F468707

General Info

Members Datasets Scaffolds Average Seq Length
607 232 607 276

Family's Representative Sequence

Representative Sequence 3300031733|Ga0316577_10001199|Ga0316577_100011993
Length 270
Sequence MRDKYGILFLGDVIGRPGRRALRKFLPVLLEKYSPSLVVANGENAAGGIGITPDICRQLLAQVDVLTSGNHIWDKREAIEYLDVEPRLLRPANYPSPNPGKGVYAFETREGFQVAILNLQGRVFMEPIDCPFRAADKELALLEGKKTITLVDFHAEATSEKQAMGWYLDGRVSAVVGTHTHVPTADEKILPQGTAFITDVGMVGGYASVIGLKKEQALQRFLTSRPQRFEPGKQGLVSSSLFVDVDTQTGKAISIQRDMLYEDVKENEHL

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
148 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
152 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
153 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
154 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
155 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
156 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
157 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
158 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
159 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
160 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
161 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
162 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
163 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
164 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
165 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
166 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
167 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
168 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
169 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
170 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
171 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
172 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
173 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
174 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
176 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
177 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
178 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
179 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
180 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
181 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
182 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
183 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
184 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
185 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
186 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
187 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
188 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
189 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
190 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
191 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
192 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
193 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
194 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
195 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
196 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
197 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
198 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
199 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
200 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
201 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
202 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
203 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
204 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
205 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
206 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
207 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
208 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
214 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
215 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
216 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
217 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
218 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
219 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
220 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
221 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
222 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
223 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
224 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
225 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
226 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
227 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
228 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
229 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
230 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
231 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
232 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.49
Rhizosphere 99.34
Stem 0
Stem Tuber 0
Unclassified 0.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3495822 2162886007 Unclassified 1449
2 SwRhRL2b_contig_757619 2162886007 Bacteria 931
3 JGI24746J21847_1005383 3300001977 Bacteria 1997
4 JGI25406J46586_10000188 3300003203 Bacteria 27540
5 Ga0065714_10108694 3300005288 Bacteria 1511
6 Ga0065704_10242024 3300005289 Bacteria 1012
7 Ga0065712_10071830 3300005290 Bacteria 5038
8 Ga0065712_10093172 3300005290 Bacteria 2303
9 Ga0065712_10097785 3300005290 Bacteria 2139
10 Ga0065715_10009149 3300005293 Bacteria 3229
11 Ga0065715_10150770 3300005293 Bacteria 1732
12 Ga0065715_10198750 3300005293 Bacteria 1373
13 Ga0065707_10006880 3300005295 Bacteria 4371
14 Ga0065707_10095648 3300005295 Bacteria 3336
15 Ga0070658_10283380 3300005327 Bacteria 1411
16 Ga0070676_10018577 3300005328 Bacteria 3855
17 Ga0070676_10023781 3300005328 Bacteria 3445
18 Ga0070676_10046293 3300005328 Bacteria 2536
19 Ga0070683_100201078 3300005329 Bacteria 1892
20 Ga0070683_100440231 3300005329 Bacteria 1244
21 Ga0070690_100026105 3300005330 Bacteria 3600
22 Ga0070690_100033795 3300005330 Bacteria 3203
23 Ga0070690_100224517 3300005330 Bacteria 1318
24 Ga0070670_100002877 3300005331 Bacteria 14242
25 Ga0070670_100008188 3300005331 Bacteria 8902
26 Ga0070670_100039805 3300005331 Bacteria 4042
27 Ga0070670_100077047 3300005331 Bacteria 2865
28 Ga0070677_10021822 3300005333 Bacteria 2352
29 Ga0070677_10044875 3300005333 Bacteria 1761
30 Ga0068869_100003236 3300005334 Bacteria 9954
31 Ga0068869_100005463 3300005334 Bacteria 7997
32 Ga0070666_10115833 3300005335 Bacteria 1856
33 Ga0070680_100065511 3300005336 Bacteria 2977
34 Ga0070680_100323441 3300005336 Bacteria 1309
35 Ga0068868_100008101 3300005338 Bacteria 7516
36 Ga0068868_100202796 3300005338 Bacteria 1654
37 Ga0068868_100366735 3300005338 Bacteria 1237
38 Ga0070689_100014552 3300005340 Bacteria 5718
39 Ga0070689_100051308 3300005340 Bacteria 3189
40 Ga0070689_100062586 3300005340 Bacteria 2896
41 Ga0070689_100134546 3300005340 Bacteria 1984
42 Ga0070687_100013368 3300005343 Bacteria 3658
43 Ga0070687_100016036 3300005343 Bacteria 3404
44 Ga0070661_100037274 3300005344 Bacteria 3536
45 Ga0070661_100114605 3300005344 Bacteria 2015
46 Ga0070661_100215027 3300005344 Bacteria 1473
47 Ga0070692_10064233 3300005345 Bacteria 1941
48 Ga0070669_100002727 3300005353 Bacteria 12739
49 Ga0070669_100026198 3300005353 Bacteria 4195
50 Ga0070669_100075890 3300005353 Bacteria 2494
51 Ga0070669_100157077 3300005353 Bacteria 1765
52 Ga0070669_100164344 3300005353 Bacteria 1727
53 Ga0070675_100000537 3300005354 Bacteria 25951
54 Ga0070675_100003145 3300005354 Bacteria 12491
55 Ga0070675_100005576 3300005354 Bacteria 9637
56 Ga0070675_100027847 3300005354 Bacteria 4543
57 Ga0070675_100083050 3300005354 Bacteria 2673
58 Ga0070675_100118918 3300005354 Bacteria 2244
59 Ga0070675_100212814 3300005354 Bacteria 1681
60 Ga0070671_100029642 3300005355 Bacteria 4512
61 Ga0070671_100544321 3300005355 Bacteria 1001
62 Ga0070674_100001500 3300005356 Bacteria 12440
63 Ga0070674_100202005 3300005356 Bacteria 1535
64 Ga0070673_100011067 3300005364 Bacteria 6147
65 Ga0070673_100152749 3300005364 Bacteria 1956
66 Ga0070673_100173764 3300005364 Bacteria 1840
67 Ga0070673_100174804 3300005364 Bacteria 1835
68 Ga0070673_100178630 3300005364 Bacteria 1816
69 Ga0070673_100273664 3300005364 Bacteria 1479
70 Ga0070673_100330612 3300005364 Bacteria 1348
71 Ga0070688_100009604 3300005365 Bacteria 5301
72 Ga0070688_100056574 3300005365 Bacteria 2463
73 Ga0070688_100099110 3300005365 Bacteria 1918
74 Ga0070688_100157964 3300005365 Bacteria 1556
75 Ga0070659_100064075 3300005366 Bacteria 2909
76 Ga0070659_100146248 3300005366 Bacteria 1926
77 Ga0070667_100010567 3300005367 Bacteria 7620
78 Ga0070667_100484271 3300005367 Bacteria 1133
79 Ga0070701_10002485 3300005438 Bacteria 7123
80 Ga0070701_10021663 3300005438 Bacteria 3071
81 Ga0070705_100135440 3300005440 Bacteria 1613
82 Ga0070700_100015111 3300005441 Bacteria 4371
83 Ga0070700_100018991 3300005441 Bacteria 3962
84 Ga0070700_100094208 3300005441 Bacteria 1960
85 Ga0070700_100409431 3300005441 Bacteria 1022
86 Ga0070694_100300369 3300005444 Bacteria 1230
87 Ga0070678_100039934 3300005456 Bacteria 3316
88 Ga0070678_100142803 3300005456 Bacteria 1918
89 Ga0070678_100165541 3300005456 Bacteria 1796
90 Ga0070678_100168194 3300005456 Bacteria 1783
91 Ga0070678_100177709 3300005456 Bacteria 1740
92 Ga0070662_100085345 3300005457 Bacteria 2359
93 Ga0070662_100306350 3300005457 Bacteria 1292
94 Ga0070681_10025905 3300005458 Bacteria 5896
95 Ga0068867_100000147 3300005459 Bacteria 45184
96 Ga0068867_100003422 3300005459 Bacteria 11159
97 Ga0068867_100071966 3300005459 Bacteria 2587
98 Ga0068867_100089238 3300005459 Bacteria 2338
99 Ga0068867_100186096 3300005459 Bacteria 1654
100 Ga0070685_10017893 3300005466 Bacteria 3803
101 Ga0070685_10143686 3300005466 Bacteria 1505
102 Ga0070685_10180385 3300005466 Bacteria 1359
103 Ga0070707_100228446 3300005468 Bacteria 1812
104 Ga0070707_100283272 3300005468 Bacteria 1610
105 Ga0070698_100022784 3300005471 Bacteria 6549
106 Ga0070698_100049505 3300005471 Bacteria 4288
107 Ga0070698_100059186 3300005471 Bacteria 3870
108 Ga0070698_100420067 3300005471 Bacteria 1272
109 Ga0070699_100000339 3300005518 Bacteria 45340
110 Ga0070699_100024512 3300005518 Bacteria 5199
111 Ga0070699_100192061 3300005518 Bacteria 1814
112 Ga0070699_100214118 3300005518 Bacteria 1716
113 Ga0070699_100275613 3300005518 Bacteria 1506
114 Ga0070679_100054537 3300005530 Bacteria 3980
115 Ga0070697_100204128 3300005536 Bacteria 1680
116 Ga0070697_100269293 3300005536 Bacteria 1460
117 Ga0070672_100003678 3300005543 Bacteria 9967
118 Ga0070672_100020041 3300005543 Bacteria 4872
119 Ga0070672_100074274 3300005543 Bacteria 2712
120 Ga0070672_100097480 3300005543 Bacteria 2380
121 Ga0070686_100074620 3300005544 Bacteria 2229
122 Ga0070686_100104497 3300005544 Bacteria 1919
123 Ga0070695_100231791 3300005545 Bacteria 1335
124 Ga0070696_100062338 3300005546 Bacteria 2610
125 Ga0070696_100125184 3300005546 Bacteria 1864
126 Ga0070665_100012196 3300005548 Bacteria 8665
127 Ga0070665_100031333 3300005548 Bacteria 5351
128 Ga0070704_100028361 3300005549 Bacteria 3723
129 Ga0070704_100059667 3300005549 Bacteria 2723
130 Ga0070704_100116285 3300005549 Bacteria 2045
131 Ga0070664_100010031 3300005564 Bacteria 7676
132 Ga0070664_100011751 3300005564 Bacteria 7107
133 Ga0070664_100027774 3300005564 Bacteria 4705
134 Ga0070664_100130213 3300005564 Bacteria 2209
