_005381 Ga0500652_005381_2007_2870 263
46 3300053139 Ga0500568_0024438 Ga0500568_0024438_1351_2214 263
47 3300025913 Ga0207695_10059033 Ga0207695_100590334 268
48 3300025949 Ga0207667_10045123 Ga0207667_100451233 268
49 3300026023 Ga0207677_10280466 Ga0207677_102804662 268
50 3300026089 Ga0207648_10136340 Ga0207648_101363402 268
51 3300005353 Ga0070669_100449076 Ga0070669_1004490761 269
52 3300005367 Ga0070667_100007822 Ga0070667_1000078225 269
53 3300005842 Ga0068858_100538290 Ga0068858_1005382902 269
54 3300005844 Ga0068862_100052368 Ga0068862_1000523681 269
55 3300006237 Ga0097621_100000499 Ga0097621_10000049916 269
56 3300006358 Ga0068871_100002567 Ga0068871_1000025679 269
57 3300006881 Ga0068865_100208891 Ga0068865_1002088911 269
58 3300009177 Ga0105248_10022859 Ga0105248_100228598 269
59 3300009551 Ga0105238_10041527 Ga0105238_100415272 269
60 3300013105 Ga0157369_10082252 Ga0157369_100822523 269
61 3300013297 Ga0157378_10012828 Ga0157378_100128283 269
62 3300013306 Ga0163162_10001523 Ga0163162_1000152312 269
63 3300013307 Ga0157372_10018758 Ga0157372_100187583 269
64 3300013307 Ga0157372_10113180 Ga0157372_101131802 269
65 3300013307 Ga0157372_10195909 Ga0157372_101959092 269
66 3300013307 Ga0157372_10201832 Ga0157372_102018323 269
67 3300013308 Ga0157375_10000686 Ga0157375_1000068619 269
68 3300014325 Ga0163163_10495187 Ga0163163_104951871 269
69 3300014968 Ga0157379_10011127 Ga0157379_100111275 269
70 3300014969 Ga0157376_10001139 Ga0157376_100011398 269
71 3300014969 Ga0157376_10394225 Ga0157376_103942252 269
72 3300017792 Ga0163161_10034025 Ga0163161_100340252 269
73 3300025903 Ga0207680_10076151 Ga0207680_100761512 269
74 3300025931 Ga0207644_10008911 Ga0207644_100089114 269
75 3300025941 Ga0207711_10324337 Ga0207711_103243372 269
76 3300025986 Ga0207658_10008025 Ga0207658_100080252 269
77 3300026035 Ga0207703_10579352 Ga0207703_105793522 269
78 3300026089 Ga0207648_10169059 Ga0207648_101690592 269
79 3300037312 Ga0395899_0174223 Ga0395899_0174223_528_1337 269
80 3300037418 Ga0395900_0124935 Ga0395900_0124935_1774_2583 269
81 3300048904 Ga0496101_0080185 Ga0496101_0080185_69_878 269
82 3300048917 Ga0496114_0040216 Ga0496114_0040216_2388_3197 269
83 3300049586 Ga0501070_0135800 Ga0501070_0135800_414_1223 269
84 3300049823 Ga0501044_0048864 Ga0501044_0048864_2172_2981 269
85 3300005457 Ga0070662_100210733 Ga0070662_1002107332 270
86 3300009094 Ga0111539_10073279 Ga0111539_100732794 270
87 3300025934 Ga0207686_10245279 Ga0207686_102452791 270
88 3300050511 nmdc:mga08y16_201809_c1 nmdc:mga08y16_201809_c1_406_1284 270
89 3300005337 Ga0070682_100181005 Ga0070682_1001810052 271
90 3300025921 Ga0207652_10236324 Ga0207652_102363242 271
91 3300026075 Ga0207708_10341101 Ga0207708_103411012 271
92 3300027907 Ga0207428_10062495 Ga0207428_100624954 271
93 3300013307 Ga0157372_10563121 Ga0157372_105631211 272
94 3300021384 Ga0213876_10037551 Ga0213876_100375512 272
95 3300039437 Ga0436365_0333717 Ga0436365_0333717_350_1252 272
96 3300049521 Ga0501298_007964 Ga0501298_007964_898_1719 273
97 iso_pu_bacteria 2911138879 2911143797 273
98 3300025904 Ga0207647_10027231 Ga0207647_100272311 274
99 3300025909 Ga0207705_10043803 Ga0207705_100438032 274
100 3300003320 rootH2_10009982 rootH2_1000998217 275
101 3300005327 Ga0070658_10160350 Ga0070658_101603501 275
102 3300005336 Ga0070680_100008782 Ga0070680_1000087824 275
103 3300005339 Ga0070660_100048944 Ga0070660_1000489442 275
104 3300005457 Ga0070662_100130026 Ga0070662_1001300263 275
105 3300005530 Ga0070679_100026672 Ga0070679_1000266722 275
106 3300005539 Ga0068853_100010908 Ga0068853_1000109084 275
107 3300005563 Ga0068855_100031575 Ga0068855_1000315752 275
108 3300005577 Ga0068857_100219479 Ga0068857_1002194792 275
109 3300025919 Ga0207657_10192301 Ga0207657_101923012 275
110 3300025921 Ga0207652_10016246 Ga0207652_100162466 275
111 3300026041 Ga0207639_10019277 Ga0207639_100192775 275
112 3300026116 Ga0207674_10010211 Ga0207674_100102118 275
113 3300025917 Ga0207660_10041338 Ga0207660_100413384 276
114 3300003322 rootL2_10145242 rootL2_101452422 277
115 3300005355 Ga0070671_100121363 Ga0070671_1001213632 277
116 3300005364 Ga0070673_100355710 Ga0070673_1003557102 277
117 3300005535 Ga0070684_100004469 Ga0070684_1000044691 277
118 3300005577 Ga0068857_100213959 Ga0068857_1002139592 277
119 3300005834 Ga0068851_10073973 Ga0068851_100739732 277
