F468693

General Info

Members Datasets Scaffolds Average Seq Length
607 339 1212 323

Family's Representative Sequence

Representative Sequence 3300025924|Ga0207694_10017930|Ga0207694_100179303
Length 373
Sequence MKKLFALAAIAAAAAGVHAQDFPAGKTVTLVVPFAAGGPTDRVARDLAEAMQKTLGTTIVVDNTAGAGSSIGTAKVARAAPDGYTLLLNHIGMSTMPALYRKLPFNVENDFEYLGMVNEVPMTLIGKPGLPANNYKELTAWIAANKGKINLGNAGLGAASHLCGLLFQSALKVEMTPVPYKGTAPAIADLLGGQIDLLCDQTTNTTSQIEAKKVKAYAVTTSKRLTTPALKDLPTLDESGLKGFEVTIWHGVYAPKGTPAPVLKKLNEAIKAAMKDPGFVKREEALGRGDHDRQAHRAGRAQEVRLGRDRQVGPDHQGGWRVRRLAVARPQAARQSRFRGVPGFEFAEAAVLLRTAAFFVAATSAGWRQPSPG

Samples

Sample ID Description Type Environment
1 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
6 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
7 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
8 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
9 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
10 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
11 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
12 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
13 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
48 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
49 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
50 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
51 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
52 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
53 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
61 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
62 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
85 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
86 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
92 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
94 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
97 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
100 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
102 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
105 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
147 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
148 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
149 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
154 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
155 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
156 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
157 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
158 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
159 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
160 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
161 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
162 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
163 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
164 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
165 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
166 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
167 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
168 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
169 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
170 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
171 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
172 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
173 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
174 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
175 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
176 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
177 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
178 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
179 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
180 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
181 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
182 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
183 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
184 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
185 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
186 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
187 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
188 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
189 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
190 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
191 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
192 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
193 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
194 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
195 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
196 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
197 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
198 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
199 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
200 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
201 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
202 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
203 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
204 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
205 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
206 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
207 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
208 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
209 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
210 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
211 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
212 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
213 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
214 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
215 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
216 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
217 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
218 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
219 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
220 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
221 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
222 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
223 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
224 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
225 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
226 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
227 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
228 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
229 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
230 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
231 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
232 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
233 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
234 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
235 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
236 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
237 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