135 Ga0070664_100160666 3300005564 Bacteria 1988
136 Ga0068857_100033732 3300005577 Bacteria 4527
137 Ga0068857_100078821 3300005577 Bacteria 2940
138 Ga0068857_100181226 3300005577 Bacteria 1917
139 Ga0068857_100256147 3300005577 Bacteria 1605
140 Ga0068854_100055078 3300005578 Bacteria 2862
141 Ga0070702_100022601 3300005615 Bacteria 3328
142 Ga0068859_100002533 3300005617 Bacteria 18549
143 Ga0068859_100044995 3300005617 Bacteria 4435
144 Ga0068859_100046545 3300005617 Bacteria 4356
145 Ga0068859_100068989 3300005617 Bacteria 3570
146 Ga0068859_100080631 3300005617 Bacteria 3296
147 Ga0068859_100101945 3300005617 Bacteria 2928
148 Ga0068859_100258832 3300005617 Bacteria 1831
149 Ga0068864_100112652 3300005618 Bacteria 2425
150 Ga0068864_100223612 3300005618 Bacteria 1738
151 Ga0068866_10004135 3300005718 Bacteria 5950
152 Ga0068861_100001293 3300005719 Bacteria 15634
153 Ga0068861_100035291 3300005719 Bacteria 3703
154 Ga0068861_100060837 3300005719 Bacteria 2896
155 Ga0068861_100120742 3300005719 Bacteria 2114
156 Ga0068861_100288460 3300005719 Bacteria 1416
157 Ga0068870_10008632 3300005840 Bacteria 4593
158 Ga0068870_10033511 3300005840 Bacteria 2621
159 Ga0068870_10062119 3300005840 Bacteria 2011
160 Ga0068870_10131221 3300005840 Bacteria 1455
161 Ga0068863_100133676 3300005841 Bacteria 2369
162 Ga0068858_100066511 3300005842 Bacteria 3337
163 Ga0068858_100185150 3300005842 Bacteria 1967
164 Ga0068860_100082640 3300005843 Bacteria 3055
165 Ga0068860_100086446 3300005843 Bacteria 2984
166 Ga0068862_100001293 3300005844 Bacteria 23404
167 Ga0068862_100466306 3300005844 Bacteria 1193
168 Ga0081539_10000013 3300005985 Bacteria 432395
169 Ga0081539_10013539 3300005985 Bacteria 6136
170 Ga0070716_100262996 3300006173 Bacteria 1181
171 Ga0097621_100092943 3300006237 Bacteria 2527
172 Ga0097621_100190319 3300006237 Bacteria 1777
173 Ga0097621_100191446 3300006237 Bacteria 1771
174 Ga0068871_100167506 3300006358 Bacteria 1882
175 Ga0075428_100000869 3300006844 Bacteria 31758
176 Ga0075428_100008219 3300006844 Bacteria 11575
177 Ga0075428_100051934 3300006844 Bacteria 4495
178 Ga0075428_100119341 3300006844 Bacteria 2872
179 Ga0075428_100760395 3300006844 Bacteria 1031
180 Ga0075430_100022848 3300006846 Bacteria 5319
181 Ga0075430_100040989 3300006846 Bacteria 3918
182 Ga0075430_100492171 3300006846 Bacteria 1012
183 Ga0075431_100049128 3300006847 Bacteria 4351
184 Ga0075431_100090962 3300006847 Bacteria 3150
185 Ga0075431_100204632 3300006847 Bacteria 2018
186 Ga0075431_100329722 3300006847 Bacteria 1537
187 Ga0075433_10002009 3300006852 Bacteria 15330
188 Ga0075433_10013571 3300006852 Bacteria 6631
189 Ga0075433_10184104 3300006852 Bacteria 1858
190 Ga0075433_10202027 3300006852 Bacteria 1767
191 Ga0075433_10493710 3300006852 Bacteria 1078
192 Ga0075434_100005716 3300006871 Bacteria 11358
193 Ga0075434_100008044 3300006871 Bacteria 9777
194 Ga0075434_100008828 3300006871 Bacteria 9381
195 Ga0075434_100038568 3300006871 Bacteria 4731
196 Ga0075434_100078720 3300006871 Bacteria 3292
197 Ga0075434_100109915 3300006871 Bacteria 2767
198 Ga0075434_100255165 3300006871 Bacteria 1772
199 Ga0075429_100052468 3300006880 Bacteria 3548
200 Ga0075429_100079071 3300006880 Bacteria 2867
201 Ga0075429_100091302 3300006880 Bacteria 2657
202 Ga0075429_100096904 3300006880 Bacteria 2573
203 Ga0075429_100196292 3300006880 Bacteria 1768
204 Ga0075429_100393126 3300006880 Bacteria 1214
205 Ga0075429_100463729 3300006880 Bacteria 1110
206 Ga0068865_100005178 3300006881 Bacteria 7889
207 Ga0068865_100017474 3300006881 Bacteria 4613
208 Ga0068865_100077390 3300006881 Bacteria 2377
209 Ga0068865_100112314 3300006881 Bacteria 2012
210 Ga0068865_100241631 3300006881 Bacteria 1421
211 Ga0075436_100125073 3300006914 Bacteria 1801
212 Ga0097620_100002533 3300006931 Bacteria 18549
213 Ga0097620_100044994 3300006931 Bacteria 4435
214 Ga0097620_100046547 3300006931 Bacteria 4356
215 Ga0097620_100068989 3300006931 Bacteria 3570
216 Ga0097620_100080627 3300006931 Bacteria 3296
217 Ga0097620_100101943 3300006931 Bacteria 2928
218 Ga0097620_100258834 3300006931 Bacteria 1831
219 Ga0075435_100005714 3300007076 Bacteria 8719
220 Ga0075435_100010574 3300007076 Bacteria 6754
221 Ga0075435_100050563 3300007076 Bacteria 3345
222 Ga0075435_100065813 3300007076 Bacteria 2947
223 Ga0075435_100158714 3300007076 Bacteria 1904
224 Ga0111539_10000044 3300009094 Bacteria 125347
225 Ga0111539_10000769 3300009094 Bacteria 41797
226 Ga0111539_10001774 3300009094 Bacteria 28680
227 Ga0111539_10022455 3300009094 Bacteria 7752
228 Ga0111539_10055455 3300009094 Bacteria 4711
229 Ga0111539_10100266 3300009094 Bacteria 3401
230 Ga0111539_10242372 3300009094 Bacteria 2099
231 Ga0111539_10266868 3300009094 Bacteria 1992
232 Ga0111539_10324706 3300009094 Bacteria 1791
233 Ga0105245_10008629 3300009098 Bacteria 8891
234 Ga0105245_10459839 3300009098 Bacteria 1283
235 Ga0114129_10003198 3300009147 Bacteria 22984
236 Ga0114129_10003276 3300009147 Bacteria 22724
237 Ga0114129_10006054 3300009147 Bacteria 17152
238 Ga0114129_10009872 3300009147 Bacteria 13609
239 Ga0114129_10029480 3300009147 Bacteria 7773
240 Ga0114129_10096834 3300009147 Bacteria 4085
241 Ga0114129_10132600 3300009147 Bacteria 3421
242 Ga0114129_10160493 3300009147 Bacteria 3071
243 Ga0114129_10176742 3300009147 Bacteria 2908
244 Ga0114129_10846750 3300009147 Bacteria 1163
245 Ga0114129_11101553 3300009147 Bacteria 994
246 Ga0105243_10008157 3300009148 Bacteria 8043
247 Ga0105241_10568125 3300009174 Bacteria 1020
248 Ga0105242_10002921 3300009176 Bacteria 13348
249 Ga0105242_10290514 3300009176 Bacteria 1488
250 Ga0105242_10476981 3300009176 Bacteria 1181
251 Ga0105248_10241039 3300009177 Bacteria 2036
252 Ga0105248_10647238 3300009177 Bacteria 1192
253 Ga0105238_10043505 3300009551 Bacteria 4544
254 Ga0105249_10001334 3300009553 Bacteria 21606
255 Ga0105249_10043919 3300009553 Bacteria 4065
256 Ga0105249_10087301 3300009553 Bacteria 2910
257 Ga0105246_10021871 3300011119 Bacteria 4122
258 Ga0105246_10028237 3300011119 Bacteria 3684
259 Ga0157371_10043810 3300013102 Bacteria 3187
260 Ga0157374_10215050 3300013296 Bacteria 1885
261 Ga0157374_10264284 3300013296 Bacteria 1695
262 Ga0157378_10099238 3300013297 Bacteria 2656
263 Ga0157378_10216219 3300013297 Bacteria 1820
264 Ga0163162_10033186 3300013306 Bacteria 5128
265 Ga0163162_10168863 3300013306 Bacteria 2312
266 Ga0163162_10182938 3300013306 Bacteria 2222
267 Ga0157375_10018181 3300013308 Bacteria 6370
268 Ga0157375_10033798 3300013308 Bacteria 4864
269 Ga0157375_10062458 3300013308 Bacteria 3702
270 Ga0157375_10164865 3300013308 Bacteria 2360
271 Ga0157375_10209089 3300013308 Bacteria 2108
272 Ga0157375_10301418 3300013308 Bacteria 1766
273 Ga0157375_10348737 3300013308 Bacteria 1646
274 Ga0163163_10074895 3300014325 Bacteria 3378
275 Ga0163163_10140451 3300014325 Bacteria 2458
276 Ga0163163_10842994 3300014325 Bacteria 980
277 Ga0157380_10003886 3300014326 Bacteria 10304
278 Ga0157380_10007439 3300014326 Bacteria 7775
279 Ga0157380_10073267 3300014326 Bacteria 2776
280 Ga0157380_10158137 3300014326 Bacteria 1966
281 Ga0157380_10274561 3300014326 Unclassified 1539
282 Ga0157380_10278188 3300014326 Bacteria 1530
283 Ga0157380_10536658 3300014326 Bacteria 1144
284 Ga0157377_10002991 3300014745 Bacteria 7572
285 Ga0157377_10015219 3300014745 Bacteria 3929
286 Ga0157377_10093693 3300014745 Bacteria 1778
287 Ga0157379_10003739 3300014968 Bacteria 12939
288 Ga0157379_10328573 3300014968 Bacteria 1397
289 Ga0157376_10052484 3300014969 Bacteria 3390
290 Ga0157376_10057545 3300014969 Bacteria 3253
291 Ga0157376_10225378 3300014969 Bacteria 1738
292 Ga0157376_10234502 3300014969 Bacteria 1706
293 Ga0157376_10251963 3300014969 Unclassified 1649
294 Ga0163161_10023461 3300017792 Bacteria 4352
295 Ga0163161_10042869 3300017792 Bacteria 3256
296 Ga0207697_10001514 3300025315 Bacteria 12621
297 Ga0207697_10068491 3300025315 Bacteria 1485
298 Ga0207697_10091137 3300025315 Bacteria 1292
299 Ga0207682_10001841 3300025893 Bacteria 9661
300 Ga0207682_10003394 3300025893 Bacteria 6930
301 Ga0207682_10014594 3300025893 Bacteria 3062
302 Ga0207682_10042777 3300025893 Bacteria 1851
303 Ga0207682_10148890 3300025893 Bacteria 1055
304 Ga0207642_10016929 3300025899 Bacteria 2760
305 Ga0207642_10194784 3300025899 Bacteria 1115
306 Ga0207688_10001443 3300025901 Bacteria 12425
307 Ga0207680_10105873 3300025903 Bacteria 1815
308 Ga0207647_10098223 3300025904 Bacteria 1740
309 Ga0207699_10037961 3300025906 Bacteria 2757
310 Ga0207645_10001881 3300025907 Bacteria 16948
311 Ga0207645_10016937 3300025907 Bacteria 4815
312 Ga0207645_10027133 3300025907 Bacteria 3700
313 Ga0207645_10043765 3300025907 Bacteria 2866
314 Ga0207643_10005281 3300025908 Bacteria 6909
315 Ga0207643_10005748 3300025908 Bacteria 6631
316 Ga0207643_10015261 3300025908 Bacteria 4179
317 Ga0207643_10020319 3300025908 Bacteria 3644
318 Ga0207643_10027240 3300025908 Bacteria 3167
319 Ga0207643_10039643 3300025908 Bacteria 2650
320 Ga0207705_10482681 3300025909 Bacteria 962
321 Ga0207684_10568773 3300025910 Bacteria 969
322 Ga0207660_10280256 3300025917 Bacteria 1323
323 Ga0207662_10002054 3300025918 Bacteria 9973
324 Ga0207662_10020005 3300025918 Bacteria 3816
325 Ga0207649_10088325 3300025920 Bacteria 2024
326 Ga0207652_10085534 3300025921 Bacteria 2764
327 Ga0207646_10247413 3300025922 Bacteria 1610
328 Ga0207646_10332477 3300025922 Bacteria 1373
329 Ga0207681_10000566 3300025923 Bacteria 25276
330 Ga0207681_10020352 3300025923 Bacteria 4203
331 Ga0207681_10030926 3300025923 Bacteria 3494
332 Ga0207681_10074125 3300025923 Bacteria 2383
333 Ga0207681_10074279 3300025923 Bacteria 2381
334 Ga0207681_10081612 3300025923 Bacteria 2283
335 Ga0207681_10146939 3300025923 Bacteria 1762
336 Ga0207694_10024715 3300025924 Bacteria 4563
337 Ga0207650_10072055 3300025925 Bacteria 2600
338 Ga0207650_10083205 3300025925 Bacteria 2430
339 Ga0207650_10211843 3300025925 Bacteria 1556
340 Ga0207659_10001222 3300025926 Bacteria 15363
341 Ga0207659_10002242 3300025926 Bacteria 11514
342 Ga0207659_10002762 3300025926 Bacteria 10460
343 Ga0207659_10007569 3300025926 Bacteria 6690
344 Ga0207659_10014600 3300025926 Bacteria 5071
345 Ga0207659_10018603 3300025926 Bacteria 4558
346 Ga0207659_10027625 3300025926 Bacteria 3845
347 Ga0207659_10029682 3300025926 Bacteria 3729
348 Ga0207659_10147555 3300025926 Bacteria 1833
349 Ga0207659_10163944 3300025926 Bacteria 1748
350 Ga0207659_10231190 3300025926 Bacteria 1491
351 Ga0207659_10293757 3300025926 Bacteria 1332
352 Ga0207659_10353734 3300025926 Bacteria 1219
353 Ga0207687_10014295 3300025927 Bacteria 5193
354 Ga0207690_10199165 3300025932 Bacteria 1520
355 Ga0207706_10003425 3300025933 Bacteria 15142
356 Ga0207706_10105521 3300025933 Bacteria 2479
357 Ga0207706_10218302 3300025933 Bacteria 1670
358 Ga0207706_10292309 3300025933 Bacteria 1421
359 Ga0207686_10006753 3300025934 Bacteria 6180
360 Ga0207686_10034387 3300025934 Bacteria 3034
361 Ga0207709_10003920 3300025935 Bacteria 8690
362 Ga0207670_10014557 3300025936 Bacteria 4674
363 Ga0207670_10079787 3300025936 Bacteria 2286
364 Ga0207670_10108480 3300025936 Bacteria 1996
365 Ga0207670_10245445 3300025936 Bacteria 1381
366 Ga0207670_10309284 3300025936 Bacteria 1240
367 Ga0207669_10001529 3300025937 Bacteria 9860
368 Ga0207669_10307745 3300025937 Bacteria 1207
369 Ga0207704_10016569 3300025938 Bacteria 3790
370 Ga0207704_10038855 3300025938 Bacteria 2765
371 Ga0207691_10005705 3300025940 Bacteria 12037