120 3300049571 Ga0501034_0000017 Ga0501034_0000017_52889_53731 277
121 3300005564 Ga0070664_100366106 Ga0070664_1003661062 278
122 3300005616 Ga0068852_100044179 Ga0068852_1000441793 278
123 3300005618 Ga0068864_100480800 Ga0068864_1004808001 278
124 3300005834 Ga0068851_10063590 Ga0068851_100635902 278
125 3300025321 Ga0207656_10023113 Ga0207656_100231131 278
126 3300025321 Ga0207656_10050990 Ga0207656_100509902 278
127 3300025921 Ga0207652_10035250 Ga0207652_100352505 278
128 3300025931 Ga0207644_10044110 Ga0207644_100441104 278
129 3300025942 Ga0207689_10213690 Ga0207689_102136901 278
130 3300025960 Ga0207651_10240143 Ga0207651_102401432 278
131 3300026142 Ga0207698_10097006 Ga0207698_100970062 278
132 3300003354 JGI25160J50197_1000941 JGI25160J50197_10009417 279
133 3300005459 Ga0068867_100080730 Ga0068867_1000807302 279
134 3300006358 Ga0068871_100535463 Ga0068871_1005354631 279
135 3300009174 Ga0105241_10295272 Ga0105241_102952723 279
136 3300013296 Ga0157374_10000260 Ga0157374_1000026034 279
137 3300025302 Ga0207426_1000211 Ga0207426_100021123 279
138 3300025919 Ga0207657_10340403 Ga0207657_103404031 279
139 3300026089 Ga0207648_10067242 Ga0207648_100672422 279
140 3300049573 Ga0501037_0172262 Ga0501037_0172262_426_1265 279
141 3300009174 Ga0105241_10251282 Ga0105241_102512822 281
142 3300025911 Ga0207654_10306619 Ga0207654_103066192 281
143 3300031730 Ga0307516_10002314 Ga0307516_1000231410 281
144 3300035170 Ga0373943_0182227 Ga0373943_0182227_74_937 281
145 3300003316 rootH1_10070184 rootH1_100701842 282
146 3300005616 Ga0068852_100156239 Ga0068852_1001562392 282
147 3300005844 Ga0068862_100241903 Ga0068862_1002419032 282
148 3300009553 Ga0105249_10339243 Ga0105249_103392432 282
149 3300013306 Ga0163162_10001336 Ga0163162_100013364 282
150 3300026142 Ga0207698_10131542 Ga0207698_101315422 282
151 3300028381 Ga0268264_10000019 Ga0268264_10000019209 282
152 3300028381 Ga0268264_10000054 Ga0268264_10000054161 282
153 3300044658 Ga0466972_0009311 Ga0466972_0009311_3814_4671 282
154 3300046460 Ga0495638_0033016 Ga0495638_0033016_505_1356 282
155 3300046524 Ga0495648_0002002 Ga0495648_0002002_11901_12752 282
156 3300047443 Ga0495687_000031 Ga0495687_000031_127441_128292 282
157 3300053092 Ga0500583_0024874 Ga0500583_0024874_354_1205 282
158 3300053156 Ga0500622_0000926 Ga0500622_0000926_20673_21524 282
159 3300003320 rootH2_10076618 rootH2_100766182 283
160 3300005535 Ga0070684_100507321 Ga0070684_1005073211 283
161 3300009093 Ga0105240_10000472 Ga0105240_100004724 283
162 3300009174 Ga0105241_10006485 Ga0105241_100064854 283
163 3300009551 Ga0105238_10002017 Ga0105238_1000201712 283
164 3300013104 Ga0157370_10157853 Ga0157370_101578532 283
165 3300013307 Ga0157372_10234475 Ga0157372_102344752 283
166 3300025913 Ga0207695_10001688 Ga0207695_1000168829 283
167 3300025914 Ga0207671_10011870 Ga0207671_100118702 283
168 3300030521 Ga0307511_10000228 Ga0307511_1000022812 283
169 iso_pu_bacteria 8003151029 8003156874 283
170 3300005327 Ga0070658_10001648 Ga0070658_100016484 284
171 3300005328 Ga0070676_10000489 Ga0070676_1000048914 284
172 3300005334 Ga0068869_100071604 Ga0068869_1000716042 284
173 3300005338 Ga0068868_100000187 Ga0068868_10000018729 284
174 3300005347 Ga0070668_100003714 Ga0070668_1000037142 284
175 3300005354 Ga0070675_100110972 Ga0070675_1001109722 284
176 3300005364 Ga0070673_100000124 Ga0070673_10000012412 284
177 3300005367 Ga0070667_100000980 Ga0070667_10000098012 284
178 3300005457 Ga0070662_100010835 Ga0070662_1000108352 284
179 3300005458 Ga0070681_10147631 Ga0070681_101476312 284
180 3300005459 Ga0068867_100002368 Ga0068867_1000023686 284
181 3300005539 Ga0068853_100002569 Ga0068853_1000025694 284
182 3300005543 Ga0070672_100000105 Ga0070672_10000010525 284
183 3300005548 Ga0070665_100000018 Ga0070665_100000018146 284
184 3300005548 Ga0070665_100000635 Ga0070665_10000063525 284
185 3300005563 Ga0068855_100097871 Ga0068855_1000978712 284
186 3300005564 Ga0070664_100083437 Ga0070664_1000834372 284
187 3300005616 Ga0068852_100098181 Ga0068852_1000981812 284
188 3300005618 Ga0068864_100001254 Ga0068864_1000012545 284
189 3300005719 Ga0068861_100422216 Ga0068861_1004222161 284
190 3300005834 Ga0068851_10000475 Ga0068851_1000047514 284
191 3300005841 Ga0068863_100005370 Ga0068863_1000053702 284
192 3300005843 Ga0068860_100001418 Ga0068860_10000141814 284
193 3300006237 Ga0097621_100007453 Ga0097621_1000074532 284