238 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
239 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
240 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
241 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
242 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
243 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
244 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
245 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
246 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
247 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
248 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
249 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
250 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
251 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
252 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
253 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
254 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
255 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
256 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
257 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
258 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
259 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
260 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
261 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
262 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
263 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
264 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
265 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
266 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
267 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
268 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
269 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
270 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
271 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
272 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
273 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
274 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
275 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
276 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
277 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
278 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
279 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
280 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
281 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
282 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
283 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
284 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
285 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
286 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
287 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
288 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
289 2547132374 Acidovorax radicis N35 Isolate Unclassified
290 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
291 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
292 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
293 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
294 2643221570 Acidovorax sp. Root568 Isolate Unclassified
295 2643221596 Acidovorax sp. Root70 Isolate Unclassified
296 2643221609 Acidovorax sp. Root217 Isolate Unclassified
297 2643221611 Acidovorax sp. Root219 Isolate Unclassified
298 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
299 2643221652 Acidovorax sp. Root402 Isolate Unclassified
300 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
301 2643221658 Variovorax sp. Root411 Isolate Unclassified
302 2643221672 Variovorax sp. Root434 Isolate Unclassified
303 2643221683 Variovorax sp. Root473 Isolate Unclassified
304 2643221717 Acidovorax sp. Root267 Isolate Unclassified
305 2738541277 Variovorax sp. GV051 Isolate Unclassified
306 2738541307 Variovorax sp. GV008 Isolate Unclassified
307 2738543012 Acidovorax sp. CF301 Isolate Unclassified
308 2738543019 Variovorax sp. GV040 Isolate Unclassified
309 2816332133 Acidovorax radicis 2721A Isolate Unclassified
310 2818991446 Variovorax sp. 1180 Isolate Unclassified
311 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
312 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
313 2842677519 Variovorax sp. R-72495 Isolate Unclassified
314 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
315 2842747753 Variovorax sp. R-72060 Isolate Unclassified
316 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
317 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
318 2885198086 Variovorax sp. 679 Isolate Unclassified
319 2885211737 Variovorax sp. 553 Isolate Unclassified
320 2899924645 Variovorax sp. 369 Isolate Unclassified
321 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
322 2904456579 Variovorax sp. 2002 Isolate Unclassified
323 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
324 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
325 2928037797 Variovorax sp. 1126 Isolate Unclassified
326 2928044640 Variovorax sp. 1128 Isolate Unclassified
327 2928051484 Variovorax sp. 1133 Isolate Unclassified
328 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
329 2928070936 Variovorax gossypii 1167 Isolate Unclassified
330 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
331 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
332 2929520902 Variovorax beijingensis 502 Isolate Unclassified
333 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
334 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
335 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
336 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
337 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
338 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
339 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.47
Metatranscriptomes 0.49
Isolates 11.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 26.85
Nodule 0.99
Rhizoplane 2.8
Rhizosphere 57.66
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207694_10017930 3300025924 Bacteria 5351
2 JGI24740J21852_10038452 3300001979 Bacteria 1468
3 JGI24739J22299_10006667 3300001989 Bacteria 4345
4 JGI24739J22299_10035608 3300001989 Bacteria 1686
5 JGI25151J46595_10003087 3300003187 Bacteria 9388
6 Ga0006562J51391_1110138 3300003578 Bacteria 3620
7 Ga0055535_1001456 3300003761 Bacteria 11948
8 Ga0055542_1000003 3300003762 Bacteria 582721
9 Ga0055537_1001922 3300003773 Bacteria 7437
10 Ga0055536_1002577 3300003781 Bacteria 10092
11 Ga0055536_1010222 3300003781 Bacteria 3754
12 Ga0055534_1000008 3300003784 Bacteria 211098
13 Ga0055528_1000170 3300003790 Bacteria 54883
14 Ga0055530_10000292 3300003791 Bacteria 45623
15 Ga0055530_10007508 3300003791 Bacteria 4574
16 Ga0055540_1001010 3300003792 Bacteria 18032
17 Ga0055540_1002374 3300003792 Bacteria 10048
18 Ga0055540_1005976 3300003792 Bacteria 4941
19 Ga0055540_1007595 3300003792 Bacteria 4057
20 Ga0055531_10001140 3300003794 Bacteria 20572
21 Ga0055531_10001626 3300003794 Bacteria 16291
22 Ga0065714_10003497 3300005288 Bacteria 7102
