F468707
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 607 | 232 | 607 | 276 |
Family's Representative Sequence
| Representative Sequence | 3300031733|Ga0316577_10001199|Ga0316577_100011993 |
| Length | 270 |
| Sequence | MRDKYGILFLGDVIGRPGRRALRKFLPVLLEKYSPSLVVANGENAAGGIGITPDICRQLLAQVDVLTSGNHIWDKREAIEYLDVEPRLLRPANYPSPNPGKGVYAFETREGFQVAILNLQGRVFMEPIDCPFRAADKELALLEGKKTITLVDFHAEATSEKQAMGWYLDGRVSAVVGTHTHVPTADEKILPQGTAFITDVGMVGGYASVIGLKKEQALQRFLTSRPQRFEPGKQGLVSSSLFVDVDTQTGKAISIQRDMLYEDVKENEHL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 7 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 53 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 54 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 56 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 57 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 58 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 59 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 60 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 61 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 62 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 63 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 64 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 65 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 68 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 69 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 70 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 71 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 72 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 73 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 74 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 75 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 76 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 78 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 148 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 152 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 153 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 154 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 155 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 156 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 157 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 158 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 159 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 160 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 161 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 162 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 163 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 164 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 165 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 166 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 167 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 168 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 169 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 170 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 171 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 172 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 173 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 174 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 175 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 176 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 177 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 178 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 