194 3300006881 Ga0068865_100001094 Ga0068865_1000010949 284
195 3300009093 Ga0105240_10154276 Ga0105240_101542762 284
196 3300009101 Ga0105247_10033980 Ga0105247_100339802 284
197 3300009148 Ga0105243_10589518 Ga0105243_105895181 284
198 3300009177 Ga0105248_10151001 Ga0105248_101510012 284
199 3300009545 Ga0105237_10415685 Ga0105237_104156852 284
200 3300009553 Ga0105249_10085265 Ga0105249_100852652 284
201 3300013102 Ga0157371_10208211 Ga0157371_102082112 284
202 3300013296 Ga0157374_10002980 Ga0157374_100029802 284
203 3300013297 Ga0157378_10013251 Ga0157378_100132512 284
204 3300013306 Ga0163162_10000312 Ga0163162_1000031225 284
205 3300013307 Ga0157372_10094440 Ga0157372_100944402 284
206 3300013307 Ga0157372_10410828 Ga0157372_104108282 284
207 3300013308 Ga0157375_10002871 Ga0157375_1000287114 284
208 3300014325 Ga0163163_10000346 Ga0163163_1000034627 284
209 3300014968 Ga0157379_10000242 Ga0157379_1000024211 284
210 3300025907 Ga0207645_10001794 Ga0207645_100017942 284
211 3300025913 Ga0207695_10106388 Ga0207695_101063882 284
212 3300025933 Ga0207706_10061177 Ga0207706_100611772 284
213 3300025938 Ga0207704_10000562 Ga0207704_100005622 284
214 3300025940 Ga0207691_10000012 Ga0207691_1000001261 284
215 3300025949 Ga0207667_10034450 Ga0207667_100344505 284
216 3300025960 Ga0207651_10000216 Ga0207651_100002162 284
217 3300025961 Ga0207712_10010440 Ga0207712_100104403 284
218 3300025972 Ga0207668_10001361 Ga0207668_100013614 284
219 3300025986 Ga0207658_10000374 Ga0207658_1000037430 284
220 3300026023 Ga0207677_10000984 Ga0207677_100009842 284
221 3300026041 Ga0207639_10002390 Ga0207639_100023908 284
222 3300026088 Ga0207641_10022535 Ga0207641_100225353 284
223 3300026088 Ga0207641_10460278 Ga0207641_104602782 284
224 3300026089 Ga0207648_10010253 Ga0207648_100102533 284
225 3300026095 Ga0207676_10000697 Ga0207676_100006975 284
226 3300026118 Ga0207675_100022342 Ga0207675_1000223423 284
227 3300026142 Ga0207698_10009340 Ga0207698_100093402 284
228 3300028379 Ga0268266_10000026 Ga0268266_10000026215 284
229 3300028379 Ga0268266_10005379 Ga0268266_1000537912 284
230 3300028381 Ga0268264_10003975 Ga0268264_100039753 284
231 3300028381 Ga0268264_10005188 Ga0268264_100051887 284
232 3300053153 Ga0500616_0026690 Ga0500616_0026690_1141_1998 284
233 3300009545 Ga0105237_10360118 Ga0105237_103601181 285
234 3300013100 Ga0157373_10164397 Ga0157373_101643972 285
235 3300013307 Ga0157372_10023974 Ga0157372_100239742 285
236 3300025914 Ga0207671_10236354 Ga0207671_102363542 285
237 3300025925 Ga0207650_10002954 Ga0207650_100029542 285
238 3300025931 Ga0207644_10041431 Ga0207644_100414313 285
239 3300031731 Ga0307405_10005405 Ga0307405_100054058 285
240 3300031824 Ga0307413_10008468 Ga0307413_100084685 285
241 3300031852 Ga0307410_10133568 Ga0307410_101335682 285
242 3300031903 Ga0307407_10103515 Ga0307407_101035152 285
243 3300031911 Ga0307412_10061446 Ga0307412_100614462 285
244 3300031995 Ga0307409_100062332 Ga0307409_1000623322 285
245 3300032002 Ga0307416_100060439 Ga0307416_1000604392 285
246 3300032126 Ga0307415_100035696 Ga0307415_1000356962 285
247 3300033180 Ga0307510_10017333 Ga0307510_100173339 285
248 3300046507 Ga0495606_0003341 Ga0495606_0003341_11391_12284 285
249 3300049650 Ga0501199_001778 Ga0501199_001778_1078_1935 285
250 3300049652 Ga0501202_004538 Ga0501202_004538_1491_2348 285
251 3300049654 Ga0501207_001587 Ga0501207_001587_1054_1911 285
252 3300049661 Ga0501217_003847 Ga0501217_003847_1415_2272 285
253 3300049686 Ga0501257_030754 Ga0501257_030754_364_1221 285
254 3300005328 Ga0070676_10004865 Ga0070676_100048653 286
255 3300005328 Ga0070676_10400885 Ga0070676_104008851 286
256 3300005331 Ga0070670_100053373 Ga0070670_1000533732 286
257 3300005333 Ga0070677_10042946 Ga0070677_100429462 286
258 3300005334 Ga0068869_100108650 Ga0068869_1001086501 286
259 3300005335 Ga0070666_10000031 Ga0070666_1000003140 286
260 3300005338 Ga0068868_100003257 Ga0068868_1000032576 286
261 3300005338 Ga0068868_100148261 Ga0068868_1001482612 286
262 3300005341 Ga0070691_10088105 Ga0070691_100881052 286
263 3300005347 Ga0070668_100027163 Ga0070668_1000271631 286
264 3300005354 Ga0070675_100035460 Ga0070675_1000354602 286
265 3300005356 Ga0070674_100007803 Ga0070674_1000078032 286
266 3300005364 Ga0070673_100070512 Ga0070673_1000705124 286
267 3300005367 Ga0070667_100011432 Ga0070667_1000114328 286
268 3300005367 Ga0070667_100174060 Ga0070667_1001740602 286