23 Ga0065714_10009417 3300005288 Bacteria 2778
24 Ga0065704_10125337 3300005289 Bacteria 1704
25 Ga0070676_10001898 3300005328 Bacteria 10623
26 Ga0070676_10008826 3300005328 Bacteria 5442
27 Ga0070676_10013570 3300005328 Bacteria 4466
28 Ga0070676_10212421 3300005328 Bacteria 1274
29 Ga0070670_100055393 3300005331 Bacteria 3404
30 Ga0070677_10010567 3300005333 Bacteria 3161
31 Ga0070677_10018826 3300005333 Bacteria 2493
32 Ga0068869_100003901 3300005334 Bacteria 9200
33 Ga0068869_100012322 3300005334 Bacteria 5648
34 Ga0070666_10046631 3300005335 Bacteria 2907
35 Ga0068868_100107600 3300005338 Bacteria 2263
36 Ga0068868_100232470 3300005338 Bacteria 1547
37 Ga0068868_100344701 3300005338 Bacteria 1275
38 Ga0070689_100107303 3300005340 Bacteria 2217
39 Ga0070661_100206362 3300005344 Bacteria 1503
40 Ga0070675_100003113 3300005354 Bacteria 12541
41 Ga0070675_100130955 3300005354 Bacteria 2138
42 Ga0070671_100028482 3300005355 Bacteria 4599
43 Ga0070671_100054735 3300005355 Bacteria 3318
44 Ga0070674_100001813 3300005356 Bacteria 11593
45 Ga0070673_100004630 3300005364 Bacteria 8723
46 Ga0070673_100322224 3300005364 Bacteria 1365
47 Ga0070667_100006775 3300005367 Bacteria 9512
48 Ga0070667_100031717 3300005367 Bacteria 4404
49 Ga0070663_100005578 3300005455 Bacteria 7493
50 Ga0070663_100052115 3300005455 Bacteria 2918
51 Ga0070662_100017064 3300005457 Bacteria 4886
52 Ga0070662_100139241 3300005457 Bacteria 1879
53 Ga0070662_100184062 3300005457 Bacteria 1648
54 Ga0068867_100029643 3300005459 Bacteria 3943
55 Ga0068867_100059306 3300005459 Bacteria 2837
56 Ga0070672_100005324 3300005543 Bacteria 8521
57 Ga0070672_100006932 3300005543 Bacteria 7659
58 Ga0070672_100033711 3300005543 Bacteria 3880
59 Ga0070672_100073991 3300005543 Bacteria 2716
60 Ga0070665_100020973 3300005548 Bacteria 6568
61 Ga0070665_100174926 3300005548 Bacteria 2147
62 Ga0070665_100259542 3300005548 Bacteria 1739
63 Ga0068855_100452673 3300005563 Bacteria 1400
64 Ga0070664_100029390 3300005564 Bacteria 4582
65 Ga0070664_100238184 3300005564 Bacteria 1633
66 Ga0068857_100005597 3300005577 Bacteria 10734
67 Ga0068857_100025871 3300005577 Bacteria 5168
68 Ga0068857_100052976 3300005577 Bacteria 3600
69 Ga0068854_100133847 3300005578 Bacteria 1896
70 Ga0068852_100085795 3300005616 Bacteria 2805
71 Ga0068852_100094212 3300005616 Bacteria 2686
72 Ga0068859_100090339 3300005617 Bacteria 3114
73 Ga0068864_100002220 3300005618 Bacteria 16047
74 Ga0068864_100102048 3300005618 Bacteria 2545
75 Ga0068851_10000564 3300005834 Bacteria 16153
76 Ga0068863_100027767 3300005841 Bacteria 5401
77 Ga0068860_100005401 3300005843 Bacteria 12967
78 Ga0068860_100170592 3300005843 Bacteria 2101
79 Ga0068860_100273919 3300005843 Bacteria 1648
80 Ga0068862_100030075 3300005844 Bacteria 4576
81 Ga0068862_100058889 3300005844 Bacteria 3296
82 Ga0068862_100326814 3300005844 Bacteria 1417
83 Ga0075365_10008719 3300006038 Bacteria 5779
84 Ga0075368_10001317 3300006042 Bacteria 7857
85 Ga0075368_10011263 3300006042 Bacteria 3251
86 Ga0075363_100003026 3300006048 Bacteria 7036
87 Ga0075363_100012413 3300006048 Bacteria 4106
88 Ga0075363_100012835 3300006048 Bacteria 4045
89 Ga0075364_10000165 3300006051 Bacteria 29462
90 Ga0075364_10007952 3300006051 Bacteria 6317
91 Ga0075364_10011256 3300006051 Bacteria 5431
92 Ga0075364_10017227 3300006051 Bacteria 4510
93 Ga0075432_10003022 3300006058 Bacteria 5673
94 Ga0075432_10006440 3300006058 Bacteria 3995
95 Ga0075362_10005439 3300006177 Bacteria 4660
96 Ga0075362_10043641 3300006177 Bacteria 1985
97 Ga0075367_10005218 3300006178 Bacteria 6420
98 Ga0075369_10003289 3300006186 Bacteria 5870
99 Ga0075366_10000512 3300006195 Bacteria 17914
100 Ga0075366_10001615 3300006195 Bacteria 11295
101 Ga0075366_10007653 3300006195 Bacteria 5977
102 Ga0075366_10020374 3300006195 Bacteria 3848
103 Ga0075366_10045159 3300006195 Bacteria 2611
104 Ga0075366_10182856 3300006195 Bacteria 1273
105 Ga0075370_10000867 3300006353 Bacteria 12306
106 Ga0075370_10002120 3300006353 Bacteria 9052
107 Ga0075370_10003491 3300006353 Bacteria 7490
108 Ga0075370_10014520 3300006353 Bacteria 4203
109 Ga0075370_10033208 3300006353 Bacteria 2888
110 Ga0075370_10033330 3300006353 Bacteria 2883
111 Ga0075370_10145934 3300006353 Bacteria 1385
112 Ga0075370_10155857 3300006353 Bacteria 1339
113 Ga0068871_100059356 3300006358 Bacteria 3117
114 Ga0075430_100039277 3300006846 Bacteria 4008
115 Ga0068865_100004212 3300006881 Bacteria 8668
116 Ga0068865_100045188 3300006881 Bacteria 3018
117 Ga0097620_100090341 3300006931 Bacteria 3114
118 Ga0079104_1025453 3300006946 Bacteria 1544
119 Ga0099826_10000134 3300006948 Bacteria 31806
120 Ga0099826_10000249 3300006948 Bacteria 23710
121 Ga0105244_10001068 3300009036 Bacteria 22905
122 Ga0105240_10094193 3300009093 Bacteria 3654
123 Ga0105245_10024599 3300009098 Bacteria 5289
124 Ga0105245_10249530 3300009098 Bacteria 1724
125 Ga0105243_10002328 3300009148 Bacteria 15901
126 Ga0105243_10006470 3300009148 Bacteria 9059
127 Ga0105243_10006784 3300009148 Bacteria 8829
128 Ga0105243_10051046 3300009148 Bacteria 3269
129 Ga0105242_10198852 3300009176 Bacteria 1779
130 Ga0105248_10037029 3300009177 Bacteria 5456
131 Ga0105248_10063949 3300009177 Bacteria 4130
132 Ga0105237_10000646 3300009545 Bacteria 48623
133 Ga0105237_10023146 3300009545 Bacteria 6369
134 Ga0105238_10080945 3300009551 Bacteria 3237
135 Ga0105249_10021293 3300009553 Bacteria 5805
136 Ga0105249_10024618 3300009553 Bacteria 5411
137 Ga0105239_10002203 3300010375 Bacteria 25060
138 Ga0105239_10226401 3300010375 Bacteria 2098
139 Ga0105246_10066431 3300011119 Bacteria 2525
140 Ga0157347_1001474 3300012502 Bacteria 1853
141 Ga0157370_10001540 3300013104 Bacteria 28519
142 Ga0157369_10101715 3300013105 Bacteria 3062
143 Ga0157369_10177377 3300013105 Bacteria 2243
144 Ga0157374_10042643 3300013296 Bacteria 4186
145 Ga0157378_10474269 3300013297 Bacteria 1246
146 Ga0157378_10507931 3300013297 Bacteria 1205
147 Ga0163162_10006139 3300013306 Bacteria 11629
148 Ga0163162_10169161 3300013306 Bacteria 2310
149 Ga0163162_10175551 3300013306 Bacteria 2268
150 Ga0163162_10282850 3300013306 Bacteria 1791
151 Ga0157372_10014394 3300013307 Bacteria 8460
152 Ga0157375_10010413 3300013308 Bacteria 8188
153 Ga0157375_10016070 3300013308 Bacteria 6714
154 Ga0157380_10294501 3300014326 Bacteria 1492
155 Ga0182008_10004254 3300014497 Bacteria 8391
156 Ga0182008_10009875 3300014497 Bacteria 5131
157 Ga0182008_10078989 3300014497 Bacteria 1619
158 Ga0157376_10000620 3300014969 Bacteria 22978
159 Ga0157376_10017903 3300014969 Bacteria 5417
160 Ga0157376_10054952 3300014969 Bacteria 3321
161 Ga0182006_1004191 3300015261 Bacteria 7151
162 Ga0182006_1006968 3300015261 Bacteria 5201
163 Ga0182006_1043588 3300015261 Bacteria 1753
164 Ga0182007_10001485 3300015262 Bacteria 12546
165 Ga0182007_10002591 3300015262 Bacteria 8899
166 Ga0183362_10007 3300015683 Bacteria 240101
167 Ga0163161_10000105 3300017792 Bacteria 80620
168 Ga0163161_10000657 3300017792 Bacteria 27646
169 Ga0163161_10004139 3300017792 Bacteria 10141
170 Ga0163161_10008072 3300017792 Bacteria 7278
171 Ga0163161_10029066 3300017792 Bacteria 3929