372 Ga0207691_10008285 3300025940 Bacteria 9981
373 Ga0207691_10025779 3300025940 Bacteria 5518
374 Ga0207691_10027241 3300025940 Bacteria 5361
375 Ga0207691_10030625 3300025940 Bacteria 5026
376 Ga0207691_10049189 3300025940 Bacteria 3863
377 Ga0207691_10070544 3300025940 Bacteria 3155
378 Ga0207691_10216928 3300025940 Bacteria 1660
379 Ga0207691_10242069 3300025940 Bacteria 1559
380 Ga0207691_10318015 3300025940 Bacteria 1335
381 Ga0207711_10126377 3300025941 Bacteria 2288
382 Ga0207711_10452056 3300025941 Bacteria 1196
383 Ga0207689_10000831 3300025942 Bacteria 29759
384 Ga0207689_10005795 3300025942 Bacteria 10963
385 Ga0207689_10210793 3300025942 Bacteria 1605
386 Ga0207689_10395547 3300025942 Bacteria 1152
387 Ga0207689_10559836 3300025942 Bacteria 960
388 Ga0207661_10020477 3300025944 Bacteria 4945
389 Ga0207679_10026524 3300025945 Bacteria 3996
390 Ga0207679_10366979 3300025945 Bacteria 1259
391 Ga0207651_10015409 3300025960 Bacteria 4441
392 Ga0207651_10061581 3300025960 Bacteria 2611
393 Ga0207651_10118570 3300025960 Bacteria 2002
394 Ga0207651_10135856 3300025960 Bacteria 1891
395 Ga0207651_10217778 3300025960 Bacteria 1541
396 Ga0207651_10323620 3300025960 Bacteria 1289
397 Ga0207712_10002418 3300025961 Bacteria 12069
398 Ga0207712_10029712 3300025961 Bacteria 3669
399 Ga0207668_10050926 3300025972 Bacteria 2857
400 Ga0207668_10063916 3300025972 Bacteria 2599
401 Ga0207668_10294346 3300025972 Bacteria 1337
402 Ga0207640_10125688 3300025981 Bacteria 1846
403 Ga0207658_10281318 3300025986 Bacteria 1426
404 Ga0207677_10056451 3300026023 Bacteria 2691
405 Ga0207677_10074628 3300026023 Bacteria 2407
406 Ga0207677_10277135 3300026023 Bacteria 1375
407 Ga0207703_10033664 3300026035 Bacteria 4064
408 Ga0207703_10086035 3300026035 Bacteria 2632
409 Ga0207703_10103101 3300026035 Bacteria 2421
410 Ga0207639_10142279 3300026041 Bacteria 2000
411 Ga0207708_10003991 3300026075 Bacteria 10861
412 Ga0207708_10070416 3300026075 Bacteria 2678
413 Ga0207708_10089859 3300026075 Bacteria 2367
414 Ga0207708_10111947 3300026075 Bacteria 2120
415 Ga0207708_10198955 3300026075 Bacteria 1598
416 Ga0207708_10251301 3300026075 Bacteria 1425
417 Ga0207708_10348322 3300026075 Bacteria 1215
418 Ga0207641_10042542 3300026088 Bacteria 3811
419 Ga0207641_10093039 3300026088 Bacteria 2642
420 Ga0207648_10000093 3300026089 Bacteria 84666
421 Ga0207648_10000446 3300026089 Bacteria 45706
422 Ga0207648_10048633 3300026089 Bacteria 3712
423 Ga0207648_10087655 3300026089 Bacteria 2716
424 Ga0207648_10305841 3300026089 Bacteria 1427
425 Ga0207676_10120036 3300026095 Bacteria 2215
426 Ga0207674_10043449 3300026116 Bacteria 4633
427 Ga0207674_10057586 3300026116 Bacteria 3939
428 Ga0207674_10089328 3300026116 Bacteria 3074
429 Ga0207674_10095960 3300026116 Bacteria 2951
430 Ga0207675_100001058 3300026118 Bacteria 27297
431 Ga0207675_100004015 3300026118 Bacteria 14272
432 Ga0207675_100060737 3300026118 Bacteria 3529
433 Ga0207675_100093451 3300026118 Bacteria 2829
434 Ga0207675_100323156 3300026118 Bacteria 1507
435 Ga0207683_10021244 3300026121 Bacteria 5554
436 Ga0207683_10038673 3300026121 Bacteria 4160
437 Ga0207683_10045261 3300026121 Bacteria 3848
438 Ga0207683_10059137 3300026121 Bacteria 3366
439 Ga0207683_10093639 3300026121 Bacteria 2677
440 Ga0207683_10112388 3300026121 Bacteria 2439
441 Ga0207428_10000224 3300027907 Bacteria 78533
442 Ga0207428_10000353 3300027907 Bacteria 59325
443 Ga0207428_10002217 3300027907 Bacteria 19496
444 Ga0207428_10004706 3300027907 Bacteria 12908
445 Ga0207428_10069176 3300027907 Bacteria 2776
446 Ga0268266_10211239 3300028379 Bacteria 1780
447 Ga0268266_10336344 3300028379 Bacteria 1416
448 Ga0268266_10471370 3300028379 Bacteria 1196
449 Ga0268265_10000540 3300028380 Bacteria 38471
450 Ga0268265_10058496 3300028380 Bacteria 2944
451 Ga0268265_10062280 3300028380 Bacteria 2866
452 Ga0268265_10066118 3300028380 Bacteria 2793
453 Ga0268265_10196089 3300028380 Bacteria 1748
454 Ga0268264_10036528 3300028381 Bacteria 4048
455 Ga0268264_10071496 3300028381 Bacteria 2940
456 Ga0268264_10088574 3300028381 Bacteria 2664
457 Ga0265314_10084420 3300031711 Bacteria 2085
458 Ga0307405_10036021 3300031731 Bacteria 2961
459 Ga0316577_10001199 3300031733 Bacteria 11998
460 Ga0307410_10009560 3300031852 Bacteria 5445
461 Ga0307407_10042811 3300031903 Bacteria 2542
462 Ga0307412_10010531 3300031911 Bacteria 5326
463 Ga0307409_100011842 3300031995 Bacteria 5524
464 Ga0307409_100670149 3300031995 Bacteria 1033
465 Ga0307416_100004482 3300032002 Bacteria 8423
466 Ga0307414_10044810 3300032004 Bacteria 3025
467 Ga0307411_10016639 3300032005 Bacteria 4166
468 Ga0307415_100053170 3300032126 Bacteria 2758
469 Ga0373928_0020210 3300035084 Bacteria 1395
470 Ga0373923_0040693 3300035111 Bacteria 1914
471 Ga0373953_0148642 3300035117 Bacteria 1004
472 Ga0373957_0135763 3300035120 Bacteria 1004
473 Ga0373943_0003682 3300035170 Bacteria 6969
474 Ga0373946_0009173 3300035171 Bacteria 3641
475 Ga0373955_0004579 3300035172 Bacteria 6129
476 Ga0373961_0006165 3300035241 Bacteria 2881
477 Ga0373924_0003631 3300035410 Bacteria 5322
478 Ga0373931_0022676 3300035691 Bacteria 3162
479 Ga0373935_0178182 3300035692 Bacteria 1458
480 Ga0373927_0371273 3300035695 Bacteria 943
481 Ga0373925_0148733 3300037068 Bacteria 1837
482 Ga0373925_0171535 3300037068 Bacteria 1713
483 Ga0373925_0219320 3300037068 Unclassified 1518
484 Ga0395900_0394320 3300037418 Bacteria 1350
485 Ga0451853_1517139 3300041512 Bacteria 3345
486 Ga0439441_015397 3300042001 Bacteria 1352
487 Ga0439446_0057618 3300042156 Bacteria 1170
488 Ga0439435_0060464 3300042436 Bacteria 1103
489 Ga0450916_000840 3300042530 Bacteria 2881
490 Ga0451577_0071562 3300042876 Bacteria 3092
491 Ga0451577_0125389 3300042876 Bacteria 2301
492 Ga0451577_0363512 3300042876 Unclassified 1313
493 Ga0453684_0059299 3300044712 Bacteria 4936
494 Ga0453684_0114534 3300044712 Bacteria 3268
495 Ga0451576_0013731 3300045051 Bacteria 9047
496 Ga0451576_0021675 3300045051 Bacteria 6980
497 Ga0451576_0052019 3300045051 Bacteria 4292
498 Ga0451576_0177479 3300045051 Bacteria 2224
499 Ga0451576_0717339 3300045051 Bacteria 1050
500 Ga0495580_0118487 3300046472 Bacteria 1838
501 Ga0495608_0003468 3300046511 Bacteria 11288
502 Ga0495628_0138285 3300046516 Bacteria 1860
503 Ga0495630_0016655 3300046517 Bacteria 5375
504 Ga0495663_0059105 3300046525 Bacteria 1202
505 Ga0495652_0164291 3300046529 Bacteria 1720
506 Ga0495587_0039508 3300046536 Bacteria 2823
507 Ga0495598_0016109 3300046537 Bacteria 1901
508 Ga0495621_0000539 3300046539 Bacteria 9397
509 Ga0495621_0012526 3300046539 Bacteria 2645
510 Ga0495633_0045317 3300046558 Bacteria 2083
511 Ga0495656_0033659 3300046615 Bacteria 2093
512 Ga0495656_0109244 3300046615 Bacteria 1291
513 Ga0495659_0016434 3300046664 Bacteria 2441
514 Ga0495659_0020455 3300046664 Bacteria 2223
515 Ga0495659_0035277 3300046664 Bacteria 1762
516 Ga0495647_0111633 3300046681 Bacteria 1142
517 Ga0495658_0059852 3300046683 Bacteria 2183
518 Ga0495658_0117678 3300046683 Bacteria 1604
519 Ga0495669_0001215 3300046684 Bacteria 10716
520 Ga0495669_0074664 3300046684 Bacteria 1550
521 Ga0495613_0003695 3300046689 Bacteria 11476
522 Ga0495604_0062959 3300047317 Bacteria 2832
523 Ga0495636_0072670 3300047318 Bacteria 1470
524 Ga0495674_0009481 3300047319 Bacteria 9249
525 Ga0495674_0179328 3300047319 Bacteria 1765
526 Ga0495677_0071882 3300047445 Bacteria 1290
527 Ga0495684_0000601 3300047471 Bacteria 28931
528 Ga0496104_0074080 3300048907 Bacteria 3241
529 Ga0496109_0055599 3300048912 Bacteria 3611
530 Ga0496113_0037187 3300048916 Bacteria 3570
531 Ga0501039_0074972 3300049575 Bacteria 2630
532 Ga0501039_0093895 3300049575 Bacteria 2338
533 Ga0501040_0033029 3300049576 Bacteria 3504
534 Ga0501041_0092802 3300049577 Bacteria 1864
535 Ga0501042_0003889 3300049578 Bacteria 9445
536 Ga0501042_0236178 3300049578 Bacteria 1319
537 Ga0501042_0342725 3300049578 Bacteria 1080
538 Ga0501046_0075810 3300049580 Bacteria 2607
539 Ga0501046_0348896 3300049580 Bacteria 1075
540 Ga0501071_0158449 3300049587 Bacteria 1691
541 Ga0501074_0330732 3300049590 Bacteria 1082
542 Ga0501075_0310479 3300049591 Bacteria 1202
543 Ga0501076_0190632 3300049592 Bacteria 1673
544 Ga0501077_0051690 3300049593 Bacteria 2611
545 Ga0501077_0132067 3300049593 Bacteria 1583
546 Ga0501079_0262337 3300049741 Bacteria 1350
547 Ga0501045_0089081 3300049824 Bacteria 2279
548 nmdc:mga05p37_136169_c1 3300050507 Bacteria 3012
549 nmdc:mga05p37_17011_c1 3300050507 Bacteria 8770
550 nmdc:mga05p37_282105_c1 3300050507 Bacteria 1981
551 nmdc:mga05p37_28799_c1 3300050507 Bacteria 6776
552 nmdc:mga05p37_35576_c1 3300050507 Bacteria 3243
553 nmdc:mga05p37_358361_c1 3300050507 Bacteria 1715
554 nmdc:mga05p37_429140_c1 3300050507 Bacteria 1536
555 nmdc:mga05p37_84584_c1 3300050507 Bacteria 3908
556 nmdc:mga05p37_92576_c1 3300050507 Bacteria 3725
557 nmdc:mga09592_106396_c1 3300050508 Bacteria 2406
558 nmdc:mga09592_135869_c1 3300050508 Bacteria 2118
559 nmdc:mga09592_164039_c1 3300050508 Bacteria 1920
560 nmdc:mga09592_18887_c1 3300050508 Bacteria 5655
561 nmdc:mga09592_274532_c1 3300050508 Bacteria 1462
562 nmdc:mga09592_316135_c1 3300050508 Bacteria 1353
563 nmdc:mga09592_393425_c1 3300050508 Bacteria 1198
564 nmdc:mga0qj67_4306_c2 3300050509 Bacteria 8212
565 nmdc:mga0qj67_66977_c1 3300050509 Bacteria 2861
566 nmdc:mga0qj67_93568_c1 3300050509 Bacteria 2417
567 nmdc:mga06r32_206675_c1 3300050510 Bacteria 1952
568 nmdc:mga06r32_209770_c1 3300050510 Bacteria 1936
569 nmdc:mga08y16_12914_c1 3300050511 Bacteria 8786
570 nmdc:mga08y16_15575_c1 3300050511 Bacteria 7995
571 nmdc:mga08y16_273023_c1 3300050511 Bacteria 1745
572 nmdc:mga08y16_32226_c1 3300050511 Bacteria 5511
573 nmdc:mga08y16_375226_c1 3300050511 Bacteria 1458
574 nmdc:mga08y16_40195_c1 3300050511 Bacteria 4903
575 nmdc:mga08y16_48255_c1 3300050511 Bacteria 4456
576 nmdc:mga08y16_50424_c1 3300050511 Bacteria 4355
577 nmdc:mga08y16_5828_c1 3300050511 Bacteria 12911
578 nmdc:mga08y16_945_c1 3300050511 Bacteria 28237
579 nmdc:mga0n895_10821_c1 3300050512 Bacteria 8096
580 nmdc:mga0n895_27620_c1 3300050512 Bacteria 5394
581 nmdc:mga0n895_39130_c1 3300050512 Bacteria 4599
582 nmdc:mga0n895_4485_c1 3300050512 Bacteria 11475
583 nmdc:mga0n895_467810_c1 3300050512 Bacteria 1272
584 nmdc:mga0n895_6752_c1 3300050512 Bacteria 9788
585 nmdc:mga0n895_802454_c1 3300050512 Bacteria 932
586 nmdc:mga0n895_81489_c1 3300050512 Bacteria 3225
587 nmdc:mga0n895_86092_c1 3300050512 Bacteria 3139
588 nmdc:mga0n895_98386_c1 3300050512 Bacteria 2932
589 nmdc:mga0rr50_108527_c1 3300050513 Bacteria 2193
590 nmdc:mga0rr50_119416_c1 3300050513 Bacteria 2096
591 nmdc:mga0rr50_190578_c1 3300050513 Bacteria 1680
592 nmdc:mga0rr50_21346_c1 3300050513 Bacteria 4419
593 nmdc:mga08x19_123848_c1 3300050514 Bacteria 1735
594 nmdc:mga0a205_129737_c1 3300050515 Bacteria 2422
595 nmdc:mga0a205_1497_c1 3300050515 Bacteria 19917
596 nmdc:mga0a205_210015_c1 3300050515 Bacteria 1835
597 nmdc:mga0a205_220729_c1 3300050515 Bacteria 1781
598 nmdc:mga0a205_44250_c1 3300050515 Bacteria 4291
599 nmdc:mga0a205_4601_c1 3300050515 Bacteria 12370
600 nmdc:mga0a205_71273_c1 3300050515 Bacteria 3356
601 nmdc:mga0a205_808_c1 3300050515 Bacteria 25457
602 Ga0495601_0055214 3300053077 Bacteria 2514
603 Ga0495601_0105419 3300053077 Bacteria 1823
604 Ga0495619_0000386 3300053085 Bacteria 30136
605 Ga0495619_0078744 3300053085 Bacteria 2216
606 Ga0501082_0006994 3300060353 Bacteria 9740
607 Ga0530510_0004934 3300061734 Bacteria 9214