269 3300005438 Ga0070701_10095774 Ga0070701_100957742 286
270 3300005456 Ga0070678_100007411 Ga0070678_1000074114 286
271 3300005459 Ga0068867_100066748 Ga0068867_1000667483 286
272 3300005466 Ga0070685_10076045 Ga0070685_100760451 286
273 3300005466 Ga0070685_10302072 Ga0070685_103020722 286
274 3300005539 Ga0068853_100231375 Ga0068853_1002313751 286
275 3300005539 Ga0068853_100259861 Ga0068853_1002598611 286
276 3300005543 Ga0070672_100096093 Ga0070672_1000960932 286
277 3300005543 Ga0070672_100291040 Ga0070672_1002910402 286
278 3300005544 Ga0070686_100001965 Ga0070686_1000019658 286
279 3300005548 Ga0070665_100076193 Ga0070665_1000761934 286
280 3300005563 Ga0068855_100019495 Ga0068855_1000194958 286
281 3300005564 Ga0070664_100380197 Ga0070664_1003801971 286
282 3300005577 Ga0068857_100000287 Ga0068857_10000028721 286
283 3300005578 Ga0068854_100026109 Ga0068854_1000261092 286
284 3300005614 Ga0068856_100044643 Ga0068856_1000446432 286
285 3300005616 Ga0068852_100008024 Ga0068852_1000080246 286
286 3300005617 Ga0068859_100000045 Ga0068859_100000045100 286
287 3300005617 Ga0068859_100026115 Ga0068859_1000261157 286
288 3300005617 Ga0068859_100049476 Ga0068859_1000494762 286
289 3300005617 Ga0068859_100220111 Ga0068859_1002201112 286
290 3300005618 Ga0068864_100001485 Ga0068864_10000148516 286
291 3300005719 Ga0068861_100201581 Ga0068861_1002015812 286
292 3300005834 Ga0068851_10008746 Ga0068851_100087463 286
293 3300005841 Ga0068863_100002352 Ga0068863_10000235215 286
294 3300005842 Ga0068858_100003543 Ga0068858_1000035435 286
295 3300005842 Ga0068858_100476066 Ga0068858_1004760661 286
296 3300005843 Ga0068860_100008301 Ga0068860_1000083014 286
297 3300005843 Ga0068860_100018642 Ga0068860_1000186423 286
298 3300005843 Ga0068860_100039499 Ga0068860_1000394994 286
299 3300005843 Ga0068860_100076409 Ga0068860_1000764093 286
300 3300005843 Ga0068860_100576537 Ga0068860_1005765371 286
301 3300006237 Ga0097621_100035931 Ga0097621_1000359312 286
302 3300006358 Ga0068871_100008100 Ga0068871_1000081004 286
303 3300006358 Ga0068871_100228898 Ga0068871_1002288982 286
304 3300006871 Ga0075434_100009056 Ga0075434_1000090566 286
305 3300006881 Ga0068865_100006917 Ga0068865_1000069174 286
306 3300006881 Ga0068865_100016931 Ga0068865_1000169315 286
307 3300006931 Ga0097620_100000045 Ga0097620_10000004540 286
308 3300006931 Ga0097620_100026115 Ga0097620_1000261157 286
309 3300006931 Ga0097620_100049476 Ga0097620_1000494762 286
310 3300006931 Ga0097620_100220098 Ga0097620_1002200982 286
311 3300009093 Ga0105240_10019870 Ga0105240_100198703 286
312 3300009093 Ga0105240_10022478 Ga0105240_100224788 286
313 3300009093 Ga0105240_10097824 Ga0105240_100978241 286
314 3300009101 Ga0105247_10003520 Ga0105247_1000352011 286
315 3300009148 Ga0105243_10109968 Ga0105243_101099682 286
316 3300009174 Ga0105241_10001733 Ga0105241_100017333 286
317 3300009174 Ga0105241_10068382 Ga0105241_100683822 286
318 3300009174 Ga0105241_10219785 Ga0105241_102197852 286
319 3300009176 Ga0105242_10010544 Ga0105242_100105446 286
320 3300009176 Ga0105242_10020808 Ga0105242_100208084 286
321 3300009545 Ga0105237_10001767 Ga0105237_1000176721 286
322 3300009545 Ga0105237_10054400 Ga0105237_100544002 286
323 3300009545 Ga0105237_10060266 Ga0105237_100602663 286
324 3300009545 Ga0105237_10317901 Ga0105237_103179011 286
325 3300009551 Ga0105238_10159680 Ga0105238_101596801 286
326 3300009553 Ga0105249_10011083 Ga0105249_100110834 286
327 3300010375 Ga0105239_10001180 Ga0105239_100011804 286
328 3300013100 Ga0157373_10067784 Ga0157373_100677842 286
329 3300013104 Ga0157370_10009358 Ga0157370_100093588 286
330 3300013105 Ga0157369_10073809 Ga0157369_100738093 286
331 3300013296 Ga0157374_10027083 Ga0157374_100270835 286
332 3300013297 Ga0157378_10003039 Ga0157378_100030393 286
333 3300013297 Ga0157378_10071685 Ga0157378_100716852 286
334 3300013306 Ga0163162_10004258 Ga0163162_1000425811 286
335 3300013306 Ga0163162_10074114 Ga0163162_100741142 286
336 3300013307 Ga0157372_10000741 Ga0157372_100007414 286
337 3300014325 Ga0163163_10135642 Ga0163163_101356423 286
338 3300014968 Ga0157379_10052461 Ga0157379_100524613 286
339 3300014968 Ga0157379_10179209 Ga0157379_101792092 286
340 3300014969 Ga0157376_10085547 Ga0157376_100855472 286
341 3300014969 Ga0157376_10192255 Ga0157376_101922552 286
342 3300025901 Ga0207688_10030435 Ga0207688_100304352 286