179 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 180 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 181 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 182 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 183 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 184 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 206 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 207 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 208 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 209 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 210 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 211 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 212 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 213 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 214 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 215 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 216 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 217 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 218 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 219 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 220 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 221 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 222 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 223 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 224 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 225 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 226 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 227 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 228 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 229 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 232 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0.49 |
| Rhizosphere | 99.34 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.16 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_3495822 | 2162886007 | Unclassified | 1449 |
| 2 | SwRhRL2b_contig_757619 | 2162886007 | Bacteria | 931 |
| 3 | JGI24746J21847_1005383 | 3300001977 | Bacteria | 1997 |
| 4 | JGI25406J46586_10000188 | 3300003203 | Bacteria | 27540 |
| 5 | Ga0065714_10108694 | 3300005288 | Bacteria | 1511 |
| 6 | Ga0065704_10242024 | 3300005289 | Bacteria | 1012 |
| 7 | Ga0065712_10071830 | 3300005290 | Bacteria | 5038 |
| 8 | Ga0065712_10093172 | 3300005290 | Bacteria | 2303 |
| 9 | Ga0065712_10097785 | 3300005290 | Bacteria | 2139 |
| 10 | Ga0065715_10009149 | 3300005293 | Bacteria | 3229 |
| 11 | Ga0065715_10150770 | 3300005293 | Bacteria | 1732 |
| 12 | Ga0065715_10198750 | 3300005293 | Bacteria | 1373 |
| 13 | Ga0065707_10006880 | 3300005295 | Bacteria | 4371 |
| 14 | Ga0065707_10095648 | 3300005295 | Bacteria | 3336 |
| 15 | Ga0070658_10283380 | 3300005327 | Bacteria | 1411 |
| 16 | Ga0070676_10018577 | 3300005328 | Bacteria | 3855 |
| 17 | Ga0070676_10023781 | 3300005328 | Bacteria | 3445 |
| 18 | Ga0070676_10046293 | 3300005328 | Bacteria | 2536 |
| 19 | Ga0070683_100201078 | 3300005329 | Bacteria | 1892 |
| 20 | Ga0070683_100440231 | 3300005329 | Bacteria | 1244 |
| 21 | Ga0070690_100026105 | 3300005330 | Bacteria | 3600 |
| 22 | Ga0070690_100033795 | 3300005330 | Bacteria | 3203 |
| 23 | Ga0070690_100224517 | 3300005330 | Bacteria | 1318 |
| 24 | Ga0070670_100002877 | 3300005331 | Bacteria | 14242 |
| 25 | Ga0070670_100008188 | 3300005331 | Bacteria | 8902 |
| 26 | Ga0070670_100039805 | 3300005331 | Bacteria | 4042 |