172 Ga0163161_10037658 3300017792 Bacteria 3468
173 Ga0209672_101644 3300025228 Bacteria 7333
174 Ga0209147_100439 3300025229 Bacteria 26588
175 Ga0209258_100015 3300025242 Bacteria 706310
176 Ga0207425_1000234 3300025245 Bacteria 42951
177 Ga0209148_1000028 3300025254 Bacteria 582773
178 Ga0209129_1000049 3300025258 Bacteria 268086
179 Ga0209129_1007065 3300025258 Bacteria 3437
180 Ga0209565_1000042 3300025263 Bacteria 239712
181 Ga0209565_1000108 3300025263 Bacteria 120719
182 Ga0209565_1000337 3300025263 Bacteria 41609
183 Ga0209673_1000071 3300025273 Bacteria 239966
184 Ga0209673_1000193 3300025273 Bacteria 123134
185 Ga0209673_1000477 3300025273 Bacteria 66849
186 Ga0209673_1000817 3300025273 Bacteria 41131
187 Ga0209673_1004323 3300025273 Bacteria 7666
188 Ga0209673_1006959 3300025273 Bacteria 5338
189 Ga0209673_1019620 3300025273 Bacteria 2421
190 Ga0209130_1000267 3300025284 Bacteria 65435
191 Ga0209130_1006443 3300025284 Bacteria 3814
192 Ga0209675_1000041 3300025291 Bacteria 239712
193 Ga0209675_1000163 3300025291 Bacteria 81884
194 Ga0209675_1000398 3300025291 Bacteria 36047
195 Ga0209675_1003589 3300025291 Bacteria 7295
196 Ga0209675_1014431 3300025291 Bacteria 2406
197 Ga0209676_1000137 3300025292 Bacteria 179437
198 Ga0209676_1000173 3300025292 Bacteria 153411
199 Ga0209676_1000903 3300025292 Bacteria 37397
200 Ga0209676_1001273 3300025292 Bacteria 26119
201 Ga0209676_1022273 3300025292 Bacteria 2104
202 Ga0209676_1029668 3300025292 Bacteria 1685
203 Ga0209025_1000409 3300025294 Bacteria 86577
204 Ga0209025_1000481 3300025294 Bacteria 77405
205 Ga0209025_1000707 3300025294 Bacteria 56879
206 Ga0209025_1005325 3300025294 Bacteria 10565
207 Ga0209025_1013704 3300025294 Bacteria 5067
208 Ga0209025_1044238 3300025294 Bacteria 1864
209 Ga0209025_1047275 3300025294 Bacteria 1759
210 Ga0209564_1000232 3300025295 Bacteria 122080
211 Ga0209564_1001382 3300025295 Bacteria 25319
212 Ga0209758_1000135 3300025297 Bacteria 177753
213 Ga0209758_1004899 3300025297 Bacteria 10766
214 Ga0209050_1000015 3300025298 Bacteria 759102
215 Ga0209050_1000936 3300025298 Bacteria 38151
216 Ga0209256_1000129 3300025299 Bacteria 163766
217 Ga0209256_1000604 3300025299 Bacteria 49837
218 Ga0209256_1020864 3300025299 Bacteria 2030
219 Ga0207426_1000171 3300025302 Bacteria 163766
220 Ga0207426_1000185 3300025302 Bacteria 154146
221 Ga0209051_1000010 3300025303 Bacteria 641298
222 Ga0209051_1000137 3300025303 Bacteria 137784
223 Ga0209051_1000172 3300025303 Bacteria 117180
224 Ga0209051_1000282 3300025303 Bacteria 82787
225 Ga0209051_1000556 3300025303 Bacteria 45471
226 Ga0209051_1000940 3300025303 Bacteria 28752
227 Ga0209051_1033120 3300025303 Bacteria 1959
228 Ga0209257_1000015 3300025304 Bacteria 908141
229 Ga0209257_1000026 3300025304 Bacteria 723225
230 Ga0209257_1000108 3300025304 Bacteria 240229
231 Ga0209257_1000205 3300025304 Bacteria 143735
232 Ga0207655_1000800 3300025728 Bacteria 34234
233 Ga0207682_10033531 3300025893 Bacteria 2068
234 Ga0207682_10058074 3300025893 Bacteria 1614
235 Ga0207682_10087063 3300025893 Bacteria 1348
236 Ga0207688_10166059 3300025901 Bacteria 1311
237 Ga0207645_10004343 3300025907 Bacteria 10500
238 Ga0207645_10036430 3300025907 Bacteria 3158
239 Ga0207645_10036921 3300025907 Bacteria 3138
240 Ga0207645_10133303 3300025907 Bacteria 1617
241 Ga0207643_10148821 3300025908 Bacteria 1402
242 Ga0207643_10155001 3300025908 Bacteria 1376
243 Ga0207705_10178452 3300025909 Bacteria 1602
244 Ga0207695_10028147 3300025913 Bacteria 6239
245 Ga0207695_10143317 3300025913 Bacteria 2336
246 Ga0207671_10056167 3300025914 Bacteria 2917
247 Ga0207671_10114799 3300025914 Bacteria 2053
248 Ga0207657_10082967 3300025919 Bacteria 2689
249 Ga0207681_10017900 3300025923 Bacteria 4455
250 Ga0207681_10298678 3300025923 Bacteria 1273
251 Ga0207694_10022957 3300025924 Bacteria 4734
252 Ga0207650_10193322 3300025925 Bacteria 1627
253 Ga0207659_10021020 3300025926 Bacteria 4325
254 Ga0207659_10112316 3300025926 Bacteria 2073
255 Ga0207687_10041056 3300025927 Bacteria 3174
256 Ga0207644_10078424 3300025931 Bacteria 2434
257 Ga0207690_10049213 3300025932 Bacteria 2808
258 Ga0207706_10017095 3300025933 Bacteria 6540
259 Ga0207706_10268549 3300025933 Bacteria 1489
260 Ga0207709_10000285 3300025935 Bacteria 57630
261 Ga0207709_10000461 3300025935 Bacteria 37464
262 Ga0207709_10000947 3300025935 Bacteria 21689
263 Ga0207709_10002463 3300025935 Bacteria 11620
264 Ga0207709_10033346 3300025935 Bacteria 3023
265 Ga0207709_10039546 3300025935 Bacteria 2818
266 Ga0207670_10036817 3300025936 Bacteria 3185
267 Ga0207670_10121864 3300025936 Bacteria 1897
268 Ga0207704_10065099 3300025938 Bacteria 2281
269 Ga0207704_10066918 3300025938 Bacteria 2258
270 Ga0207691_10004921 3300025940 Bacteria 12890
271 Ga0207691_10009917 3300025940 Bacteria 9143
272 Ga0207691_10028236 3300025940 Bacteria 5255
273 Ga0207691_10029522 3300025940 Bacteria 5129
274 Ga0207711_10127826 3300025941 Bacteria 2275
275 Ga0207689_10003961 3300025942 Bacteria 13485
276 Ga0207689_10016702 3300025942 Bacteria 6211
277 Ga0207689_10055180 3300025942 Bacteria 3271
278 Ga0207689_10077267 3300025942 Bacteria 2737
279 Ga0207679_10340450 3300025945 Bacteria 1304
280 Ga0207667_10254641 3300025949 Bacteria 1796
281 Ga0207651_10345335 3300025960 Bacteria 1251
282 Ga0207712_10050226 3300025961 Bacteria 2911
283 Ga0207712_10072717 3300025961 Bacteria 2477
284 Ga0207668_10065118 3300025972 Bacteria 2578
285 Ga0207658_10153403 3300025986 Bacteria 1879
286 Ga0207658_10154700 3300025986 Bacteria 1872
287 Ga0207658_10276019 3300025986 Bacteria 1439
288 Ga0207677_10058419 3300026023 Bacteria 2655
289 Ga0207677_10067003 3300026023 Bacteria 2513
290 Ga0207677_10104078 3300026023 Bacteria 2097
291 Ga0207677_10105653 3300026023 Bacteria 2084
292 Ga0207703_10011615 3300026035 Bacteria 6846
293 Ga0207703_10088027 3300026035 Bacteria 2605
294 Ga0207703_10224897 3300026035 Bacteria 1680
295 Ga0207639_10048548 3300026041 Bacteria 3214
296 Ga0207639_10063026 3300026041 Bacteria 2869
297 Ga0207639_10189606 3300026041 Bacteria 1755
298 Ga0207678_10034625 3300026067 Bacteria 4398
299 Ga0207708_10013465 3300026075 Bacteria 6115
300 Ga0207648_10004164 3300026089 Bacteria 14964
301 Ga0207648_10010452 3300026089 Bacteria 8794
302 Ga0207648_10010854 3300026089 Bacteria 8610
303 Ga0207648_10197131 3300026089 Bacteria 1786
304 Ga0207676_10014655 3300026095 Bacteria 5645
305 Ga0207676_10493655 3300026095 Bacteria 1161
306 Ga0207674_10009080 3300026116 Bacteria 11416
307 Ga0207674_10062409 3300026116 Bacteria 3764
308 Ga0207674_10091279 3300026116 Bacteria 3036
309 Ga0207675_100014546 3300026118 Bacteria 7336
310 Ga0207683_10023567 3300026121 Bacteria 5295
311 Ga0207698_10024342 3300026142 Bacteria 4248
312 Ga0207698_10053831 3300026142 Bacteria 3092
313 Ga0209281_1018037 3300027111 Bacteria 1419
314 Ga0209282_1001604 3300027666 Bacteria 12525
315 Ga0209813_10000936 3300027866 Bacteria 6553
316 Ga0207428_10066176 3300027907 Bacteria 2848
317 Ga0268266_10026929 3300028379 Bacteria 4891
318 Ga0268266_10207934 3300028379 Bacteria 1794
319 Ga0268266_10299215 3300028379 Bacteria 1500