343 3300025903 Ga0207680_10000141 Ga0207680_1000014127 286
344 3300025904 Ga0207647_10002819 Ga0207647_100028195 286
345 3300025907 Ga0207645_10054686 Ga0207645_100546861 286
346 3300025911 Ga0207654_10057810 Ga0207654_100578102 286
347 3300025911 Ga0207654_10271483 Ga0207654_102714832 286
348 3300025913 Ga0207695_10028517 Ga0207695_100285176 286
349 3300025913 Ga0207695_10064026 Ga0207695_100640263 286
350 3300025914 Ga0207671_10011688 Ga0207671_100116883 286
351 3300025914 Ga0207671_10142434 Ga0207671_101424342 286
352 3300025914 Ga0207671_10209971 Ga0207671_102099711 286
353 3300025923 Ga0207681_10017517 Ga0207681_100175173 286
354 3300025923 Ga0207681_10325805 Ga0207681_103258052 286
355 3300025925 Ga0207650_10288149 Ga0207650_102881492 286
356 3300025927 Ga0207687_10137272 Ga0207687_101372721 286
357 3300025931 Ga0207644_10036096 Ga0207644_100360963 286
358 3300025934 Ga0207686_10050058 Ga0207686_100500582 286
359 3300025937 Ga0207669_10096141 Ga0207669_100961412 286
360 3300025940 Ga0207691_10004759 Ga0207691_100047594 286
361 3300025940 Ga0207691_10088274 Ga0207691_100882743 286
362 3300025940 Ga0207691_10216348 Ga0207691_102163482 286
363 3300025942 Ga0207689_10008936 Ga0207689_100089362 286
364 3300025942 Ga0207689_10018137 Ga0207689_100181371 286
365 3300025942 Ga0207689_10030002 Ga0207689_100300023 286
366 3300025942 Ga0207689_10070533 Ga0207689_100705332 286
367 3300025949 Ga0207667_10000643 Ga0207667_1000064311 286
368 3300025960 Ga0207651_10354520 Ga0207651_103545202 286
369 3300025972 Ga0207668_10054223 Ga0207668_100542232 286
370 3300025981 Ga0207640_10015769 Ga0207640_100157691 286
371 3300025986 Ga0207658_10033838 Ga0207658_100338382 286
372 3300025986 Ga0207658_10050631 Ga0207658_100506313 286
373 3300026023 Ga0207677_10092119 Ga0207677_100921192 286
374 3300026035 Ga0207703_10035352 Ga0207703_100353522 286
375 3300026035 Ga0207703_10278392 Ga0207703_102783922 286
376 3300026041 Ga0207639_10158079 Ga0207639_101580792 286
377 3300026041 Ga0207639_10545805 Ga0207639_105458051 286
378 3300026078 Ga0207702_10025199 Ga0207702_100251993 286
379 3300026088 Ga0207641_10000133 Ga0207641_1000013385 286
380 3300026089 Ga0207648_10012892 Ga0207648_100128925 286
381 3300026089 Ga0207648_10027821 Ga0207648_100278214 286
382 3300026116 Ga0207674_10001630 Ga0207674_1000163010 286
383 3300026118 Ga0207675_100005430 Ga0207675_1000054302 286
384 3300026118 Ga0207675_100174885 Ga0207675_1001748852 286
385 3300026121 Ga0207683_10002013 Ga0207683_1000201312 286
386 3300026142 Ga0207698_10014863 Ga0207698_100148635 286
387 3300028379 Ga0268266_10035267 Ga0268266_100352674 286
388 3300028381 Ga0268264_10008390 Ga0268264_100083906 286
389 3300028381 Ga0268264_10008570 Ga0268264_100085704 286
390 3300028381 Ga0268264_10008865 Ga0268264_100088654 286
391 3300028381 Ga0268264_10107627 Ga0268264_101076273 286
392 3300031456 Ga0307513_10206813 Ga0307513_102068132 286
393 3300044658 Ga0466972_0000016 Ga0466972_0000016_50292_51221 286
394 3300044765 Ga0466970_0003015 Ga0466970_0003015_3305_4234 286
395 3300047320 Ga0495672_0038837 Ga0495672_0038837_81_944 286
396 3300049513 Ga0501290_003419 Ga0501290_003419_1065_1925 286
397 3300049651 Ga0501201_003219 Ga0501201_003219_55_915 286
398 3300049652 Ga0501202_000819 Ga0501202_000819_3133_3993 286
399 3300049661 Ga0501217_056499 Ga0501217_056499_38_898 286
400 3300049662 Ga0501222_001204 Ga0501222_001204_1358_2218 286
401 3300049663 Ga0501223_001850 Ga0501223_001850_1455_2315 286
402 3300049673 Ga0501240_002479 Ga0501240_002479_923_1783 286
403 3300049675 Ga0501243_003490 Ga0501243_003490_57_917 286
404 3300049686 Ga0501257_002646 Ga0501257_002646_1135_1995 286
405 3300049690 Ga0501261_000533 Ga0501261_000533_3021_3881 286
406 3300049703 Ga0501219_000159 Ga0501219_000159_474_1406 286
407 3300049705 Ga0501225_0005770 Ga0501225_0005770_2279_3139 286
408 3300049707 Ga0501234_003320 Ga0501234_003320_80_940 286
409 3300049763 Ga0501266_006733 Ga0501266_006733_536_1396 286
410 3300050005 Ga0501284_00018 Ga0501284_00018_72050_72982 286
411 3300053177 Ga0500636_0053601 Ga0500636_0053601_1472_2332 286
412 3300000043 ARcpr5yngRDRAFT_c003927 ARcpr5yngRDRAFT_0039272 287
413 3300003215 JGI25153J46596_10009336 JGI25153J46596_100093364 287
414 3300003316 rootH1_10028021 rootH1_100280213 287
415 3300003322 rootL2_10028177 rootL2_100281772 287
416 3300003322 rootL2_10247536 rootL2_102475361 287
417 3300003323 rootH1_10116572 rootH1_101165722 287