| 27 | Ga0070670_100077047 | 3300005331 | Bacteria | 2865 |
| 28 | Ga0070677_10021822 | 3300005333 | Bacteria | 2352 |
| 29 | Ga0070677_10044875 | 3300005333 | Bacteria | 1761 |
| 30 | Ga0068869_100003236 | 3300005334 | Bacteria | 9954 |
| 31 | Ga0068869_100005463 | 3300005334 | Bacteria | 7997 |
| 32 | Ga0070666_10115833 | 3300005335 | Bacteria | 1856 |
| 33 | Ga0070680_100065511 | 3300005336 | Bacteria | 2977 |
| 34 | Ga0070680_100323441 | 3300005336 | Bacteria | 1309 |
| 35 | Ga0068868_100008101 | 3300005338 | Bacteria | 7516 |
| 36 | Ga0068868_100202796 | 3300005338 | Bacteria | 1654 |
| 37 | Ga0068868_100366735 | 3300005338 | Bacteria | 1237 |
| 38 | Ga0070689_100014552 | 3300005340 | Bacteria | 5718 |
| 39 | Ga0070689_100051308 | 3300005340 | Bacteria | 3189 |
| 40 | Ga0070689_100062586 | 3300005340 | Bacteria | 2896 |
| 41 | Ga0070689_100134546 | 3300005340 | Bacteria | 1984 |
| 42 | Ga0070687_100013368 | 3300005343 | Bacteria | 3658 |
| 43 | Ga0070687_100016036 | 3300005343 | Bacteria | 3404 |
| 44 | Ga0070661_100037274 | 3300005344 | Bacteria | 3536 |
| 45 | Ga0070661_100114605 | 3300005344 | Bacteria | 2015 |
| 46 | Ga0070661_100215027 | 3300005344 | Bacteria | 1473 |
| 47 | Ga0070692_10064233 | 3300005345 | Bacteria | 1941 |
| 48 | Ga0070669_100002727 | 3300005353 | Bacteria | 12739 |
| 49 | Ga0070669_100026198 | 3300005353 | Bacteria | 4195 |
| 50 | Ga0070669_100075890 | 3300005353 | Bacteria | 2494 |
| 51 | Ga0070669_100157077 | 3300005353 | Bacteria | 1765 |
| 52 | Ga0070669_100164344 | 3300005353 | Bacteria | 1727 |
| 53 | Ga0070675_100000537 | 3300005354 | Bacteria | 25951 |
| 54 | Ga0070675_100003145 | 3300005354 | Bacteria | 12491 |
| 55 | Ga0070675_100005576 | 3300005354 | Bacteria | 9637 |
| 56 | Ga0070675_100027847 | 3300005354 | Bacteria | 4543 |
| 57 | Ga0070675_100083050 | 3300005354 | Bacteria | 2673 |
| 58 | Ga0070675_100118918 | 3300005354 | Bacteria | 2244 |
| 59 | Ga0070675_100212814 | 3300005354 | Bacteria | 1681 |
| 60 | Ga0070671_100029642 | 3300005355 | Bacteria | 4512 |
| 61 | Ga0070671_100544321 | 3300005355 | Bacteria | 1001 |
| 62 | Ga0070674_100001500 | 3300005356 | Bacteria | 12440 |
| 63 | Ga0070674_100202005 | 3300005356 | Bacteria | 1535 |
| 64 | Ga0070673_100011067 | 3300005364 | Bacteria | 6147 |
| 65 | Ga0070673_100152749 | 3300005364 | Bacteria | 1956 |
| 66 | Ga0070673_100173764 | 3300005364 | Bacteria | 1840 |
| 67 | Ga0070673_100174804 | 3300005364 | Bacteria | 1835 |
| 68 | Ga0070673_100178630 | 3300005364 | Bacteria | 1816 |
| 69 | Ga0070673_100273664 | 3300005364 | Bacteria | 1479 |
| 70 | Ga0070673_100330612 | 3300005364 | Bacteria | 1348 |
| 71 | Ga0070688_100009604 | 3300005365 | Bacteria | 5301 |
| 72 | Ga0070688_100056574 | 3300005365 | Bacteria | 2463 |
| 73 | Ga0070688_100099110 | 3300005365 | Bacteria | 1918 |
| 74 | Ga0070688_100157964 | 3300005365 | Bacteria | 1556 |
| 75 | Ga0070659_100064075 | 3300005366 | Bacteria | 2909 |
| 76 | Ga0070659_100146248 | 3300005366 | Bacteria | 1926 |
| 77 | Ga0070667_100010567 | 3300005367 | Bacteria | 7620 |
| 78 | Ga0070667_100484271 | 3300005367 | Bacteria | 1133 |
| 79 | Ga0070701_10002485 | 3300005438 | Bacteria | 7123 |
| 80 | Ga0070701_10021663 | 3300005438 | Bacteria | 3071 |
| 81 | Ga0070705_100135440 | 3300005440 | Bacteria | 1613 |
| 82 | Ga0070700_100015111 | 3300005441 | Bacteria | 4371 |
| 83 | Ga0070700_100018991 | 3300005441 | Bacteria | 3962 |
| 84 | Ga0070700_100094208 | 3300005441 | Bacteria | 1960 |