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006880 Ga0075429_100393126 Ga0075429_1003931262 237
2 3300025899 Ga0207642_10194784 Ga0207642_101947842 256
3 3300026075 Ga0207708_10348322 Ga0207708_103483222 258
4 3300005456 Ga0070678_100168194 Ga0070678_1001681943 259
5 3300042876 Ga0451577_0125389 Ga0451577_0125389_1502_2284 259
6 3300044712 Ga0453684_0114534 Ga0453684_0114534_169_951 259
7 3300053077 Ga0495601_0105419 Ga0495601_0105419_11_850 263
8 3300031733 Ga0316577_10001199 Ga0316577_100011993 264
9 3300037068 Ga0373925_0219320 Ga0373925_0219320_560_1399 264
10 3300005518 Ga0070699_100214118 Ga0070699_1002141182 265
11 3300009174 Ga0105241_10568125 Ga0105241_105681251 265
12 3300025936 Ga0207670_10309284 Ga0207670_103092842 265
13 3300053085 Ga0495619_0078744 Ga0495619_0078744_28_867 265
14 3300005293 Ga0065715_10150770 Ga0065715_101507702 266
15 3300005331 Ga0070670_100039805 Ga0070670_1000398054 266
16 3300005456 Ga0070678_100142803 Ga0070678_1001428031 266
17 3300005456 Ga0070678_100177709 Ga0070678_1001777091 266
18 3300005617 Ga0068859_100258832 Ga0068859_1002588322 266
19 3300006237 Ga0097621_100190319 Ga0097621_1001903192 266
20 3300006358 Ga0068871_100167506 Ga0068871_1001675062 266
21 3300006931 Ga0097620_100258834 Ga0097620_1002588342 266
22 3300014968 Ga0157379_10328573 Ga0157379_103285732 266
23 3300014969 Ga0157376_10251963 Ga0157376_102519632 266
24 3300025906 Ga0207699_10037961 Ga0207699_100379612 266
25 3300025926 Ga0207659_10027625 Ga0207659_100276254 266
26 3300025926 Ga0207659_10163944 Ga0207659_101639442 266
27 3300025940 Ga0207691_10070544 Ga0207691_100705444 266
28 3300025945 Ga0207679_10026524 Ga0207679_100265244 266
29 3300025960 Ga0207651_10135856 Ga0207651_101358562 266
30 3300026121 Ga0207683_10045261 Ga0207683_100452614 266
31 3300031995 Ga0307409_100670149 Ga0307409_1006701492 266
32 3300035117 Ga0373953_0148642 Ga0373953_0148642_71_880 266
33 3300041512 Ga0451853_1517139 Ga0451853_1517139_896_1711 266
34 3300045051 Ga0451576_0717339 Ga0451576_0717339_168_974 266
35 3300046516 Ga0495628_0138285 Ga0495628_0138285_119_928 266
36 3300048907 Ga0496104_0074080 Ga0496104_0074080_256_1065 266
37 3300005327 Ga0070658_10283380 Ga0070658_102833801 267
38 3300005328 Ga0070676_10018577 Ga0070676_100185773 267
39 3300005330 Ga0070690_100033795 Ga0070690_1000337952 267
40 3300005331 Ga0070670_100002877 Ga0070670_10000287712 267
41 3300005334 Ga0068869_100005463 Ga0068869_1000054633 267
42 3300005338 Ga0068868_100202796 Ga0068868_1002027963 267
43 3300005353 Ga0070669_100026198 Ga0070669_1000261984 267
44 3300005353 Ga0070669_100075890 Ga0070669_1000758902 267
45 3300005353 Ga0070669_100157077 Ga0070669_1001570771 267
46 3300005354 Ga0070675_100000537 Ga0070675_10000053713 267
47 3300005354 Ga0070675_100003145 Ga0070675_1000031459 267
48 3300005354 Ga0070675_100027847 Ga0070675_1000278474 267
49 3300005354 Ga0070675_100118918 Ga0070675_1001189182 267
50 3300005364 Ga0070673_100173764 Ga0070673_1001737643 267
51 3300005364 Ga0070673_100178630 Ga0070673_1001786303 267
52 3300005365 Ga0070688_100009604 Ga0070688_1000096042 267
53 3300005438 Ga0070701_10002485 Ga0070701_100024854 267
54 3300005441 Ga0070700_100015111 Ga0070700_1000151113 267
55 3300005457 Ga0070662_100306350 Ga0070662_1003063501 267
56 3300005459 Ga0068867_100003422 Ga0068867_1000034228 267
57 3300005543 Ga0070672_100003678 Ga0070672_1000036787 267
58 3300005545 Ga0070695_100231791 Ga0070695_1002317912 267
59 3300005578 Ga0068854_100055078 Ga0068854_1000550783 267
60 3300005615 Ga0070702_100022601 Ga0070702_1000226013 267
61 3300005617 Ga0068859_100080631 Ga0068859_1000806312 267
62 3300005718 Ga0068866_10004135 Ga0068866_100041356 267
63 3300005719 Ga0068861_100035291 Ga0068861_1000352912 267
64 3300005719 Ga0068861_100288460 Ga0068861_1002884602 267
65 3300005842 Ga0068858_100066511 Ga0068858_1000665112 267
66 3300005843 Ga0068860_100082640 Ga0068860_1000826403 267
67 3300006237 Ga0097621_100092943 Ga0097621_1000929432 267
68 3300006881 Ga0068865_100005178 Ga0068865_1000051789 267
69 3300006931 Ga0097620_100080627 Ga0097620_1000806272 267
70 3300009148 Ga0105243_10008157 Ga0105243_100081573 267
71 3300009176 Ga0105242_10002921 Ga0105242_100029212 267
72 3300009551 Ga0105238_10043505 Ga0105238_100435052 267
73 3300014325 Ga0163163_10074895 Ga0163163_100748953 267
74 3300014325 Ga0163163_10842994 Ga0163163_108429942 267
75 3300014326 Ga0157380_10073267 Ga0157380_100732672 267
76 3300014326 Ga0157380_10158137 Ga0157380_101581373 267
77 3300014969 Ga0157376_10234502 Ga0157376_102345022 267
78 3300025893 Ga0207682_10042777 Ga0207682_100427771 267
79 3300025899 Ga0207642_10016929 Ga0207642_100169293 267
80 3300025907 Ga0207645_10016937 Ga0207645_100169376 267
81 3300025908 Ga0207643_10027240 Ga0207643_100272402 267
82 3300025909 Ga0207705_10482681 Ga0207705_104826811 267
83 3300025923 Ga0207681_10020352 Ga0207681_100203524 267
84 3300025923 Ga0207681_10030926 Ga0207681_100309264 267
85 3300025923 Ga0207681_10074279 Ga0207681_100742792 267
86 3300025924 Ga0207694_10024715 Ga0207694_100247154 267
87 3300025925 Ga0207650_10072055 Ga0207650_100720552 267
88 3300025926 Ga0207659_10002762 Ga0207659_1000276212 267
89 3300025926 Ga0207659_10007569 Ga0207659_100075694 267
90 3300025926 Ga0207659_10018603 Ga0207659_100186033 267
91 3300025926 Ga0207659_10353734 Ga0207659_103537342 267
92 3300025933 Ga0207706_10105521 Ga0207706_101055212 267
93 3300025934 Ga0207686_10006753 Ga0207686_100067534 267
94 3300025935 Ga0207709_10003920 Ga0207709_100039209 267
95 3300025940 Ga0207691_10008285 Ga0207691_100082857 267
96 3300025940 Ga0207691_10216928 Ga0207691_102169282 267
97 3300025940 Ga0207691_10242069 Ga0207691_102420692 267
98 3300025940 Ga0207691_10318015 Ga0207691_103180152 267
99 3300025941 Ga0207711_10452056 Ga0207711_104520562 267
100 3300025942 Ga0207689_10005795 Ga0207689_1000579512 267
101 3300025942 Ga0207689_10559836 Ga0207689_105598361 267
102 3300025960 Ga0207651_10015409 Ga0207651_100154092 267
103 3300025972 Ga0207668_10294346 Ga0207668_102943462 267
104 3300025981 Ga0207640_10125688 Ga0207640_101256883 267
105 3300026035 Ga0207703_10033664 Ga0207703_100336643 267
106 3300026035 Ga0207703_10103101 Ga0207703_101031012 267
107 3300026075 Ga0207708_10003991 Ga0207708_100039914 267
108 3300026088 Ga0207641_10093039 Ga0207641_100930393 267
109 3300026089 Ga0207648_10000093 Ga0207648_1000009316 267
110 3300026118 Ga0207675_100060737 Ga0207675_1000607372 267
111 3300026121 Ga0207683_10112388 Ga0207683_101123883 267
112 3300028379 Ga0268266_10471370 Ga0268266_104713702 267
113 3300028381 Ga0268264_10071496 Ga0268264_100714963 267
114 3300042436 Ga0439435_0060464 Ga0439435_0060464_251_1060 267
115 3300005336 Ga0070680_100323441 Ga0070680_1003234412 269
116 3300005985 Ga0081539_10013539 Ga0081539_100135392 269
117 3300005290 Ga0065712_10093172 Ga0065712_100931722 270
118 3300005335 Ga0070666_10115833 Ga0070666_101158331 270
119 3300005354 Ga0070675_100005576 Ga0070675_1000055763 270
120 3300005354 Ga0070675_100212814 Ga0070675_1002128142 270
121 3300005364 Ga0070673_100011067 Ga0070673_1000110674 270
122 3300005440 Ga0070705_100135440 Ga0070705_1001354402 270
123 3300005466 Ga0070685_10143686 Ga0070685_101436863 270
124 3300005471 Ga0070698_100049505 Ga0070698_1000495052 270
125 3300005518 Ga0070699_100000339 Ga0070699_10000033912 270
126 3300005546 Ga0070696_100125184 Ga0070696_1001251842 270
127 3300005549 Ga0070704_100116285 Ga0070704_1001162852 270
128 3300005617 Ga0068859_100101945 Ga0068859_1001019454 270
129 3300006844 Ga0075428_100051934 Ga0075428_1000519343 270
130 3300006846 Ga0075430_100040989 Ga0075430_1000409892 270
131 3300006847 Ga0075431_100090962 Ga0075431_1000909623 270
132 3300006847 Ga0075431_100204632 Ga0075431_1002046323 270
133 3300006847 Ga0075431_100329722 Ga0075431_1003297222 270
134 3300006852 Ga0075433_10202027 Ga0075433_102020272 270
135 3300006880 Ga0075429_100052468 Ga0075429_1000524684 270
136 3300006880 Ga0075429_100196292 Ga0075429_1001962922 270
137 3300006931 Ga0097620_100101943 Ga0097620_1001019434 270
138 3300009094 Ga0111539_10000044 Ga0111539_1000004472 270
139 3300009094 Ga0111539_10001774 Ga0111539_1000177426 270
140 3300009094 Ga0111539_10055455 Ga0111539_100554553 270
141 3300009094 Ga0111539_10324706 Ga0111539_103247062 270
142 3300009147 Ga0114129_10003198 Ga0114129_100031982 270
143 3300009147 Ga0114129_10009872 Ga0114129_1000987212 270
144 3300009147 Ga0114129_10029480 Ga0114129_100294808 270
145 3300013308 Ga0157375_10062458 Ga0157375_100624582 270
146 3300014326 Ga0157380_10536658 Ga0157380_105366582 270
147 3300025315 Ga0207697_10068491 Ga0207697_100684912 270
148 3300025926 Ga0207659_10029682 Ga0207659_100296824 270
149 3300025933 Ga0207706_10218302 Ga0207706_102183022 270
150 3300025936 Ga0207670_10079787 Ga0207670_100797872 270
151 3300025936 Ga0207670_10108480 Ga0207670_101084802 270
152 3300025940 Ga0207691_10049189 Ga0207691_100491895 270
153 3300026089 Ga0207648_10305841 Ga0207648_103058412 270
154 3300027907 Ga0207428_10000353 Ga0207428_1000035322 270
155 3300027907 Ga0207428_10069176 Ga0207428_100691762 270
156 3300028380 Ga0268265_10196089 Ga0268265_101960892 270
157 3300037418 Ga0395900_0394320 Ga0395900_0394320_13_846 270