418 3300003771 Ga0055526_1012091 Ga0055526_10120914 287
419 3300003790 Ga0055528_1001378 Ga0055528_10013787 287
420 3300003791 Ga0055530_10002564 Ga0055530_100025648 287
421 3300004625 Ga0055543_1018775 Ga0055543_10187751 287
422 3300005262 Ga0065165_1002242 Ga0065165_10022422 287
423 3300005327 Ga0070658_10081792 Ga0070658_100817922 287
424 3300005328 Ga0070676_10005268 Ga0070676_100052685 287
425 3300005329 Ga0070683_100040688 Ga0070683_1000406882 287
426 3300005330 Ga0070690_100047878 Ga0070690_1000478781 287
427 3300005331 Ga0070670_100058021 Ga0070670_1000580214 287
428 3300005334 Ga0068869_100011325 Ga0068869_1000113252 287
429 3300005336 Ga0070680_100005567 Ga0070680_1000055674 287
430 3300005337 Ga0070682_100278342 Ga0070682_1002783422 287
431 3300005338 Ga0068868_100000427 Ga0068868_10000042716 287
432 3300005338 Ga0068868_100128787 Ga0068868_1001287872 287
433 3300005339 Ga0070660_100001959 Ga0070660_10000195913 287
434 3300005339 Ga0070660_100013641 Ga0070660_1000136413 287
435 3300005341 Ga0070691_10006430 Ga0070691_100064302 287
436 3300005344 Ga0070661_100002315 Ga0070661_1000023154 287
437 3300005344 Ga0070661_100209652 Ga0070661_1002096522 287
438 3300005345 Ga0070692_10087061 Ga0070692_100870613 287
439 3300005347 Ga0070668_100313498 Ga0070668_1003134981 287
440 3300005354 Ga0070675_100064519 Ga0070675_1000645192 287
441 3300005355 Ga0070671_100238505 Ga0070671_1002385051 287
442 3300005356 Ga0070674_100339814 Ga0070674_1003398142 287
443 3300005364 Ga0070673_100022372 Ga0070673_1000223722 287
444 3300005364 Ga0070673_100346412 Ga0070673_1003464122 287
445 3300005366 Ga0070659_100003555 Ga0070659_1000035558 287
446 3300005366 Ga0070659_100328513 Ga0070659_1003285132 287
447 3300005438 Ga0070701_10302166 Ga0070701_103021661 287
448 3300005455 Ga0070663_100547125 Ga0070663_1005471251 287
449 3300005456 Ga0070678_100057194 Ga0070678_1000571942 287
450 3300005456 Ga0070678_100308276 Ga0070678_1003082761 287
451 3300005457 Ga0070662_100009734 Ga0070662_1000097343 287
452 3300005457 Ga0070662_100011948 Ga0070662_1000119485 287
453 3300005457 Ga0070662_100473921 Ga0070662_1004739212 287
454 3300005458 Ga0070681_10023031 Ga0070681_100230312 287
455 3300005458 Ga0070681_10077245 Ga0070681_100772454 287
456 3300005459 Ga0068867_100003400 Ga0068867_1000034005 287
457 3300005459 Ga0068867_100028878 Ga0068867_1000288781 287
458 3300005466 Ga0070685_10049557 Ga0070685_100495574 287
459 3300005468 Ga0070707_100351801 Ga0070707_1003518012 287
460 3300005530 Ga0070679_100003309 Ga0070679_10000330914 287
461 3300005535 Ga0070684_100001198 Ga0070684_10000119812 287
462 3300005535 Ga0070684_100049157 Ga0070684_1000491575 287
463 3300005539 Ga0068853_100002879 Ga0068853_10000287914 287
464 3300005539 Ga0068853_100635687 Ga0068853_1006356871 287
465 3300005543 Ga0070672_100114098 Ga0070672_1001140983 287
466 3300005547 Ga0070693_100004189 Ga0070693_1000041893 287
467 3300005548 Ga0070665_100130947 Ga0070665_1001309472 287
468 3300005563 Ga0068855_100007383 Ga0068855_1000073837 287
469 3300005563 Ga0068855_100045431 Ga0068855_1000454313 287
470 3300005563 Ga0068855_100144424 Ga0068855_1001444242 287
471 3300005563 Ga0068855_100349166 Ga0068855_1003491662 287
472 3300005564 Ga0070664_100006530 Ga0070664_1000065303 287
473 3300005564 Ga0070664_100020320 Ga0070664_1000203204 287
474 3300005564 Ga0070664_100270073 Ga0070664_1002700732 287
475 3300005577 Ga0068857_100007841 Ga0068857_1000078413 287
476 3300005577 Ga0068857_100011785 Ga0068857_1000117855 287
477 3300005577 Ga0068857_100186221 Ga0068857_1001862212 287
478 3300005578 Ga0068854_100010687 Ga0068854_1000106872 287
479 3300005578 Ga0068854_100309376 Ga0068854_1003093761 287
480 3300005614 Ga0068856_100075596 Ga0068856_1000755962 287
481 3300005614 Ga0068856_100126812 Ga0068856_1001268121 287
482 3300005616 Ga0068852_100031900 Ga0068852_1000319002 287
483 3300005616 Ga0068852_100157821 Ga0068852_1001578212 287
484 3300005617 Ga0068859_100475765 Ga0068859_1004757651 287
485 3300005618 Ga0068864_100161078 Ga0068864_1001610782 287
486 3300005718 Ga0068866_10070600 Ga0068866_100706002 287
487 3300005841 Ga0068863_100083560 Ga0068863_1000835602 287
488 3300005841 Ga0068863_100561491 Ga0068863_1005614911 287
489 3300005841 Ga0068863_100595920 Ga0068863_1005959201 287
490 3300005843 Ga0068860_100220951 Ga0068860_1002209512 287
491 3300006195 Ga0075366_10077696 Ga0075366_100776962 287