| 85 | Ga0070700_100409431 | 3300005441 | Bacteria | 1022 |
| 86 | Ga0070694_100300369 | 3300005444 | Bacteria | 1230 |
| 87 | Ga0070678_100039934 | 3300005456 | Bacteria | 3316 |
| 88 | Ga0070678_100142803 | 3300005456 | Bacteria | 1918 |
| 89 | Ga0070678_100165541 | 3300005456 | Bacteria | 1796 |
| 90 | Ga0070678_100168194 | 3300005456 | Bacteria | 1783 |
| 91 | Ga0070678_100177709 | 3300005456 | Bacteria | 1740 |
| 92 | Ga0070662_100085345 | 3300005457 | Bacteria | 2359 |
| 93 | Ga0070662_100306350 | 3300005457 | Bacteria | 1292 |
| 94 | Ga0070681_10025905 | 3300005458 | Bacteria | 5896 |
| 95 | Ga0068867_100000147 | 3300005459 | Bacteria | 45184 |
| 96 | Ga0068867_100003422 | 3300005459 | Bacteria | 11159 |
| 97 | Ga0068867_100071966 | 3300005459 | Bacteria | 2587 |
| 98 | Ga0068867_100089238 | 3300005459 | Bacteria | 2338 |
| 99 | Ga0068867_100186096 | 3300005459 | Bacteria | 1654 |
| 100 | Ga0070685_10017893 | 3300005466 | Bacteria | 3803 |
| 101 | Ga0070685_10143686 | 3300005466 | Bacteria | 1505 |
| 102 | Ga0070685_10180385 | 3300005466 | Bacteria | 1359 |
| 103 | Ga0070707_100228446 | 3300005468 | Bacteria | 1812 |
| 104 | Ga0070707_100283272 | 3300005468 | Bacteria | 1610 |
| 105 | Ga0070698_100022784 | 3300005471 | Bacteria | 6549 |
| 106 | Ga0070698_100049505 | 3300005471 | Bacteria | 4288 |
| 107 | Ga0070698_100059186 | 3300005471 | Bacteria | 3870 |
| 108 | Ga0070698_100420067 | 3300005471 | Bacteria | 1272 |
| 109 | Ga0070699_100000339 | 3300005518 | Bacteria | 45340 |
| 110 | Ga0070699_100024512 | 3300005518 | Bacteria | 5199 |
| 111 | Ga0070699_100192061 | 3300005518 | Bacteria | 1814 |
| 112 | Ga0070699_100214118 | 3300005518 | Bacteria | 1716 |
| 113 | Ga0070699_100275613 | 3300005518 | Bacteria | 1506 |
| 114 | Ga0070679_100054537 | 3300005530 | Bacteria | 3980 |
| 115 | Ga0070697_100204128 | 3300005536 | Bacteria | 1680 |
| 116 | Ga0070697_100269293 | 3300005536 | Bacteria | 1460 |
| 117 | Ga0070672_100003678 | 3300005543 | Bacteria | 9967 |
| 118 | Ga0070672_100020041 | 3300005543 | Bacteria | 4872 |
| 119 | Ga0070672_100074274 | 3300005543 | Bacteria | 2712 |
| 120 | Ga0070672_100097480 | 3300005543 | Bacteria | 2380 |
| 121 | Ga0070686_100074620 | 3300005544 | Bacteria | 2229 |
| 122 | Ga0070686_100104497 | 3300005544 | Bacteria | 1919 |
| 123 | Ga0070695_100231791 | 3300005545 | Bacteria | 1335 |
| 124 | Ga0070696_100062338 | 3300005546 | Bacteria | 2610 |
| 125 | Ga0070696_100125184 | 3300005546 | Bacteria | 1864 |
| 126 | Ga0070665_100012196 | 3300005548 | Bacteria | 8665 |
| 127 | Ga0070665_100031333 | 3300005548 | Bacteria | 5351 |
| 128 | Ga0070704_100028361 | 3300005549 | Bacteria | 3723 |
| 129 | Ga0070704_100059667 | 3300005549 | Bacteria | 2723 |
| 130 | Ga0070704_100116285 | 3300005549 | Bacteria | 2045 |
| 131 | Ga0070664_100010031 | 3300005564 | Bacteria | 7676 |
| 132 | Ga0070664_100011751 | 3300005564 | Bacteria | 7107 |
| 133 | Ga0070664_100027774 | 3300005564 | Bacteria | 4705 |
| 134 | Ga0070664_100130213 | 3300005564 | Bacteria | 2209 |
| 135 | Ga0070664_100160666 | 3300005564 | Bacteria | 1988 |
| 136 | Ga0068857_100033732 | 3300005577 | Bacteria | 4527 |
| 137 | Ga0068857_100078821 | 3300005577 | Bacteria | 2940 |
| 138 | Ga0068857_100181226 | 3300005577 | Bacteria | 1917 |
| 139 | Ga0068857_100256147 | 3300005577 | Bacteria | 1605 |
| 140 | Ga0068854_100055078 | 3300005578 | Bacteria | 2862 |
| 141 | Ga0070702_100022601 | 3300005615 | Bacteria | 3328 |