320 Ga0268266_10323096 3300028379 Bacteria 1445
321 Ga0268265_10026846 3300028380 Bacteria 4101
322 Ga0268265_10066913 3300028380 Bacteria 2779
323 Ga0268264_10010530 3300028381 Bacteria 7647
324 Ga0307517_10013720 3300028786 Bacteria 10974
325 Ga0307515_10136841 3300028794 Bacteria 2657
326 Ga0307512_10177253 3300030522 Bacteria 1206
327 Ga0316177_1018459 3300030731 Bacteria 2832
328 Ga0316177_1186399 3300030731 Bacteria 8418
329 Ga0316176_1116172 3300030732 Bacteria 2909
330 Ga0314311_1007245 3300030733 Bacteria 3259
331 Ga0316179_1087037 3300030734 Bacteria 3711
332 Ga0316179_1094680 3300030734 Bacteria 2243
333 Ga0316178_1028671 3300030735 Bacteria 6060
334 Ga0316178_1040279 3300030735 Bacteria 4656
335 Ga0316180_1145328 3300030736 Bacteria 3201
336 Ga0316183_1127478 3300030742 Bacteria 3185
337 Ga0316181_1178495 3300030744 Bacteria 3336
338 Ga0316182_1061027 3300030745 Bacteria 4265
339 Ga0316182_1203815 3300030745 Bacteria 1937
340 Ga0307513_10048430 3300031456 Bacteria 4613
341 Ga0307513_10074516 3300031456 Bacteria 3529
342 Ga0307509_10002279 3300031507 Bacteria 31377
343 Ga0307408_100000107 3300031548 Bacteria 91378
344 Ga0307408_100079691 3300031548 Bacteria 2444
345 Ga0307408_100332050 3300031548 Bacteria 1284
346 Ga0307508_10173327 3300031616 Bacteria 1760
347 Ga0307514_10003232 3300031649 Bacteria 15916
348 Ga0307514_10007285 3300031649 Bacteria 9538
349 Ga0307514_10207142 3300031649 Bacteria 1223
350 Ga0307516_10102694 3300031730 Bacteria 2673
351 Ga0307405_10016902 3300031731 Bacteria 3991
352 Ga0307405_10126774 3300031731 Bacteria 1756
353 Ga0307413_10061787 3300031824 Bacteria 2314
354 Ga0307413_10076246 3300031824 Bacteria 2130
355 Ga0307410_10255742 3300031852 Bacteria 1364
356 Ga0307406_10000661 3300031901 Bacteria 19533
357 Ga0307412_10002986 3300031911 Bacteria 9375
358 Ga0307412_10008062 3300031911 Bacteria 6002
359 Ga0307412_10172074 3300031911 Bacteria 1620
360 Ga0307412_10406759 3300031911 Bacteria 1109
361 Ga0307409_100109085 3300031995 Bacteria 2317
362 Ga0307416_100003175 3300032002 Bacteria 9634
363 Ga0307416_100012183 3300032002 Bacteria 5778
364 Ga0307416_100100327 3300032002 Bacteria 2517
365 Ga0307414_10094954 3300032004 Bacteria 2227
366 Ga0307411_10051507 3300032005 Bacteria 2686
367 Ga0307411_10071529 3300032005 Bacteria 2351
368 Ga0307411_10103365 3300032005 Bacteria 2021
369 Ga0307411_10123207 3300032005 Bacteria 1880
370 Ga0307411_10299804 3300032005 Bacteria 1288
371 Ga0307510_10049948 3300033180 Bacteria 4443
372 Ga0439436_0000461 3300041404 Bacteria 10431
373 Ga0439436_0016572 3300041404 Bacteria 2209
374 Ga0439439_0004279 3300041406 Bacteria 3208
375 Ga0439466_0000370 3300041411 Bacteria 17330
376 Ga0439466_0029204 3300041411 Bacteria 1899
377 Ga0439466_0037424 3300041411 Bacteria 1633
378 Ga0439465_0000199 3300041413 Bacteria 15833
379 Ga0451807_1667229 3300041486 Bacteria 2515
380 Ga0439431_0000478 3300041997 Bacteria 8489
381 Ga0439445_0002298 3300042004 Bacteria 4242
382 Ga0439432_001585 3300042006 Bacteria 8506
383 Ga0439449_0001060 3300042007 Bacteria 10844
384 Ga0439449_0019049 3300042007 Bacteria 2574
385 Ga0439449_0024679 3300042007 Bacteria 2247
386 Ga0439452_001693 3300042010 Bacteria 8662
387 Ga0439452_011220 3300042010 Bacteria 2582
388 Ga0439457_013756 3300042014 Bacteria 1816
389 Ga0439462_0003937 3300042015 Bacteria 3592
390 Ga0450920_008288 3300042122 Bacteria 1897
391 Ga0450923_001454 3300042125 Bacteria 3146
392 Ga0450898_007825 3300042134 Bacteria 1672
393 Ga0450910_000577 3300042147 Bacteria 4347
394 Ga0439446_0000308 3300042156 Bacteria 9302
395 Ga0450908_005075 3300042184 Bacteria 2525
396 Ga0439434_0002154 3300042435 Bacteria 5705
397 Ga0439434_0003511 3300042435 Bacteria 4579
398 Ga0439434_0004467 3300042435 Bacteria 4090
399 Ga0450918_001276 3300042531 Bacteria 5105
400 Ga0450918_002797 3300042531 Bacteria 3275
401 Ga0453683_0000780 3300044673 Bacteria 31494
402 Ga0466965_0015179 3300044683 Bacteria 3658
403 Ga0466957_0075912 3300044842 Bacteria 2086
404 Ga0451576_0009504 3300045051 Bacteria 11268
405 Ga0495627_002946 3300046453 Bacteria 7812
406 Ga0495592_0000517 3300046454 Bacteria 27891
407 Ga0495638_0006974 3300046460 Bacteria 8156
408 Ga0495638_0122453 3300046460 Bacteria 1535
409 Ga0495650_0008538 3300046471 Bacteria 5959
410 Ga0495610_0035017 3300046512 Bacteria 2581
411 Ga0495616_0002046 3300046513 Bacteria 13550
412 Ga0495616_0005573 3300046513 Bacteria 7723
413 Ga0495620_0015248 3300046515 Bacteria 3883
414 Ga0495620_0035368 3300046515 Bacteria 2246
415 Ga0495631_0000427 3300046518 Bacteria 29158
416 Ga0495631_0002961 3300046518 Bacteria 9401
417 Ga0495637_0065529 3300046520 Bacteria 1478
418 Ga0495642_0032268 3300046528 Bacteria 2101
419 Ga0495654_0021356 3300046530 Bacteria 3368
420 Ga0495654_0037385 3300046530 Bacteria 2435
421 Ga0495621_0019335 3300046539 Bacteria 2223
422 Ga0495621_0077047 3300046539 Bacteria 1238
423 Ga0495597_0000481 3300046542 Bacteria 33500
424 Ga0495597_0012490 3300046542 Bacteria 4098
425 Ga0495622_0142163 3300046557 Bacteria 1089
426 Ga0495656_0000049 3300046615 Bacteria 56829
427 Ga0495656_0000085 3300046615 Bacteria 41208
428 Ga0495656_0060099 3300046615 Bacteria 1655
429 Ga0495668_0083353 3300046616 Bacteria 1754
430 Ga0495625_0000510 3300046660 Bacteria 57454
431 Ga0495588_0022932 3300046674 Bacteria 3086
432 Ga0495588_0174797 3300046674 Bacteria 1135
433 Ga0495647_0132851 3300046681 Bacteria 1056
434 Ga0495658_0050677 3300046683 Bacteria 2349
435 Ga0495671_0029485 3300046692 Bacteria 2817
436 Ga0495676_0031109 3300047321 Bacteria 4518
437 Ga0495687_000174 3300047443 Bacteria 95031
438 Ga0495673_0070263 3300047469 Bacteria 1475
439 Ga0495686_0008230 3300047472 Bacteria 7688
440 Ga0495593_0001431 3300047673 Bacteria 14002
441 Ga0495593_0024984 3300047673 Bacteria 3305
442 Ga0495614_0005534 3300048089 Bacteria 5696
443 Ga0495615_0030969 3300048090 Bacteria 1280
444 Ga0496100_0037433 3300048903 Bacteria 3067
445 Ga0496101_0005762 3300048904 Bacteria 7918
446 Ga0496101_0025299 3300048904 Bacteria 4117
447 Ga0496102_0039763 3300048905 Bacteria 4251
448 Ga0496104_0001525 3300048907 Bacteria 19971
449 Ga0496105_0017531 3300048908 Bacteria 5744
450 Ga0496106_0177502 3300048909 Bacteria 1690
451 Ga0496108_0116478 3300048911 Bacteria 2289
452 Ga0496108_0259899 3300048911 Bacteria 1511
453 Ga0496109_0143149 3300048912 Bacteria 2236
454 Ga0496113_0166978 3300048916 Bacteria 1742
455 Ga0496114_0028241 3300048917 Bacteria 4602
456 Ga0496114_0029435 3300048917 Bacteria 4514
457 Ga0496116_0016711 3300048919 Bacteria 5730
458 Ga0496116_0016940 3300048919 Bacteria 5681
459 Ga0496116_0020933 3300048919 Bacteria 4948
460 Ga0496117_0034891 3300048920 Bacteria 3783
461 Ga0496118_0017790 3300048921 Bacteria 6451
462 Ga0496121_0052422 3300048924 Bacteria 3427
463 Ga0496121_0209169 3300048924 Bacteria 1383
464 Ga0496122_0001461 3300048925 Bacteria 38115
465 Ga0496122_0039176 3300048925 Bacteria 3782
466 Ga0496122_0051792 3300048925 Bacteria 3115
467 Ga0496123_0000179 3300048926 Bacteria 127833
468 Ga0496124_0133997 3300048927 Bacteria 1964
469 Ga0496124_0187489 3300048927 Bacteria 1586