158 3300042001 Ga0439441_015397 Ga0439441_015397_198_1031 270
159 3300042530 Ga0450916_000840 Ga0450916_000840_223_1056 270
160 3300042876 Ga0451577_0071562 Ga0451577_0071562_762_1580 270
161 3300044712 Ga0453684_0059299 Ga0453684_0059299_1075_1893 270
162 3300046615 Ga0495656_0033659 Ga0495656_0033659_537_1370 270
163 3300046664 Ga0495659_0020455 Ga0495659_0020455_584_1417 270
164 3300048912 Ga0496109_0055599 Ga0496109_0055599_1341_2174 270
165 3300048916 Ga0496113_0037187 Ga0496113_0037187_2238_3071 270
166 3300049575 Ga0501039_0093895 Ga0501039_0093895_509_1342 270
167 3300049578 Ga0501042_0003889 Ga0501042_0003889_6261_7094 270
168 3300049580 Ga0501046_0348896 Ga0501046_0348896_78_911 270
169 3300049587 Ga0501071_0158449 Ga0501071_0158449_482_1315 270
170 3300049590 Ga0501074_0330732 Ga0501074_0330732_142_975 270
171 3300049593 Ga0501077_0132067 Ga0501077_0132067_501_1334 270
172 3300049741 Ga0501079_0262337 Ga0501079_0262337_421_1254 270
173 3300049824 Ga0501045_0089081 Ga0501045_0089081_891_1724 270
174 3300050507 nmdc:mga05p37_282105_c1 nmdc:mga05p37_282105_c1_859_1692 270
175 3300050507 nmdc:mga05p37_28799_c1 nmdc:mga05p37_28799_c1_887_1720 270
176 3300050507 nmdc:mga05p37_35576_c1 nmdc:mga05p37_35576_c1_292_1125 270
177 3300050507 nmdc:mga05p37_92576_c1 nmdc:mga05p37_92576_c1_2818_3660 270
178 3300050508 nmdc:mga09592_106396_c1 nmdc:mga09592_106396_c1_1027_1860 270
179 3300050508 nmdc:mga09592_164039_c1 nmdc:mga09592_164039_c1_1017_1850 270
180 3300050508 nmdc:mga09592_316135_c1 nmdc:mga09592_316135_c1_105_938 270
181 3300050508 nmdc:mga09592_393425_c1 nmdc:mga09592_393425_c1_309_1142 270
182 3300050509 nmdc:mga0qj67_66977_c1 nmdc:mga0qj67_66977_c1_653_1486 270
183 3300050510 nmdc:mga06r32_206675_c1 nmdc:mga06r32_206675_c1_1027_1860 270
184 3300050510 nmdc:mga06r32_209770_c1 nmdc:mga06r32_209770_c1_684_1517 270
185 3300050511 nmdc:mga08y16_32226_c1 nmdc:mga08y16_32226_c1_497_1330 270
186 3300050511 nmdc:mga08y16_375226_c1 nmdc:mga08y16_375226_c1_331_1164 270
187 3300050511 nmdc:mga08y16_40195_c1 nmdc:mga08y16_40195_c1_1575_2408 270
188 3300050511 nmdc:mga08y16_945_c1 nmdc:mga08y16_945_c1_26152_26985 270
189 3300050512 nmdc:mga0n895_467810_c1 nmdc:mga0n895_467810_c1_57_890 270
190 3300050515 nmdc:mga0a205_220729_c1 nmdc:mga0a205_220729_c1_167_1000 270
191 3300060353 Ga0501082_0006994 Ga0501082_0006994_8350_9183 270
192 3300005344 Ga0070661_100215027 Ga0070661_1002150272 271
193 3300005364 Ga0070673_100174804 Ga0070673_1001748042 271
194 3300005364 Ga0070673_100330612 Ga0070673_1003306121 271
195 3300005366 Ga0070659_100064075 Ga0070659_1000640753 271
196 3300005456 Ga0070678_100165541 Ga0070678_1001655413 271
197 3300005459 Ga0068867_100071966 Ga0068867_1000719662 271
198 3300005471 Ga0070698_100022784 Ga0070698_1000227847 271
199 3300005471 Ga0070698_100059186 Ga0070698_1000591862 271
200 3300005546 Ga0070696_100062338 Ga0070696_1000623382 271
201 3300005548 Ga0070665_100031333 Ga0070665_1000313331 271
202 3300005564 Ga0070664_100027774 Ga0070664_1000277744 271
203 3300005719 Ga0068861_100120742 Ga0068861_1001207423 271
204 3300006173 Ga0070716_100262996 Ga0070716_1002629962 271
205 3300006846 Ga0075430_100022848 Ga0075430_1000228482 271
206 3300006871 Ga0075434_100038568 Ga0075434_1000385683 271
207 3300006871 Ga0075434_100255165 Ga0075434_1002551652 271
208 3300006881 Ga0068865_100112314 Ga0068865_1001123142 271
209 3300006881 Ga0068865_100241631 Ga0068865_1002416312 271
210 3300006914 Ga0075436_100125073 Ga0075436_1001250732 271
211 3300007076 Ga0075435_100010574 Ga0075435_1000105743 271
212 3300009098 Ga0105245_10008629 Ga0105245_1000862911 271
213 3300009147 Ga0114129_10160493 Ga0114129_101604933 271
214 3300009176 Ga0105242_10290514 Ga0105242_102905141 271
215 3300009176 Ga0105242_10476981 Ga0105242_104769811 271
216 3300009177 Ga0105248_10647238 Ga0105248_106472381 271
217 3300009553 Ga0105249_10043919 Ga0105249_100439194 271
218 3300013306 Ga0163162_10168863 Ga0163162_101688632 271
219 3300013308 Ga0157375_10209089 Ga0157375_102090892 271
220 3300014969 Ga0157376_10057545 Ga0157376_100575452 271
221 3300025910 Ga0207684_10568773 Ga0207684_105687732 271
222 3300025922 Ga0207646_10332477 Ga0207646_103324771 271
223 3300025927 Ga0207687_10014295 Ga0207687_100142954 271
224 3300025932 Ga0207690_10199165 Ga0207690_101991652 271
225 3300025934 Ga0207686_10034387 Ga0207686_100343872 271
226 3300025938 Ga0207704_10038855 Ga0207704_100388552 271
227 3300026023 Ga0207677_10056451 Ga0207677_100564511 271
228 3300026075 Ga0207708_10111947 Ga0207708_101119471 271
229 3300026089 Ga0207648_10087655 Ga0207648_100876552 271
230 3300028379 Ga0268266_10211239 Ga0268266_102112391 271
231 3300028380 Ga0268265_10066118 Ga0268265_100661182 271
232 3300031711 Ga0265314_10084420 Ga0265314_100844201 271
233 3300035111 Ga0373923_0040693 Ga0373923_0040693_1074_1904 271
234 3300035120 Ga0373957_0135763 Ga0373957_0135763_58_891 271
235 3300035170 Ga0373943_0003682 Ga0373943_0003682_593_1423 271
236 3300035171 Ga0373946_0009173 Ga0373946_0009173_1884_2714 271
237 3300035172 Ga0373955_0004579 Ga0373955_0004579_3847_4677 271
238 3300035410 Ga0373924_0003631 Ga0373924_0003631_740_1570 271
239 3300035692 Ga0373935_0178182 Ga0373935_0178182_606_1436 271
240 3300035695 Ga0373927_0371273 Ga0373927_0371273_58_888 271
241 3300037068 Ga0373925_0148733 Ga0373925_0148733_10_840 271
242 3300037068 Ga0373925_0171535 Ga0373925_0171535_197_1027 271
243 3300046472 Ga0495580_0118487 Ga0495580_0118487_299_1129 271
244 3300046511 Ga0495608_0003468 Ga0495608_0003468_6247_7077 271
245 3300046517 Ga0495630_0016655 Ga0495630_0016655_3894_4724 271
246 3300046529 Ga0495652_0164291 Ga0495652_0164291_220_1050 271
247 3300046536 Ga0495587_0039508 Ga0495587_0039508_1371_2201 271
248 3300046681 Ga0495647_0111633 Ga0495647_0111633_87_917 271
249 3300046683 Ga0495658_0117678 Ga0495658_0117678_174_1004 271
250 3300046684 Ga0495669_0001215 Ga0495669_0001215_4023_4853 271
251 3300046689 Ga0495613_0003695 Ga0495613_0003695_6377_7207 271
252 3300047317 Ga0495604_0062959 Ga0495604_0062959_1755_2585 271
253 3300047319 Ga0495674_0009481 Ga0495674_0009481_2524_3354 271
254 3300047319 Ga0495674_0179328 Ga0495674_0179328_46_876 271
255 3300047471 Ga0495684_0000601 Ga0495684_0000601_978_1808 271
256 3300050507 nmdc:mga05p37_84584_c1 nmdc:mga05p37_84584_c1_888_1715 271
257 3300050509 nmdc:mga0qj67_4306_c2 nmdc:mga0qj67_4306_c2_4286_5116 271
258 3300050511 nmdc:mga08y16_273023_c1 nmdc:mga08y16_273023_c1_513_1343 271
259 3300050512 nmdc:mga0n895_10821_c1 nmdc:mga0n895_10821_c1_7132_7971 271
260 3300050512 nmdc:mga0n895_39130_c1 nmdc:mga0n895_39130_c1_2788_3615 271
261 3300050513 nmdc:mga0rr50_21346_c1 nmdc:mga0rr50_21346_c1_2903_3730 271
262 3300050514 nmdc:mga08x19_123848_c1 nmdc:mga08x19_123848_c1_387_1214 271
263 3300050515 nmdc:mga0a205_210015_c1 nmdc:mga0a205_210015_c1_816_1646 271
264 3300050515 nmdc:mga0a205_4601_c1 nmdc:mga0a205_4601_c1_10490_11317 271
265 3300053077 Ga0495601_0055214 Ga0495601_0055214_88_918 271
266 3300053085 Ga0495619_0000386 Ga0495619_0000386_9833_10663 271
267 3300003203 JGI25406J46586_10000188 JGI25406J46586_1000018824 272
268 3300005338 Ga0068868_100366735 Ga0068868_1003667351 272
269 3300005344 Ga0070661_100114605 Ga0070661_1001146052 272
270 3300005536 Ga0070697_100269293 Ga0070697_1002692932 272
271 3300005985 Ga0081539_10000013 Ga0081539_10000013362 272
272 3300026023 Ga0207677_10277135 Ga0207677_102771352 272
273 3300049575 Ga0501039_0074972 Ga0501039_0074972_63_902 273
274 3300049576 Ga0501040_0033029 Ga0501040_0033029_2085_2924 273
275 3300049577 Ga0501041_0092802 Ga0501041_0092802_438_1277 273
276 3300049578 Ga0501042_0342725 Ga0501042_0342725_63_902 273
277 3300049580 Ga0501046_0075810 Ga0501046_0075810_931_1770 273
278 3300049592 Ga0501076_0190632 Ga0501076_0190632_685_1524 273
279 3300049593 Ga0501077_0051690 Ga0501077_0051690_321_1160 273
280 3300061734 Ga0530510_0004934 Ga0530510_0004934_560_1399 273
281 3300001977 JGI24746J21847_1005383 JGI24746J21847_10053832 275
282 3300005288 Ga0065714_10108694 Ga0065714_101086942 275
283 3300005290 Ga0065712_10071830 Ga0065712_100718302 275
284 3300005290 Ga0065712_10097785 Ga0065712_100977852 275
285 3300005293 Ga0065715_10009149 Ga0065715_100091493 275
286 3300005293 Ga0065715_10198750 Ga0065715_101987502 275
287 3300005328 Ga0070676_10046293 Ga0070676_100462932 275
288 3300005330 Ga0070690_100026105 Ga0070690_1000261052 275
289 3300005330 Ga0070690_100224517 Ga0070690_1002245172 275
290 3300005331 Ga0070670_100008188 Ga0070670_1000081889 275
291 3300005331 Ga0070670_100077047 Ga0070670_1000770472 275
292 3300005333 Ga0070677_10021822 Ga0070677_100218222 275
293 3300005334 Ga0068869_100003236 Ga0068869_1000032362 275
294 3300005338 Ga0068868_100008101 Ga0068868_1000081013 275
295 3300005340 Ga0070689_100051308 Ga0070689_1000513083 275
296 3300005340 Ga0070689_100062586 Ga0070689_1000625863 275
297 3300005340 Ga0070689_100134546 Ga0070689_1001345462 275
298 3300005343 Ga0070687_100016036 Ga0070687_1000160364 275
299 3300005344 Ga0070661_100037274 Ga0070661_1000372742 275
300 3300005345 Ga0070692_10064233 Ga0070692_100642332 275
301 3300005353 Ga0070669_100164344 Ga0070669_1001643442 275
302 3300005354 Ga0070675_100083050 Ga0070675_1000830502 275