| 142 | Ga0068859_100002533 | 3300005617 | Bacteria | 18549 |
| 143 | Ga0068859_100044995 | 3300005617 | Bacteria | 4435 |
| 144 | Ga0068859_100046545 | 3300005617 | Bacteria | 4356 |
| 145 | Ga0068859_100068989 | 3300005617 | Bacteria | 3570 |
| 146 | Ga0068859_100080631 | 3300005617 | Bacteria | 3296 |
| 147 | Ga0068859_100101945 | 3300005617 | Bacteria | 2928 |
| 148 | Ga0068859_100258832 | 3300005617 | Bacteria | 1831 |
| 149 | Ga0068864_100112652 | 3300005618 | Bacteria | 2425 |
| 150 | Ga0068864_100223612 | 3300005618 | Bacteria | 1738 |
| 151 | Ga0068866_10004135 | 3300005718 | Bacteria | 5950 |
| 152 | Ga0068861_100001293 | 3300005719 | Bacteria | 15634 |
| 153 | Ga0068861_100035291 | 3300005719 | Bacteria | 3703 |
| 154 | Ga0068861_100060837 | 3300005719 | Bacteria | 2896 |
| 155 | Ga0068861_100120742 | 3300005719 | Bacteria | 2114 |
| 156 | Ga0068861_100288460 | 3300005719 | Bacteria | 1416 |
| 157 | Ga0068870_10008632 | 3300005840 | Bacteria | 4593 |
| 158 | Ga0068870_10033511 | 3300005840 | Bacteria | 2621 |
| 159 | Ga0068870_10062119 | 3300005840 | Bacteria | 2011 |
| 160 | Ga0068870_10131221 | 3300005840 | Bacteria | 1455 |
| 161 | Ga0068863_100133676 | 3300005841 | Bacteria | 2369 |
| 162 | Ga0068858_100066511 | 3300005842 | Bacteria | 3337 |
| 163 | Ga0068858_100185150 | 3300005842 | Bacteria | 1967 |
| 164 | Ga0068860_100082640 | 3300005843 | Bacteria | 3055 |
| 165 | Ga0068860_100086446 | 3300005843 | Bacteria | 2984 |
| 166 | Ga0068862_100001293 | 3300005844 | Bacteria | 23404 |
| 167 | Ga0068862_100466306 | 3300005844 | Bacteria | 1193 |
| 168 | Ga0081539_10000013 | 3300005985 | Bacteria | 432395 |
| 169 | Ga0081539_10013539 | 3300005985 | Bacteria | 6136 |
| 170 | Ga0070716_100262996 | 3300006173 | Bacteria | 1181 |
| 171 | Ga0097621_100092943 | 3300006237 | Bacteria | 2527 |
| 172 | Ga0097621_100190319 | 3300006237 | Bacteria | 1777 |
| 173 | Ga0097621_100191446 | 3300006237 | Bacteria | 1771 |
| 174 | Ga0068871_100167506 | 3300006358 | Bacteria | 1882 |
| 175 | Ga0075428_100000869 | 3300006844 | Bacteria | 31758 |
| 176 | Ga0075428_100008219 | 3300006844 | Bacteria | 11575 |
| 177 | Ga0075428_100051934 | 3300006844 | Bacteria | 4495 |
| 178 | Ga0075428_100119341 | 3300006844 | Bacteria | 2872 |
| 179 | Ga0075428_100760395 | 3300006844 | Bacteria | 1031 |
| 180 | Ga0075430_100022848 | 3300006846 | Bacteria | 5319 |
| 181 | Ga0075430_100040989 | 3300006846 | Bacteria | 3918 |
| 182 | Ga0075430_100492171 | 3300006846 | Bacteria | 1012 |
| 183 | Ga0075431_100049128 | 3300006847 | Bacteria | 4351 |
| 184 | Ga0075431_100090962 | 3300006847 | Bacteria | 3150 |
| 185 | Ga0075431_100204632 | 3300006847 | Bacteria | 2018 |
| 186 | Ga0075431_100329722 | 3300006847 | Bacteria | 1537 |
| 187 | Ga0075433_10002009 | 3300006852 | Bacteria | 15330 |
| 188 | Ga0075433_10013571 | 3300006852 | Bacteria | 6631 |
| 189 | Ga0075433_10184104 | 3300006852 | Bacteria | 1858 |
| 190 | Ga0075433_10202027 | 3300006852 | Bacteria | 1767 |
| 191 | Ga0075433_10493710 | 3300006852 | Bacteria | 1078 |
| 192 | Ga0075434_100005716 | 3300006871 | Bacteria | 11358 |
| 193 | Ga0075434_100008044 | 3300006871 | Bacteria | 9777 |
| 194 | Ga0075434_100008828 | 3300006871 | Bacteria | 9381 |
| 195 | Ga0075434_100038568 | 3300006871 | Bacteria | 4731 |
| 196 | Ga0075434_100078720 | 3300006871 | Bacteria | 3292 |
| 197 | Ga0075434_100109915 | 3300006871 | Bacteria | 2767 |
| 198 | Ga0075434_100255165 | 3300006871 | Bacteria | 1772 |
| 199 | Ga0075429_100052468 | 3300006880 | Bacteria | 3548 |