492 3300006195 Ga0075366_10086190 Ga0075366_100861903 287
493 3300006237 Ga0097621_100193579 Ga0097621_1001935792 287
494 3300006358 Ga0068871_100131671 Ga0068871_1001316712 287
495 3300006844 Ga0075428_100023898 Ga0075428_1000238984 287
496 3300006846 Ga0075430_100018099 Ga0075430_1000180993 287
497 3300006880 Ga0075429_100014092 Ga0075429_1000140923 287
498 3300006931 Ga0097620_100475764 Ga0097620_1004757642 287
499 3300009093 Ga0105240_10009860 Ga0105240_100098608 287
500 3300009174 Ga0105241_10000985 Ga0105241_100009854 287
501 3300009174 Ga0105241_10006681 Ga0105241_100066814 287
502 3300009176 Ga0105242_10564478 Ga0105242_105644781 287
503 3300013100 Ga0157373_10009844 Ga0157373_100098443 287
504 3300013102 Ga0157371_10000284 Ga0157371_1000028430 287
505 3300013102 Ga0157371_10000725 Ga0157371_1000072518 287
506 3300013102 Ga0157371_10032796 Ga0157371_100327962 287
507 3300013104 Ga0157370_10004751 Ga0157370_100047515 287
508 3300013104 Ga0157370_10021147 Ga0157370_100211475 287
509 3300013296 Ga0157374_10079023 Ga0157374_100790232 287
510 3300013297 Ga0157378_10328610 Ga0157378_103286102 287
511 3300013306 Ga0163162_10022439 Ga0163162_100224392 287
512 3300013306 Ga0163162_10074490 Ga0163162_100744902 287
513 3300013307 Ga0157372_10167842 Ga0157372_101678422 287
514 3300013307 Ga0157372_10186876 Ga0157372_101868762 287
515 3300013307 Ga0157372_10211924 Ga0157372_102119242 287
516 3300013307 Ga0157372_10245818 Ga0157372_102458182 287
517 3300013308 Ga0157375_10010009 Ga0157375_100100093 287
518 3300013308 Ga0157375_10478217 Ga0157375_104782172 287
519 3300014745 Ga0157377_10017063 Ga0157377_100170634 287
520 3300014968 Ga0157379_10032372 Ga0157379_100323723 287
521 3300017792 Ga0163161_10128416 Ga0163161_101284162 287
522 3300025273 Ga0209673_1000016 Ga0209673_100001665 287
523 3300025295 Ga0209564_1004934 Ga0209564_10049345 287
524 3300025298 Ga0209050_1000124 Ga0209050_1000124114 287
525 3300025304 Ga0209257_1000658 Ga0209257_10006585 287
526 3300025315 Ga0207697_10009658 Ga0207697_100096583 287
527 3300025899 Ga0207642_10054151 Ga0207642_100541512 287
528 3300025907 Ga0207645_10040449 Ga0207645_100404493 287
529 3300025909 Ga0207705_10007257 Ga0207705_100072575 287
530 3300025913 Ga0207695_10004070 Ga0207695_1000407014 287
531 3300025917 Ga0207660_10005510 Ga0207660_100055107 287
532 3300025919 Ga0207657_10023896 Ga0207657_100238962 287
533 3300025919 Ga0207657_10134061 Ga0207657_101340611 287
534 3300025920 Ga0207649_10026846 Ga0207649_100268464 287
535 3300025921 Ga0207652_10000045 Ga0207652_1000004551 287
536 3300025921 Ga0207652_10000214 Ga0207652_100002142 287
537 3300025921 Ga0207652_10008710 Ga0207652_100087102 287
538 3300025923 Ga0207681_10011577 Ga0207681_100115774 287
539 3300025923 Ga0207681_10280009 Ga0207681_102800092 287
540 3300025926 Ga0207659_10035806 Ga0207659_100358063 287
541 3300025926 Ga0207659_10096132 Ga0207659_100961322 287
542 3300025931 Ga0207644_10198329 Ga0207644_101983293 287
543 3300025933 Ga0207706_10003994 Ga0207706_100039945 287
544 3300025933 Ga0207706_10059068 Ga0207706_100590683 287
545 3300025936 Ga0207670_10070587 Ga0207670_100705872 287
546 3300025938 Ga0207704_10187715 Ga0207704_101877152 287
547 3300025940 Ga0207691_10108794 Ga0207691_101087942 287
548 3300025940 Ga0207691_10224567 Ga0207691_102245672 287
549 3300025942 Ga0207689_10009466 Ga0207689_100094666 287
550 3300025942 Ga0207689_10138065 Ga0207689_101380652 287
551 3300025944 Ga0207661_10003108 Ga0207661_100031087 287
552 3300025944 Ga0207661_10152076 Ga0207661_101520762 287
553 3300025945 Ga0207679_10004210 Ga0207679_100042101 287
554 3300025945 Ga0207679_10017260 Ga0207679_100172601 287
555 3300025949 Ga0207667_10083216 Ga0207667_100832162 287
556 3300025949 Ga0207667_10097434 Ga0207667_100974343 287
557 3300025949 Ga0207667_10132420 Ga0207667_101324203 287
558 3300025981 Ga0207640_10048773 Ga0207640_100487732 287
559 3300025981 Ga0207640_10109399 Ga0207640_101093992 287
560 3300025986 Ga0207658_10057016 Ga0207658_100570163 287
561 3300026023 Ga0207677_10004993 Ga0207677_100049932 287
562 3300026023 Ga0207677_10018387 Ga0207677_100183875 287
563 3300026041 Ga0207639_10396638 Ga0207639_103966381 287
564 3300026067 Ga0207678_10013503 Ga0207678_100135034 287
565 3300026067 Ga0207678_10237683 Ga0207678_102376832 287
566 3300026078 Ga0207702_10026475 Ga0207702_100264752 287