303 3300005356 Ga0070674_100202005 Ga0070674_1002020052 275
304 3300005364 Ga0070673_100152749 Ga0070673_1001527492 275
305 3300005365 Ga0070688_100056574 Ga0070688_1000565742 275
306 3300005365 Ga0070688_100099110 Ga0070688_1000991102 275
307 3300005366 Ga0070659_100146248 Ga0070659_1001462482 275
308 3300005367 Ga0070667_100010567 Ga0070667_1000105678 275
309 3300005441 Ga0070700_100094208 Ga0070700_1000942082 275
310 3300005441 Ga0070700_100409431 Ga0070700_1004094311 275
311 3300005456 Ga0070678_100039934 Ga0070678_1000399344 275
312 3300005457 Ga0070662_100085345 Ga0070662_1000853452 275
313 3300005459 Ga0068867_100089238 Ga0068867_1000892382 275
314 3300005466 Ga0070685_10017893 Ga0070685_100178932 275
315 3300005466 Ga0070685_10180385 Ga0070685_101803851 275
316 3300005471 Ga0070698_100420067 Ga0070698_1004200672 275
317 3300005518 Ga0070699_100275613 Ga0070699_1002756133 275
318 3300005543 Ga0070672_100020041 Ga0070672_1000200414 275
319 3300005543 Ga0070672_100097480 Ga0070672_1000974803 275
320 3300005544 Ga0070686_100074620 Ga0070686_1000746202 275
321 3300005548 Ga0070665_100012196 Ga0070665_1000121963 275
322 3300005564 Ga0070664_100011751 Ga0070664_1000117517 275
323 3300005564 Ga0070664_100130213 Ga0070664_1001302132 275
324 3300005577 Ga0068857_100256147 Ga0068857_1002561472 275
325 3300005617 Ga0068859_100044995 Ga0068859_1000449955 275
326 3300005617 Ga0068859_100046545 Ga0068859_1000465454 275
327 3300005719 Ga0068861_100060837 Ga0068861_1000608373 275
328 3300005840 Ga0068870_10033511 Ga0068870_100335113 275
329 3300005840 Ga0068870_10062119 Ga0068870_100621192 275
330 3300005840 Ga0068870_10131221 Ga0068870_101312212 275
331 3300005841 Ga0068863_100133676 Ga0068863_1001336763 275
332 3300005844 Ga0068862_100466306 Ga0068862_1004663062 275
333 3300006237 Ga0097621_100191446 Ga0097621_1001914463 275
334 3300006844 Ga0075428_100000869 Ga0075428_10000086915 275
335 3300006844 Ga0075428_100008219 Ga0075428_1000082193 275
336 3300006844 Ga0075428_100760395 Ga0075428_1007603951 275
337 3300006846 Ga0075430_100492171 Ga0075430_1004921712 275
338 3300006847 Ga0075431_100049128 Ga0075431_1000491283 275
339 3300006871 Ga0075434_100078720 Ga0075434_1000787202 275
340 3300006880 Ga0075429_100079071 Ga0075429_1000790713 275
341 3300006880 Ga0075429_100096904 Ga0075429_1000969042 275
342 3300006880 Ga0075429_100463729 Ga0075429_1004637291 275
343 3300006881 Ga0068865_100017474 Ga0068865_1000174744 275
344 3300006931 Ga0097620_100044994 Ga0097620_1000449945 275
345 3300006931 Ga0097620_100046547 Ga0097620_1000465474 275
346 3300009094 Ga0111539_10000769 Ga0111539_100007698 275
347 3300009094 Ga0111539_10100266 Ga0111539_101002664 275
348 3300009094 Ga0111539_10242372 Ga0111539_102423722 275
349 3300009098 Ga0105245_10459839 Ga0105245_104598392 275
350 3300009147 Ga0114129_10132600 Ga0114129_101326003 275
351 3300009147 Ga0114129_11101553 Ga0114129_111015532 275
352 3300009177 Ga0105248_10241039 Ga0105248_102410392 275
353 3300009553 Ga0105249_10001334 Ga0105249_1000133415 275
354 3300011119 Ga0105246_10021871 Ga0105246_100218712 275
355 3300013102 Ga0157371_10043810 Ga0157371_100438102 275
356 3300013296 Ga0157374_10215050 Ga0157374_102150503 275
357 3300013306 Ga0163162_10033186 Ga0163162_100331863 275
358 3300013306 Ga0163162_10182938 Ga0163162_101829382 275
359 3300013308 Ga0157375_10018181 Ga0157375_100181812 275
360 3300013308 Ga0157375_10301418 Ga0157375_103014182 275
361 3300014325 Ga0163163_10140451 Ga0163163_101404512 275
362 3300014326 Ga0157380_10007439 Ga0157380_100074398 275
363 3300014326 Ga0157380_10274561 Ga0157380_102745612 275
364 3300014745 Ga0157377_10015219 Ga0157377_100152193 275
365 3300014968 Ga0157379_10003739 Ga0157379_100037393 275
366 3300014969 Ga0157376_10052484 Ga0157376_100524844 275
367 3300017792 Ga0163161_10023461 Ga0163161_100234614 275
368 3300017792 Ga0163161_10042869 Ga0163161_100428692 275
369 3300025315 Ga0207697_10001514 Ga0207697_1000151413 275
370 3300025315 Ga0207697_10091137 Ga0207697_100911372 275
371 3300025893 Ga0207682_10001841 Ga0207682_100018419 275
372 3300025893 Ga0207682_10003394 Ga0207682_100033948 275
373 3300025901 Ga0207688_10001443 Ga0207688_100014438 275
374 3300025903 Ga0207680_10105873 Ga0207680_101058732 275
375 3300025907 Ga0207645_10001881 Ga0207645_100018818 275
376 3300025907 Ga0207645_10043765 Ga0207645_100437653 275
377 3300025908 Ga0207643_10005281 Ga0207643_100052818 275
378 3300025908 Ga0207643_10015261 Ga0207643_100152613 275
379 3300025908 Ga0207643_10039643 Ga0207643_100396433 275
380 3300025918 Ga0207662_10002054 Ga0207662_100020546 275
381 3300025920 Ga0207649_10088325 Ga0207649_100883252 275
382 3300025923 Ga0207681_10074125 Ga0207681_100741252 275
383 3300025923 Ga0207681_10081612 Ga0207681_100816122 275
384 3300025923 Ga0207681_10146939 Ga0207681_101469392 275
385 3300025925 Ga0207650_10083205 Ga0207650_100832053 275
386 3300025925 Ga0207650_10211843 Ga0207650_102118432 275
387 3300025926 Ga0207659_10002242 Ga0207659_100022422 275
388 3300025926 Ga0207659_10147555 Ga0207659_101475552 275
389 3300025926 Ga0207659_10293757 Ga0207659_102937572 275
390 3300025933 Ga0207706_10003425 Ga0207706_1000342511 275
391 3300025936 Ga0207670_10245445 Ga0207670_102454452 275
392 3300025937 Ga0207669_10307745 Ga0207669_103077452 275
393 3300025938 Ga0207704_10016569 Ga0207704_100165694 275
394 3300025940 Ga0207691_10005705 Ga0207691_1000570513 275
395 3300025940 Ga0207691_10027241 Ga0207691_100272415 275
396 3300025940 Ga0207691_10030625 Ga0207691_100306253 275
397 3300025941 Ga0207711_10126377 Ga0207711_101263772 275
398 3300025942 Ga0207689_10000831 Ga0207689_100008317 275
399 3300025942 Ga0207689_10395547 Ga0207689_103955471 275
400 3300025960 Ga0207651_10061581 Ga0207651_100615812 275
401 3300025960 Ga0207651_10217778 Ga0207651_102177782 275
402 3300025960 Ga0207651_10323620 Ga0207651_103236201 275
403 3300025961 Ga0207712_10002418 Ga0207712_100024188 275
404 3300025972 Ga0207668_10063916 Ga0207668_100639163 275
405 3300026023 Ga0207677_10074628 Ga0207677_100746283 275
406 3300026035 Ga0207703_10086035 Ga0207703_100860352 275
407 3300026075 Ga0207708_10198955 Ga0207708_101989552 275
408 3300026075 Ga0207708_10251301 Ga0207708_102513011 275
409 3300026088 Ga0207641_10042542 Ga0207641_100425424 275
410 3300026089 Ga0207648_10048633 Ga0207648_100486332 275
411 3300026116 Ga0207674_10089328 Ga0207674_100893284 275
412 3300026118 Ga0207675_100004015 Ga0207675_1000040158 275
413 3300026118 Ga0207675_100093451 Ga0207675_1000934513 275
414 3300026118 Ga0207675_100323156 Ga0207675_1003231562 275
415 3300026121 Ga0207683_10021244 Ga0207683_100212442 275
416 3300026121 Ga0207683_10093639 Ga0207683_100936392 275
417 3300027907 Ga0207428_10002217 Ga0207428_1000221717 275
418 3300027907 Ga0207428_10004706 Ga0207428_1000470610 275
419 3300028379 Ga0268266_10336344 Ga0268266_103363442 275
420 3300028380 Ga0268265_10058496 Ga0268265_100584963 275
421 3300028380 Ga0268265_10062280 Ga0268265_100622802 275
422 3300028381 Ga0268264_10088574 Ga0268264_100885742 275
423 3300031731 Ga0307405_10036021 Ga0307405_100360212 275
424 3300031852 Ga0307410_10009560 Ga0307410_100095606 275
425 3300031903 Ga0307407_10042811 Ga0307407_100428113 275
426 3300031911 Ga0307412_10010531 Ga0307412_100105316 275
427 3300031995 Ga0307409_100011842 Ga0307409_1000118426 275
428 3300032002 Ga0307416_100004482 Ga0307416_1000044822 275
429 3300032004 Ga0307414_10044810 Ga0307414_100448102 275
430 3300032005 Ga0307411_10016639 Ga0307411_100166393 275
431 3300032126 Ga0307415_100053170 Ga0307415_1000531702 275
432 3300035084 Ga0373928_0020210 Ga0373928_0020210_227_1063 275
433 3300035241 Ga0373961_0006165 Ga0373961_0006165_1841_2677 275
434 3300035691 Ga0373931_0022676 Ga0373931_0022676_1756_2592 275
435 3300042156 Ga0439446_0057618 Ga0439446_0057618_209_1051 275
436 3300046537 Ga0495598_0016109 Ga0495598_0016109_630_1472 275
437 3300046558 Ga0495633_0045317 Ga0495633_0045317_714_1556 275
438 3300046615 Ga0495656_0109244 Ga0495656_0109244_318_1148 275
439 3300049578 Ga0501042_0236178 Ga0501042_0236178_448_1275 275
440 3300049591 Ga0501075_0310479 Ga0501075_0310479_150_977 275
441 3300050508 nmdc:mga09592_18887_c1 nmdc:mga09592_18887_c1_4232_5074 275
442 3300050509 nmdc:mga0qj67_93568_c1 nmdc:mga0qj67_93568_c1_1483_2325 275
443 3300050511 nmdc:mga08y16_12914_c1 nmdc:mga08y16_12914_c1_336_1172 275
444 3300050511 nmdc:mga08y16_50424_c1 nmdc:mga08y16_50424_c1_2804_3646 275
445 3300050511 nmdc:mga08y16_5828_c1 nmdc:mga08y16_5828_c1_6894_7733 275
446 3300050512 nmdc:mga0n895_81489_c1 nmdc:mga0n895_81489_c1_2137_2973 275
447 3300050515 nmdc:mga0a205_1497_c1 nmdc:mga0a205_1497_c1_7417_8253 275
448 3300005333 Ga0070677_10044875 Ga0070677_100448753 276
449 3300005336 Ga0070680_100065511 Ga0070680_1000655112 276
450 3300005343 Ga0070687_100013368 Ga0070687_1000133684 276
451 3300005356 Ga0070674_100001500 Ga0070674_1000015008 276
452 3300005459 Ga0068867_100186096 Ga0068867_1001860962 276
453 3300005577 Ga0068857_100033732 Ga0068857_1000337323 276
454 3300005577 Ga0068857_100181226 Ga0068857_1001812262 276
455 3300006844 Ga0075428_100119341 Ga0075428_1001193412 276
456 3300006871 Ga0075434_100008828 Ga0075434_1000088287 276
457 3300006871 Ga0075434_100109915 Ga0075434_1001099152 276