470 Ga0496124_0230195 3300048927 Bacteria 1386
471 Ga0496125_0013608 3300048928 Bacteria 7988
472 Ga0496126_0199607 3300048929 Bacteria 1690
473 Ga0501316_010581 3300049532 Bacteria 1051
474 Ga0501320_008749 3300049536 Bacteria 1002
475 Ga0501198_000007 3300049649 Bacteria 129700
476 Ga0501222_000005 3300049662 Bacteria 129724
477 Ga0501249_001358 3300049679 Bacteria 5081
478 Ga0501252_006050 3300049682 Bacteria 1335
479 Ga0501225_0004140 3300049705 Bacteria 4337
480 Ga0501225_0011031 3300049705 Bacteria 2548
481 Ga0501262_000063 3300049759 Bacteria 12833
482 Ga0501265_002659 3300049762 Bacteria 2024
483 nmdc:mga03683_10934_c1 3300050489 Bacteria 3267
484 nmdc:mga03683_27735_c1 3300050489 Bacteria 2246
485 nmdc:mga03683_8009_c1 3300050489 Bacteria 3695
486 nmdc:mga03n38_2482_c1 3300050490 Bacteria 5705
487 nmdc:mga03n38_47634_c1 3300050490 Bacteria 1898
488 nmdc:mga00v17_11115_c2 3300050491 Bacteria 3980
489 nmdc:mga00v17_139184_c1 3300050491 Bacteria 1555
490 nmdc:mga00v17_317_c1 3300050491 Bacteria 27435
491 nmdc:mga00v17_39405_c1 3300050491 Bacteria 2830
492 nmdc:mga0yw44_35681_c1 3300050492 Bacteria 2924
493 nmdc:mga0yw44_94_c1 3300050492 Bacteria 31091
494 nmdc:mga0yw44_9647_c1 3300050492 Bacteria 4897
495 nmdc:mga0k408_1174_c1 3300050493 Bacteria 14328
496 nmdc:mga0k408_16301_c1 3300050493 Bacteria 4121
497 nmdc:mga0k408_22350_c1 3300050493 Bacteria 3561
498 nmdc:mga0k408_33839_c1 3300050493 Bacteria 2924
499 nmdc:mga0k408_39_c1 3300050493 Bacteria 66292
500 nmdc:mga0k408_729_c1 3300050493 Bacteria 18040
501 nmdc:mga0k408_7527_c1 3300050493 Bacteria 5816
502 nmdc:mga0k408_892_c1 3300050493 Bacteria 16353
503 nmdc:mga06z11_2023_c1 3300050494 Bacteria 7683
504 nmdc:mga04h51_20715_c1 3300050495 Bacteria 1968
505 nmdc:mga07m45_1487_c1 3300050496 Bacteria 10762
506 nmdc:mga07m45_2277_c1 3300050496 Bacteria 8971
507 nmdc:mga07m45_2527_c1 3300050496 Bacteria 8588
508 nmdc:mga07m45_25445_c1 3300050496 Bacteria 3245
509 nmdc:mga07m45_28479_c1 3300050496 Bacteria 3084
510 nmdc:mga07m45_4514_c1 3300050496 Bacteria 6816
511 nmdc:mga07m45_7356_c1 3300050496 Bacteria 5622
512 nmdc:mga07m45_75487_c1 3300050496 Bacteria 1921
513 nmdc:mga07m45_85981_c1 3300050496 Bacteria 1798
514 nmdc:mga07m45_8928_c1 3300050496 Bacteria 5176
515 Ga0500610_0021134 3300053079 Bacteria 3188
516 Ga0500578_0023973 3300053086 Bacteria 3919
517 Ga0500643_003877 3300053087 Bacteria 6960
518 Ga0500651_0000167 3300053093 Bacteria 42663
519 Ga0500651_0000674 3300053093 Bacteria 17006
520 Ga0500651_0019730 3300053093 Bacteria 4193
521 Ga0500566_0008966 3300053094 Bacteria 5914
522 Ga0500641_0159562 3300053096 Bacteria 973
523 Ga0500571_000040 3300053110 Bacteria 40510
524 Ga0500593_000457 3300053117 Bacteria 16194
525 Ga0500593_001045 3300053117 Bacteria 10033
526 Ga0500594_0004090 3300053118 Bacteria 3211
527 Ga0500608_052164 3300053122 Bacteria 1964
528 Ga0500655_000054 3300053133 Bacteria 31184
529 Ga0500559_0000558 3300053136 Bacteria 25786
530 Ga0500568_0001897 3300053139 Bacteria 12852
531 Ga0500568_0002834 3300053139 Bacteria 10004
532 Ga0500574_000536 3300053141 Bacteria 4880
533 Ga0500574_001350 3300053141 Bacteria 3618
534 Ga0500616_0051182 3300053153 Bacteria 2177
535 Ga0500622_0002629 3300053156 Bacteria 12769
536 Ga0500627_0001970 3300053158 Bacteria 5914
537 Ga0500627_0023110 3300053158 Bacteria 2530
538 Ga0500638_000197 3300053162 Bacteria 12463
539 Ga0500645_002647 3300053730 Bacteria 7819
540 2513227852 2513020051 Bacteria 6053213
541 2548499496 2547132374 Bacteria 5530232
542 2599621986 2599185214 Bacteria 8209958
543 2599676849 2599185226 Bacteria 8233575
544 2599685179 2599185227 Bacteria 8246414
545 2599691496 2599185229 Bacteria 8216126
546 2643866326 2643221570 Bacteria 5103772
547 2643994315 2643221596 Bacteria 5006805
548 2644057425 2643221609 Bacteria 6756331
549 2644072486 2643221611 Bacteria 6820941
550 2644159183 2643221628 Bacteria 5745828
551 2644161534 2643221628 Bacteria 5745828
552 2644293147 2643221652 Bacteria 5140275
553 2644301179 2643221654 Bacteria 5273570
554 2644326959 2643221658 Bacteria 6064537
555 2644327410 2643221658 Bacteria 6064537
556 2644398759 2643221672 Bacteria 6322190
557 2644464628 2643221683 Bacteria 5749203
558 2644465498 2643221683 Bacteria 5749203
559 2644466444 2643221683 Bacteria 5749203
560 2644648160 2643221717 Bacteria 5676132
561 2738721957 2738541277 Bacteria 7458140
562 2738880195 2738541307 Bacteria 8606193
563 2738882124 2738541307 Bacteria 8606193
564 2739241696 2738543012 Bacteria 7115078
565 2739282321 2738543019 Bacteria 7459457
566 2816470999 2816332133 Bacteria 7249298
567 2819598056 2818991446 Bacteria 7757362
568 2831269044 2831265667 Bacteria 7184833
569 2838058468 2838054893 Bacteria 7451788
570 2842677681 2842677519 Bacteria 5615038
571 2842678372 2842677519 Bacteria 5615038
572 2842681098 2842677519 Bacteria 5615038
573 2842722216 2842718218 Bacteria 4560148
574 2842748285 2842747753 Bacteria 5578255
575 2881102485 2881101125 Bacteria 4590519
576 2885197807 2885192300 Bacteria 5882526
577 2885203786 2885198086 Bacteria 7212419
578 2885217879 2885211737 Bacteria 7212420
579 2899929475 2899924645 Bacteria 7487985
580 2904451037 2904449895 Bacteria 6927402
581 2904457893 2904456579 Bacteria 6819253
582 2904543346 2904541872 Bacteria 8915136
583 2919465505 2919462493 Bacteria 5817112
584 2919465749 2919462493 Bacteria 5817112
585 2919466853 2919462493 Bacteria 5817112
586 2928040081 2928037797 Bacteria 7273642
587 2928047170 2928044640 Bacteria 7271509
588 2928057627 2928051484 Bacteria 7773759
589 2928065571 2928064002 Bacteria 7419480
590 2928067991 2928064002 Bacteria 7419480
591 2928072566 2928070936 Bacteria 8062541
592 2928085746 2928084124 Bacteria 7159212
593 2928086828 2928084124 Bacteria 7159212
594 2929160578 2929160207 Bacteria 9075316
595 2929161830 2929160207 Bacteria 9075316
596 2929523685 2929520902 Bacteria 6765052
597 2945913771 2945909444 Bacteria 7065066
598 2945914924 2945909444 Bacteria 7065066
599 2945947878 2945945610 Bacteria 5951079
600 2945951040 2945945610 Bacteria 5951079
601 2945974299 2945972063 Bacteria 6086495
602 2945989672 2945984333 Bacteria 7358892
603 2945990836 2945984333 Bacteria 7358892
604 2954769563 2954767861 Bacteria 5535784
605 2974320879 2974320154 Bacteria 4571377
606 2990714379 2990710928 Bacteria 5002431
607 Ga0207694_10017930
608 JGI24740J21852_10038452
609 JGI24739J22299_10006667
610 JGI24739J22299_10035608
611 JGI25151J46595_10003087
612 Ga0006562J51391_1110138
613 Ga0055535_1001456
614 Ga0055542_1000003
615 Ga0055537_1001922
616 Ga0055536_1002577
617 Ga0055536_1010222
618 Ga0055534_1000008
619 Ga0055528_1000170
620 Ga0055530_10000292
621 Ga0055530_10007508
622 Ga0055540_1001010
623 Ga0055540_1002374
624 Ga0055540_1005976
625 Ga0055540_1007595
626 Ga0055531_10001140
627 Ga0055531_10001626
628 Ga0065714_10003497
629 Ga0065714_10009417
630 Ga0065704_10125337
631 Ga0070676_10001898
632 Ga0070676_10008826
633 Ga0070676_10013570
634 Ga0070676_10212421
635 Ga0070670_100055393
636 Ga0070677_10010567
637 Ga0070677_10018826
638 Ga0068869_100003901
639 Ga0068869_100012322
640 Ga0070666_10046631
641 Ga0068868_100107600
642 Ga0068868_100232470