567 3300026088 Ga0207641_10563222 Ga0207641_105632222 287
568 3300026089 Ga0207648_10013112 Ga0207648_100131126 287
569 3300026089 Ga0207648_10041074 Ga0207648_100410743 287
570 3300026089 Ga0207648_10073681 Ga0207648_100736812 287
571 3300026116 Ga0207674_10004031 Ga0207674_1000403111 287
572 3300026116 Ga0207674_10216902 Ga0207674_102169021 287
573 3300026121 Ga0207683_10025467 Ga0207683_100254674 287
574 3300026121 Ga0207683_10176207 Ga0207683_101762072 287
575 3300028381 Ga0268264_10008474 Ga0268264_100084749 287
576 3300028381 Ga0268264_10350200 Ga0268264_103502002 287
577 3300028381 Ga0268264_10795965 Ga0268264_107959651 287
578 3300031251 Ga0265327_10031686 Ga0265327_100316866 287
579 3300031456 Ga0307513_10112285 Ga0307513_101122852 287
580 3300031507 Ga0307509_10015498 Ga0307509_100154986 287
581 3300031838 Ga0307518_10139407 Ga0307518_101394071 287
582 3300036401 Ga0373937_0006671 Ga0373937_0006671_933_1796 287
583 3300037312 Ga0395899_0017226 Ga0395899_0017226_4361_5233 287
584 3300037418 Ga0395900_0059235 Ga0395900_0059235_2739_3602 287
585 3300037466 Ga0395898_0013466 Ga0395898_0013466_3351_4223 287
586 3300037471 Ga0395905_0070300 Ga0395905_0070300_1670_2578 287
587 3300038443 Ga0395901_0028050 Ga0395901_0028050_1175_2047 287
588 3300039437 Ga0436365_0927657 Ga0436365_0927657_256_1131 287
589 3300044658 Ga0466972_0019573 Ga0466972_0019573_498_1361 287
590 3300046511 Ga0495608_0067439 Ga0495608_0067439_1319_2182 287
591 3300046516 Ga0495628_0022064 Ga0495628_0022064_3949_4812 287
592 3300046517 Ga0495630_0011846 Ga0495630_0011846_2524_3387 287
593 3300046535 Ga0495586_0009224 Ga0495586_0009224_1552_2415 287
594 3300046809 Ga0495600_0133662 Ga0495600_0133662_10_873 287
595 3300047317 Ga0495604_0290160 Ga0495604_0290160_196_1059 287
596 3300047322 Ga0495680_0037499 Ga0495680_0037499_2863_3726 287
597 3300048913 Ga0496110_0019814 Ga0496110_0019814_2368_3270 287
598 3300049571 Ga0501034_0037661 Ga0501034_0037661_345_1211 287
599 3300049573 Ga0501037_0080762 Ga0501037_0080762_685_1551 287
600 3300049574 Ga0501038_0059187 Ga0501038_0059187_1468_2334 287
601 3300049575 Ga0501039_0029118 Ga0501039_0029118_3206_4072 287
602 3300049579 Ga0501043_0003072 Ga0501043_0003072_6382_7248 287
603 3300049581 Ga0501047_0010118 Ga0501047_0010118_4780_5646 287
604 3300049581 Ga0501047_0188923 Ga0501047_0188923_566_1429 287
605 3300049822 Ga0501035_0016138 Ga0501035_0016138_159_1025 287
606 3300050510 nmdc:mga06r32_200583_c1 nmdc:mga06r32_200583_c1_89_952 287
607 3300053153 Ga0500616_0006698 Ga0500616_0006698_4505_5377 287

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01040

UbiA

UbiA prenyltransferase family

67

318

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
4tq6-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.7373 9 282
4tq4-assembly3.cif.gz_C structure of a ubia homolog from archaeoglobus fulgidus bound to dmapp and mg2+ 0.7294 5 282
4tq3-assembly1.cif.gz_A structure of a ubia homolog from archaeoglobus fulgidus bound to gpp and mg2+ 0.7266 5 282
4tq6-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.7204 9 282
4tq3-assembly1.cif.gz_A structure of a ubia homolog from archaeoglobus fulgidus bound to gpp and mg2+ 0.7144 5 282
ID Description Score Start End Superfamily
af_C6KSS3_382_506_1.20.120.1780 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);UbiA prenyltransferase 0.8192 160 286 1.20.120.1780
af_P0AGK1_170_289_1.20.120.1780 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);UbiA prenyltransferase 0.8061 159 287 1.20.120.1780
af_P0AGK1_170_289_1.20.120.1780 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);UbiA prenyltransferase 0.8003 159 287 1.20.120.1780
af_Q2FZM0_17_182_1.10.357.140 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase 0.7832 9 149 1.10.357.140
af_A0A0R0IQ72_105_369_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.7743 20 265 1.20.1070.10
ID Description Score Start End GO Terms
AF-A0A1G3J558-F1-model_v4 Prenyltransferase 0.998 2 287 GO:0016020
GO:0016765
AF-G8TIE5-F1-model_v4 UbiA prenyltransferase 0.9977 1 287 GO:0016020
GO:0016765
AF-A0A0C1IF90-F1-model_v4 Prenyltransferase 0.9977 1 287 GO:0016020
GO:0016765
AF-A0A0C1IEE0-F1-model_v4 UbiA prenyltransferase 0.9968 1 287 GO:0016020
GO:0016765
AF-A0A1G3J558-F1-model_v4 Prenyltransferase 0.9946 2 287 GO:0016020
GO:0016765

Feature Viewer

pLDDT pTM Quality
96.3 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map