458 3300007076 Ga0075435_100050563 Ga0075435_1000505634 276
459 3300009147 Ga0114129_10006054 Ga0114129_100060543 276
460 3300009147 Ga0114129_10176742 Ga0114129_101767422 276
461 3300014326 Ga0157380_10003886 Ga0157380_1000388611 276
462 3300014326 Ga0157380_10278188 Ga0157380_102781882 276
463 3300025893 Ga0207682_10148890 Ga0207682_101488902 276
464 3300025908 Ga0207643_10020319 Ga0207643_100203193 276
465 3300025917 Ga0207660_10280256 Ga0207660_102802562 276
466 3300025926 Ga0207659_10014600 Ga0207659_100146002 276
467 3300025933 Ga0207706_10292309 Ga0207706_102923092 276
468 3300025937 Ga0207669_10001529 Ga0207669_100015296 276
469 3300025942 Ga0207689_10210793 Ga0207689_102107932 276
470 3300026116 Ga0207674_10043449 Ga0207674_100434493 276
471 3300026116 Ga0207674_10095960 Ga0207674_100959603 276
472 3300026121 Ga0207683_10059137 Ga0207683_100591373 276
473 3300045051 Ga0451576_0013731 Ga0451576_0013731_875_1705 276
474 3300046525 Ga0495663_0059105 Ga0495663_0059105_117_947 276
475 3300046664 Ga0495659_0035277 Ga0495659_0035277_831_1661 276
476 3300046683 Ga0495658_0059852 Ga0495658_0059852_409_1239 276
477 3300050507 nmdc:mga05p37_17011_c1 nmdc:mga05p37_17011_c1_2298_3128 276
478 3300050508 nmdc:mga09592_135869_c1 nmdc:mga09592_135869_c1_871_1701 276
479 3300050512 nmdc:mga0n895_27620_c1 nmdc:mga0n895_27620_c1_1973_2803 276
480 3300050512 nmdc:mga0n895_86092_c1 nmdc:mga0n895_86092_c1_2153_2986 276
481 3300050513 nmdc:mga0rr50_119416_c1 nmdc:mga0rr50_119416_c1_496_1326 276
482 3300050515 nmdc:mga0a205_44250_c1 nmdc:mga0a205_44250_c1_26_859 276
483 3300050515 nmdc:mga0a205_71273_c1 nmdc:mga0a205_71273_c1_2176_3006 276
484 2162886007 SwRhRL2b_contig_3495822 SwRhRL2b_0361.00002870 277
485 2162886007 SwRhRL2b_contig_757619 SwRhRL2b_0133.00005430 277
486 3300005289 Ga0065704_10242024 Ga0065704_102420241 277
487 3300005295 Ga0065707_10006880 Ga0065707_100068803 277
488 3300005295 Ga0065707_10095648 Ga0065707_100956482 277
489 3300005328 Ga0070676_10023781 Ga0070676_100237812 277
490 3300005329 Ga0070683_100201078 Ga0070683_1002010782 277
491 3300005329 Ga0070683_100440231 Ga0070683_1004402311 277
492 3300005340 Ga0070689_100014552 Ga0070689_1000145524 277
493 3300005353 Ga0070669_100002727 Ga0070669_10000272713 277
494 3300005355 Ga0070671_100029642 Ga0070671_1000296422 277
495 3300005355 Ga0070671_100544321 Ga0070671_1005443211 277
496 3300005364 Ga0070673_100273664 Ga0070673_1002736642 277
497 3300005365 Ga0070688_100157964 Ga0070688_1001579642 277
498 3300005367 Ga0070667_100484271 Ga0070667_1004842712 277
499 3300005438 Ga0070701_10021663 Ga0070701_100216634 277
500 3300005441 Ga0070700_100018991 Ga0070700_1000189914 277
501 3300005444 Ga0070694_100300369 Ga0070694_1003003692 277
502 3300005458 Ga0070681_10025905 Ga0070681_100259056 277
503 3300005459 Ga0068867_100000147 Ga0068867_10000014727 277
504 3300005468 Ga0070707_100228446 Ga0070707_1002284463 277
505 3300005468 Ga0070707_100283272 Ga0070707_1002832722 277
506 3300005518 Ga0070699_100024512 Ga0070699_1000245124 277
507 3300005518 Ga0070699_100192061 Ga0070699_1001920612 277
508 3300005530 Ga0070679_100054537 Ga0070679_1000545373 277
509 3300005536 Ga0070697_100204128 Ga0070697_1002041282 277
510 3300005543 Ga0070672_100074274 Ga0070672_1000742743 277
511 3300005544 Ga0070686_100104497 Ga0070686_1001044972 277
512 3300005549 Ga0070704_100028361 Ga0070704_1000283613 277
513 3300005549 Ga0070704_100059667 Ga0070704_1000596672 277
514 3300005564 Ga0070664_100010031 Ga0070664_1000100319 277
515 3300005564 Ga0070664_100160666 Ga0070664_1001606662 277
516 3300005577 Ga0068857_100078821 Ga0068857_1000788213 277
517 3300005617 Ga0068859_100002533 Ga0068859_1000025332 277
518 3300005617 Ga0068859_100068989 Ga0068859_1000689892 277
519 3300005618 Ga0068864_100112652 Ga0068864_1001126522 277
520 3300005618 Ga0068864_100223612 Ga0068864_1002236122 277
521 3300005719 Ga0068861_100001293 Ga0068861_10000129310 277
522 3300005840 Ga0068870_10008632 Ga0068870_100086322 277
523 3300005842 Ga0068858_100185150 Ga0068858_1001851502 277
524 3300005843 Ga0068860_100086446 Ga0068860_1000864463 277
525 3300005844 Ga0068862_100001293 Ga0068862_10000129319 277
526 3300006852 Ga0075433_10002009 Ga0075433_100020093 277
527 3300006852 Ga0075433_10013571 Ga0075433_100135712 277
528 3300006852 Ga0075433_10184104 Ga0075433_101841042 277
529 3300006852 Ga0075433_10493710 Ga0075433_104937102 277
530 3300006871 Ga0075434_100005716 Ga0075434_1000057168 277
531 3300006871 Ga0075434_100008044 Ga0075434_1000080445 277
532 3300006880 Ga0075429_100091302 Ga0075429_1000913022 277
533 3300006881 Ga0068865_100077390 Ga0068865_1000773902 277
534 3300006931 Ga0097620_100002533 Ga0097620_10000253319 277
535 3300006931 Ga0097620_100068989 Ga0097620_1000689892 277
536 3300007076 Ga0075435_100005714 Ga0075435_1000057146 277
537 3300007076 Ga0075435_100065813 Ga0075435_1000658132 277
538 3300007076 Ga0075435_100158714 Ga0075435_1001587142 277
539 3300009094 Ga0111539_10022455 Ga0111539_100224555 277
540 3300009094 Ga0111539_10266868 Ga0111539_102668682 277
541 3300009147 Ga0114129_10003276 Ga0114129_1000327611 277
542 3300009147 Ga0114129_10096834 Ga0114129_100968344 277
543 3300009147 Ga0114129_10846750 Ga0114129_108467502 277
544 3300009553 Ga0105249_10087301 Ga0105249_100873013 277
545 3300011119 Ga0105246_10028237 Ga0105246_100282372 277
546 3300013296 Ga0157374_10264284 Ga0157374_102642842 277
547 3300013297 Ga0157378_10099238 Ga0157378_100992383 277
548 3300013297 Ga0157378_10216219 Ga0157378_102162192 277
549 3300013308 Ga0157375_10033798 Ga0157375_100337984 277
550 3300013308 Ga0157375_10164865 Ga0157375_101648652 277
551 3300013308 Ga0157375_10348737 Ga0157375_103487372 277
552 3300014745 Ga0157377_10002991 Ga0157377_100029912 277
553 3300014745 Ga0157377_10093693 Ga0157377_100936932 277
554 3300014969 Ga0157376_10225378 Ga0157376_102253782 277
555 3300025893 Ga0207682_10014594 Ga0207682_100145942 277
556 3300025904 Ga0207647_10098223 Ga0207647_100982232 277
557 3300025907 Ga0207645_10027133 Ga0207645_100271331 277
558 3300025908 Ga0207643_10005748 Ga0207643_100057485 277
559 3300025918 Ga0207662_10020005 Ga0207662_100200051 277
560 3300025921 Ga0207652_10085534 Ga0207652_100855342 277
561 3300025922 Ga0207646_10247413 Ga0207646_102474132 277
562 3300025923 Ga0207681_10000566 Ga0207681_1000056616 277
563 3300025926 Ga0207659_10001222 Ga0207659_100012228 277
564 3300025926 Ga0207659_10231190 Ga0207659_102311902 277
565 3300025936 Ga0207670_10014557 Ga0207670_100145574 277
566 3300025940 Ga0207691_10025779 Ga0207691_100257794 277
567 3300025944 Ga0207661_10020477 Ga0207661_100204776 277
568 3300025945 Ga0207679_10366979 Ga0207679_103669792 277
569 3300025960 Ga0207651_10118570 Ga0207651_101185702 277
570 3300025961 Ga0207712_10029712 Ga0207712_100297123 277
571 3300025972 Ga0207668_10050926 Ga0207668_100509263 277
572 3300025986 Ga0207658_10281318 Ga0207658_102813182 277
573 3300026041 Ga0207639_10142279 Ga0207639_101422792 277
574 3300026075 Ga0207708_10070416 Ga0207708_100704162 277
575 3300026075 Ga0207708_10089859 Ga0207708_100898592 277
576 3300026089 Ga0207648_10000446 Ga0207648_1000044627 277
577 3300026095 Ga0207676_10120036 Ga0207676_101200363 277
578 3300026116 Ga0207674_10057586 Ga0207674_100575863 277
579 3300026118 Ga0207675_100001058 Ga0207675_10000105810 277
580 3300026121 Ga0207683_10038673 Ga0207683_100386733 277
581 3300027907 Ga0207428_10000224 Ga0207428_1000022464 277
582 3300028380 Ga0268265_10000540 Ga0268265_1000054024 277
583 3300028381 Ga0268264_10036528 Ga0268264_100365282 277
584 3300042876 Ga0451577_0363512 Ga0451577_0363512_422_1255 277
585 3300045051 Ga0451576_0021675 Ga0451576_0021675_505_1338 277
586 3300045051 Ga0451576_0052019 Ga0451576_0052019_549_1382 277
587 3300045051 Ga0451576_0177479 Ga0451576_0177479_1258_2091 277
588 3300046539 Ga0495621_0000539 Ga0495621_0000539_1435_2268 277
589 3300046539 Ga0495621_0012526 Ga0495621_0012526_1168_2001 277
590 3300046664 Ga0495659_0016434 Ga0495659_0016434_689_1522 277
591 3300046684 Ga0495669_0074664 Ga0495669_0074664_86_919 277
592 3300047318 Ga0495636_0072670 Ga0495636_0072670_141_974 277
593 3300047445 Ga0495677_0071882 Ga0495677_0071882_107_940 277
594 3300050507 nmdc:mga05p37_136169_c1 nmdc:mga05p37_136169_c1_1770_2606 277
595 3300050507 nmdc:mga05p37_358361_c1 nmdc:mga05p37_358361_c1_199_1059 277
596 3300050507 nmdc:mga05p37_429140_c1 nmdc:mga05p37_429140_c1_471_1304 277
597 3300050508 nmdc:mga09592_274532_c1 nmdc:mga09592_274532_c1_101_934 277
598 3300050511 nmdc:mga08y16_15575_c1 nmdc:mga08y16_15575_c1_3362_4195 277
599 3300050511 nmdc:mga08y16_48255_c1 nmdc:mga08y16_48255_c1_2164_3030 277
600 3300050512 nmdc:mga0n895_4485_c1 nmdc:mga0n895_4485_c1_660_1520 277
601 3300050512 nmdc:mga0n895_6752_c1 nmdc:mga0n895_6752_c1_8285_9145 277
602 3300050512 nmdc:mga0n895_802454_c1 nmdc:mga0n895_802454_c1_58_894 277
603 3300050512 nmdc:mga0n895_98386_c1 nmdc:mga0n895_98386_c1_432_1265 277
604 3300050513 nmdc:mga0rr50_108527_c1 nmdc:mga0rr50_108527_c1_510_1346 277
605 3300050513 nmdc:mga0rr50_190578_c1 nmdc:mga0rr50_190578_c1_822_1655 277
606 3300050515 nmdc:mga0a205_129737_c1 nmdc:mga0a205_129737_c1_788_1624 277
607 3300050515 nmdc:mga0a205_808_c1 nmdc:mga0a205_808_c1_14195_15055 277