643 Ga0068868_100344701
644 Ga0070689_100107303
645 Ga0070661_100206362
646 Ga0070675_100003113
647 Ga0070675_100130955
648 Ga0070671_100028482
649 Ga0070671_100054735
650 Ga0070674_100001813
651 Ga0070673_100004630
652 Ga0070673_100322224
653 Ga0070667_100006775
654 Ga0070667_100031717
655 Ga0070663_100005578
656 Ga0070663_100052115
657 Ga0070662_100017064
658 Ga0070662_100139241
659 Ga0070662_100184062
660 Ga0068867_100029643
661 Ga0068867_100059306
662 Ga0070672_100005324
663 Ga0070672_100006932
664 Ga0070672_100033711
665 Ga0070672_100073991
666 Ga0070665_100020973
667 Ga0070665_100174926
668 Ga0070665_100259542
669 Ga0068855_100452673
670 Ga0070664_100029390
671 Ga0070664_100238184
672 Ga0068857_100005597
673 Ga0068857_100025871
674 Ga0068857_100052976
675 Ga0068854_100133847
676 Ga0068852_100085795
677 Ga0068852_100094212
678 Ga0068859_100090339
679 Ga0068864_100002220
680 Ga0068864_100102048
681 Ga0068851_10000564
682 Ga0068863_100027767
683 Ga0068860_100005401
684 Ga0068860_100170592
685 Ga0068860_100273919
686 Ga0068862_100030075
687 Ga0068862_100058889
688 Ga0068862_100326814
689 Ga0075365_10008719
690 Ga0075368_10001317
691 Ga0075368_10011263
692 Ga0075363_100003026
693 Ga0075363_100012413
694 Ga0075363_100012835
695 Ga0075364_10000165
696 Ga0075364_10007952
697 Ga0075364_10011256
698 Ga0075364_10017227
699 Ga0075432_10003022
700 Ga0075432_10006440
701 Ga0075362_10005439
702 Ga0075362_10043641
703 Ga0075367_10005218
704 Ga0075369_10003289
705 Ga0075366_10000512
706 Ga0075366_10001615
707 Ga0075366_10007653
708 Ga0075366_10020374
709 Ga0075366_10045159
710 Ga0075366_10182856
711 Ga0075370_10000867
712 Ga0075370_10002120
713 Ga0075370_10003491
714 Ga0075370_10014520
715 Ga0075370_10033208
716 Ga0075370_10033330
717 Ga0075370_10145934
718 Ga0075370_10155857
719 Ga0068871_100059356
720 Ga0075430_100039277
721 Ga0068865_100004212
722 Ga0068865_100045188
723 Ga0097620_100090341
724 Ga0079104_1025453
725 Ga0099826_10000134
726 Ga0099826_10000249
727 Ga0105244_10001068
728 Ga0105240_10094193
729 Ga0105245_10024599
730 Ga0105245_10249530
731 Ga0105243_10002328
732 Ga0105243_10006470
733 Ga0105243_10006784
734 Ga0105243_10051046
735 Ga0105242_10198852
736 Ga0105248_10037029
737 Ga0105248_10063949
738 Ga0105237_10000646
739 Ga0105237_10023146
740 Ga0105238_10080945
741 Ga0105249_10021293
742 Ga0105249_10024618
743 Ga0105239_10002203
744 Ga0105239_10226401
745 Ga0105246_10066431
746 Ga0157347_1001474
747 Ga0157370_10001540
748 Ga0157369_10101715
749 Ga0157369_10177377
750 Ga0157374_10042643
751 Ga0157378_10474269
752 Ga0157378_10507931
753 Ga0163162_10006139
754 Ga0163162_10169161
755 Ga0163162_10175551
756 Ga0163162_10282850
757 Ga0157372_10014394
758 Ga0157375_10010413
759 Ga0157375_10016070
760 Ga0157380_10294501
761 Ga0182008_10004254
762 Ga0182008_10009875
763 Ga0182008_10078989
764 Ga0157376_10000620
765 Ga0157376_10017903
766 Ga0157376_10054952
767 Ga0182006_1004191
768 Ga0182006_1006968
769 Ga0182006_1043588
770 Ga0182007_10001485
771 Ga0182007_10002591
772 Ga0183362_10007
773 Ga0163161_10000105
774 Ga0163161_10000657
775 Ga0163161_10004139
776 Ga0163161_10008072
777 Ga0163161_10029066
778 Ga0163161_10037658
779 Ga0209672_101644
780 Ga0209147_100439
781 Ga0209258_100015
782 Ga0207425_1000234
783 Ga0209148_1000028
784 Ga0209129_1000049
785 Ga0209129_1007065
786 Ga0209565_1000042
787 Ga0209565_1000108
788 Ga0209565_1000337
789 Ga0209673_1000071
790 Ga0209673_1000193
791 Ga0209673_1000477
792 Ga0209673_1000817
793 Ga0209673_1004323
794 Ga0209673_1006959
795 Ga0209673_1019620
796 Ga0209130_1000267
797 Ga0209130_1006443
798 Ga0209675_1000041
799 Ga0209675_1000163
800 Ga0209675_1000398
801 Ga0209675_1003589
802 Ga0209675_1014431
803 Ga0209676_1000137
804 Ga0209676_1000173
805 Ga0209676_1000903
806 Ga0209676_1001273
807 Ga0209676_1022273
808 Ga0209676_1029668
809 Ga0209025_1000409
810 Ga0209025_1000481
811 Ga0209025_1000707
812 Ga0209025_1005325
813 Ga0209025_1013704
814 Ga0209025_1044238
815 Ga0209025_1047275
816 Ga0209564_1000232
817 Ga0209564_1001382
818 Ga0209758_1000135
819 Ga0209758_1004899
820 Ga0209050_1000015
821 Ga0209050_1000936
822 Ga0209256_1000129
823 Ga0209256_1000604
824 Ga0209256_1020864
825 Ga0207426_1000171
826 Ga0207426_1000185
827 Ga0209051_1000010
828 Ga0209051_1000137
829 Ga0209051_1000172
830 Ga0209051_1000282
831 Ga0209051_1000556
832 Ga0209051_1000940
833 Ga0209051_1033120
834 Ga0209257_1000015
835 Ga0209257_1000026
836 Ga0209257_1000108
837 Ga0209257_1000205
838 Ga0207655_1000800
839 Ga0207682_10033531
840 Ga0207682_10058074
841 Ga0207682_10087063
842 Ga0207688_10166059
843 Ga0207645_10004343
844 Ga0207645_10036430
845 Ga0207645_10036921
846 Ga0207645_10133303
847 Ga0207643_10148821
848 Ga0207643_10155001
849 Ga0207705_10178452
850 Ga0207695_10028147
851 Ga0207695_10143317
852 Ga0207671_10056167
853 Ga0207671_10114799
854 Ga0207657_10082967
855 Ga0207681_10017900
856 Ga0207681_10298678
857 Ga0207694_10022957
858 Ga0207650_10193322
859 Ga0207659_10021020
860 Ga0207659_10112316
861 Ga0207687_10041056
862 Ga0207644_10078424
863 Ga0207690_10049213
864 Ga0207706_10017095
865 Ga0207706_10268549
866 Ga0207709_10000285
867 Ga0207709_10000461
868 Ga0207709_10000947
869 Ga0207709_10002463
870 Ga0207709_10033346
871 Ga0207709_10039546
872 Ga0207670_10036817
873 Ga0207670_10121864
874 Ga0207704_10065099
875 Ga0207704_10066918
876 Ga0207691_10004921
877 Ga0207691_10009917
878 Ga0207691_10028236
879 Ga0207691_10029522
880 Ga0207711_10127826
881 Ga0207689_10003961
882 Ga0207689_10016702
883 Ga0207689_10055180
884 Ga0207689_10077267
885 Ga0207679_10340450
886 Ga0207667_10254641
887 Ga0207651_10345335
888 Ga0207712_10050226
889 Ga0207712_10072717
890 Ga0207668_10065118
891 Ga0207658_10153403
892 Ga0207658_10154700
893 Ga0207658_10276019
894 Ga0207677_10058419
895 Ga0207677_10067003
896 Ga0207677_10104078
897 Ga0207677_10105653
898 Ga0207703_10011615
899 Ga0207703_10088027
900 Ga0207703_10224897
901 Ga0207639_10048548
902 Ga0207639_10063026
903 Ga0207639_10189606
904 Ga0207678_10034625
905 Ga0207708_10013465
906 Ga0207648_10004164
907 Ga0207648_10010452
908 Ga0207648_10010854
909 Ga0207648_10197131
910 Ga0207676_10014655
911 Ga0207676_10493655
912 Ga0207674_10009080
913 Ga0207674_10062409
914 Ga0207674_10091279
915 Ga0207675_100014546
916 Ga0207683_10023567
917 Ga0207698_10024342
918 Ga0207698_10053831
919 Ga0209281_1018037
920 Ga0209282_1001604
921 Ga0209813_10000936
922 Ga0207428_10066176
923 Ga0268266_10026929
924 Ga0268266_10207934
925 Ga0268266_10299215
926 Ga0268266_10323096
927 Ga0268265_10026846
928 Ga0268265_10066913
929 Ga0268264_10010530
930 Ga0307517_10013720
931 Ga0307515_10136841
932 Ga0307512_10177253
933 Ga0316177_1018459
934 Ga0316177_1186399
935 Ga0316176_1116172
936 Ga0314311_1007245
937 Ga0316179_1087037
938 Ga0316179_1094680
939 Ga0316178_1028671
940 Ga0316178_1040279
941 Ga0316180_1145328
942 Ga0316183_1127478
943 Ga0316181_1178495
944 Ga0316182_1061027
945 Ga0316182_1203815
946 Ga0307513_10048430
947 Ga0307513_10074516
948 Ga0307509_10002279
949 Ga0307408_100000107
950 Ga0307408_100079691
951 Ga0307408_100332050
952 Ga0307508_10173327
953 Ga0307514_10003232