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13277

YmdB

YmdB-like protein

8

257

0.98

PF00149

Metallophos

Calcineurin-like phosphoesterase

5

183

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
4b2o-assembly1.cif.gz_D crystal structure of bacillus subtilis ymdb, a global regulator of late adaptive responses. 0.902 1 261
4b2o-assembly1.cif.gz_D crystal structure of bacillus subtilis ymdb, a global regulator of late adaptive responses. 0.8858 1 261
1t70-assembly3.cif.gz_E crystal structure of a novel phosphatase from deinococcus radiodurans 0.8755 1 258
1t70-assembly3.cif.gz_E crystal structure of a novel phosphatase from deinococcus radiodurans 0.8668 1 258
1t71-assembly1.cif.gz_A crystal structure of a novel phosphatase mycoplasma pneumoniaefrom 0.8605 1 258
ID Description Score Start End Superfamily
4b2oD00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.902 1 261 3.60.21.10
4b2oD00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8858 1 261 3.60.21.10
1t71A00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8605 1 258 3.60.21.10
2z06B00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8563 1 258 3.60.21.10
2z06B00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8467 1 258 3.60.21.10
ID Description Score Start End GO Terms
AF-A0A383ALH3-F1-model_v4 Calcineurin-like phosphoesterase domain-containing protein 1.002 1 79 GO:0004113
AF-A0A3B0PD68-F1-model_v4 Metallophosphoesterase YmdB 0.9972 1 70 GO:0004113
AF-A0A2V6E159-F1-model_v4 Metallophosphoesterase 0.996 1 102 GO:0004113
AF-A0A538H8X2-F1-model_v4 YmdB family metallophosphoesterase 0.9951 1 99 GO:0004113
AF-A0A7Y2JDI4-F1-model_v4 Metallophosphoesterase 0.9942 1 61 GO:0004113

Feature Viewer

pLDDT pTM Quality
89.97 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map