954 Ga0307514_10007285
955 Ga0307514_10207142
956 Ga0307516_10102694
957 Ga0307405_10016902
958 Ga0307405_10126774
959 Ga0307413_10061787
960 Ga0307413_10076246
961 Ga0307410_10255742
962 Ga0307406_10000661
963 Ga0307412_10002986
964 Ga0307412_10008062
965 Ga0307412_10172074
966 Ga0307412_10406759
967 Ga0307409_100109085
968 Ga0307416_100003175
969 Ga0307416_100012183
970 Ga0307416_100100327
971 Ga0307414_10094954
972 Ga0307411_10051507
973 Ga0307411_10071529
974 Ga0307411_10103365
975 Ga0307411_10123207
976 Ga0307411_10299804
977 Ga0307510_10049948
978 Ga0439436_0000461
979 Ga0439436_0016572
980 Ga0439439_0004279
981 Ga0439466_0000370
982 Ga0439466_0029204
983 Ga0439466_0037424
984 Ga0439465_0000199
985 Ga0451807_1667229
986 Ga0439431_0000478
987 Ga0439445_0002298
988 Ga0439432_001585
989 Ga0439449_0001060
990 Ga0439449_0019049
991 Ga0439449_0024679
992 Ga0439452_001693
993 Ga0439452_011220
994 Ga0439457_013756
995 Ga0439462_0003937
996 Ga0450920_008288
997 Ga0450923_001454
998 Ga0450898_007825
999 Ga0450910_000577
1000 Ga0439446_0000308
1001 Ga0450908_005075
1002 Ga0439434_0002154
1003 Ga0439434_0003511
1004 Ga0439434_0004467
1005 Ga0450918_001276
1006 Ga0450918_002797
1007 Ga0453683_0000780
1008 Ga0466965_0015179
1009 Ga0466957_0075912
1010 Ga0451576_0009504
1011 Ga0495627_002946
1012 Ga0495592_0000517
1013 Ga0495638_0006974
1014 Ga0495638_0122453
1015 Ga0495650_0008538
1016 Ga0495610_0035017
1017 Ga0495616_0002046
1018 Ga0495616_0005573
1019 Ga0495620_0015248
1020 Ga0495620_0035368
1021 Ga0495631_0000427
1022 Ga0495631_0002961
1023 Ga0495637_0065529
1024 Ga0495642_0032268
1025 Ga0495654_0021356
1026 Ga0495654_0037385
1027 Ga0495621_0019335
1028 Ga0495621_0077047
1029 Ga0495597_0000481
1030 Ga0495597_0012490
1031 Ga0495622_0142163
1032 Ga0495656_0000049
1033 Ga0495656_0000085
1034 Ga0495656_0060099
1035 Ga0495668_0083353
1036 Ga0495625_0000510
1037 Ga0495588_0022932
1038 Ga0495588_0174797
1039 Ga0495647_0132851
1040 Ga0495658_0050677
1041 Ga0495671_0029485
1042 Ga0495676_0031109
1043 Ga0495687_000174
1044 Ga0495673_0070263
1045 Ga0495686_0008230
1046 Ga0495593_0001431
1047 Ga0495593_0024984
1048 Ga0495614_0005534
1049 Ga0495615_0030969
1050 Ga0496100_0037433
1051 Ga0496101_0005762
1052 Ga0496101_0025299
1053 Ga0496102_0039763
1054 Ga0496104_0001525
1055 Ga0496105_0017531
1056 Ga0496106_0177502
1057 Ga0496108_0116478
1058 Ga0496108_0259899
1059 Ga0496109_0143149
1060 Ga0496113_0166978
1061 Ga0496114_0028241
1062 Ga0496114_0029435
1063 Ga0496116_0016711
1064 Ga0496116_0016940
1065 Ga0496116_0020933
1066 Ga0496117_0034891
1067 Ga0496118_0017790
1068 Ga0496121_0052422
1069 Ga0496121_0209169
1070 Ga0496122_0001461
1071 Ga0496122_0039176
1072 Ga0496122_0051792
1073 Ga0496123_0000179
1074 Ga0496124_0133997
1075 Ga0496124_0187489
1076 Ga0496124_0230195
1077 Ga0496125_0013608
1078 Ga0496126_0199607
1079 Ga0501316_010581
1080 Ga0501320_008749
1081 Ga0501198_000007
1082 Ga0501222_000005
1083 Ga0501249_001358
1084 Ga0501252_006050
1085 Ga0501225_0004140
1086 Ga0501225_0011031
1087 Ga0501262_000063
1088 Ga0501265_002659
1089 nmdc:mga03683_10934_c1
1090 nmdc:mga03683_27735_c1
1091 nmdc:mga03683_8009_c1
1092 nmdc:mga03n38_2482_c1
1093 nmdc:mga03n38_47634_c1
1094 nmdc:mga00v17_11115_c2
1095 nmdc:mga00v17_139184_c1
1096 nmdc:mga00v17_317_c1
1097 nmdc:mga00v17_39405_c1
1098 nmdc:mga0yw44_35681_c1
1099 nmdc:mga0yw44_94_c1
1100 nmdc:mga0yw44_9647_c1
1101 nmdc:mga0k408_1174_c1
1102 nmdc:mga0k408_16301_c1
1103 nmdc:mga0k408_22350_c1
1104 nmdc:mga0k408_33839_c1
1105 nmdc:mga0k408_39_c1
1106 nmdc:mga0k408_729_c1
1107 nmdc:mga0k408_7527_c1
1108 nmdc:mga0k408_892_c1
1109 nmdc:mga06z11_2023_c1
1110 nmdc:mga04h51_20715_c1
1111 nmdc:mga07m45_1487_c1
1112 nmdc:mga07m45_2277_c1
1113 nmdc:mga07m45_2527_c1
1114 nmdc:mga07m45_25445_c1
1115 nmdc:mga07m45_28479_c1
1116 nmdc:mga07m45_4514_c1
1117 nmdc:mga07m45_7356_c1
1118 nmdc:mga07m45_75487_c1
1119 nmdc:mga07m45_85981_c1
1120 nmdc:mga07m45_8928_c1
1121 Ga0500610_0021134
1122 Ga0500578_0023973
1123 Ga0500643_003877
1124 Ga0500651_0000167
1125 Ga0500651_0000674
1126 Ga0500651_0019730
1127 Ga0500566_0008966
1128 Ga0500641_0159562
1129 Ga0500571_000040
1130 Ga0500593_000457
1131 Ga0500593_001045
1132 Ga0500594_0004090
1133 Ga0500608_052164
1134 Ga0500655_000054
1135 Ga0500559_0000558
1136 Ga0500568_0001897
1137 Ga0500568_0002834
1138 Ga0500574_000536
1139 Ga0500574_001350
1140 Ga0500616_0051182
1141 Ga0500622_0002629
1142 Ga0500627_0001970
1143 Ga0500627_0023110
1144 Ga0500638_000197
1145 Ga0500645_002647
1146 2513227852
1147 2548499496
1148 2599621986
1149 2599676849
1150 2599685179
1151 2599691496
1152 2643866326
1153 2643994315
1154 2644057425
1155 2644072486
1156 2644159183
1157 2644161534
1158 2644293147
1159 2644301179
1160 2644326959
1161 2644327410
1162 2644398759
1163 2644464628
1164 2644465498
1165 2644466444
1166 2644648160
1167 2738721957
1168 2738880195
1169 2738882124
1170 2739241696
1171 2739282321
1172 2816470999
1173 2819598056
1174 2831269044
1175 2838058468
1176 2842677681
1177 2842678372
1178 2842681098
1179 2842722216
1180 2842748285
1181 2881102485
1182 2885197807
1183 2885203786
1184 2885217879
1185 2899929475
1186 2904451037
1187 2904457893
1188 2904543346
1189 2919465505
1190 2919465749
1191 2919466853
1192 2928040081
1193 2928047170
1194 2928057627
1195 2928065571
1196 2928067991
1197 2928072566
1198 2928085746
1199 2928086828
1200 2929160578
1201 2929161830
1202 2929523685
1203 2945913771
1204 2945914924
1205 2945947878
1206 2945951040
1207 2945974299
1208 2945989672
1209 2945990836
1210 2954769563
1211 2974320879
1212 2990714379

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03401

TctC

Tripartite tricarboxylate transporter family receptor

43

305

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5oku-assembly1.cif.gz_A r. palustris rpa4515 with adipate 0.9283 27 320
2dvz-assembly1.cif.gz_A structure of a periplasmic transporter 0.9207 27 324
2f5x-assembly3.cif.gz_C structure of periplasmic binding protein bugd 0.9201 27 322
8hkb-assembly1.cif.gz_A tpa bound-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis mutant k184d 0.9122 26 324
2qpq-assembly3.cif.gz_C structure of bug27 from bordetella pertussis 0.9093 26 324
ID Description Score Start End Superfamily
2f5xC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9483 123 246 3.40.190.10
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9469 121 246 3.40.190.10
2f5xC01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.9408 26 322 3.40.190.150
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9396 121 246 3.40.190.10
2f5xC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9331 123 246 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A261UKM0-F1-model_v4 ABC transporter substrate-binding protein 0.961 26 324
AF-A0A1W1YXE8-F1-model_v4 Tripartite-type tricarboxylate transporter, receptor component TctC 0.96 26 319
AF-A0A520H6B6-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9591 22 324
AF-A0A4Q1HQL1-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9579 27 316
AF-A0A1I5K2F1-F1-model_v4 Tripartite-type tricarboxylate transporter, receptor component TctC 0.956 21 324

Map