| 200 | Ga0075429_100079071 | 3300006880 | Bacteria | 2867 |
| 201 | Ga0075429_100091302 | 3300006880 | Bacteria | 2657 |
| 202 | Ga0075429_100096904 | 3300006880 | Bacteria | 2573 |
| 203 | Ga0075429_100196292 | 3300006880 | Bacteria | 1768 |
| 204 | Ga0075429_100393126 | 3300006880 | Bacteria | 1214 |
| 205 | Ga0075429_100463729 | 3300006880 | Bacteria | 1110 |
| 206 | Ga0068865_100005178 | 3300006881 | Bacteria | 7889 |
| 207 | Ga0068865_100017474 | 3300006881 | Bacteria | 4613 |
| 208 | Ga0068865_100077390 | 3300006881 | Bacteria | 2377 |
| 209 | Ga0068865_100112314 | 3300006881 | Bacteria | 2012 |
| 210 | Ga0068865_100241631 | 3300006881 | Bacteria | 1421 |
| 211 | Ga0075436_100125073 | 3300006914 | Bacteria | 1801 |
| 212 | Ga0097620_100002533 | 3300006931 | Bacteria | 18549 |
| 213 | Ga0097620_100044994 | 3300006931 | Bacteria | 4435 |
| 214 | Ga0097620_100046547 | 3300006931 | Bacteria | 4356 |
| 215 | Ga0097620_100068989 | 3300006931 | Bacteria | 3570 |
| 216 | Ga0097620_100080627 | 3300006931 | Bacteria | 3296 |
| 217 | Ga0097620_100101943 | 3300006931 | Bacteria | 2928 |
| 218 | Ga0097620_100258834 | 3300006931 | Bacteria | 1831 |
| 219 | Ga0075435_100005714 | 3300007076 | Bacteria | 8719 |
| 220 | Ga0075435_100010574 | 3300007076 | Bacteria | 6754 |
| 221 | Ga0075435_100050563 | 3300007076 | Bacteria | 3345 |
| 222 | Ga0075435_100065813 | 3300007076 | Bacteria | 2947 |
| 223 | Ga0075435_100158714 | 3300007076 | Bacteria | 1904 |
| 224 | Ga0111539_10000044 | 3300009094 | Bacteria | 125347 |
| 225 | Ga0111539_10000769 | 3300009094 | Bacteria | 41797 |
| 226 | Ga0111539_10001774 | 3300009094 | Bacteria | 28680 |
| 227 | Ga0111539_10022455 | 3300009094 | Bacteria | 7752 |
| 228 | Ga0111539_10055455 | 3300009094 | Bacteria | 4711 |
| 229 | Ga0111539_10100266 | 3300009094 | Bacteria | 3401 |
| 230 | Ga0111539_10242372 | 3300009094 | Bacteria | 2099 |
| 231 | Ga0111539_10266868 | 3300009094 | Bacteria | 1992 |
| 232 | Ga0111539_10324706 | 3300009094 | Bacteria | 1791 |
| 233 | Ga0105245_10008629 | 3300009098 | Bacteria | 8891 |
| 234 | Ga0105245_10459839 | 3300009098 | Bacteria | 1283 |
| 235 | Ga0114129_10003198 | 3300009147 | Bacteria | 22984 |
| 236 | Ga0114129_10003276 | 3300009147 | Bacteria | 22724 |
| 237 | Ga0114129_10006054 | 3300009147 | Bacteria | 17152 |
| 238 | Ga0114129_10009872 | 3300009147 | Bacteria | 13609 |
| 239 | Ga0114129_10029480 | 3300009147 | Bacteria | 7773 |
| 240 | Ga0114129_10096834 | 3300009147 | Bacteria | 4085 |
| 241 | Ga0114129_10132600 | 3300009147 | Bacteria | 3421 |
| 242 | Ga0114129_10160493 | 3300009147 | Bacteria | 3071 |
| 243 | Ga0114129_10176742 | 3300009147 | Bacteria | 2908 |
| 244 | Ga0114129_10846750 | 3300009147 | Bacteria | 1163 |
| 245 | Ga0114129_11101553 | 3300009147 | Bacteria | 994 |
| 246 | Ga0105243_10008157 | 3300009148 | Bacteria | 8043 |
| 247 | Ga0105241_10568125 | 3300009174 | Bacteria | 1020 |
| 248 | Ga0105242_10002921 | 3300009176 | Bacteria | 13348 |
| 249 | Ga0105242_10290514 | 3300009176 | Bacteria | 1488 |
| 250 | Ga0105242_10476981 | 3300009176 | Bacteria | 1181 |
| 251 | Ga0105248_10241039 | 3300009177 | Bacteria | 2036 |
| 252 | Ga0105248_10647238 | 3300009177 | Bacteria | 1192 |
| 253 | Ga0105238_10043505 | 3300009551 | Bacteria | 4544 |
| 254 | Ga0105249_10001334 | 3300009553 | Bacteria | 21606 |
| 255 | Ga0105249_10043919 | 3300009553 | Bacteria | 4065 |
| 256 | Ga0105249_10087301 | 3300009553 | Bacteria | 2910 |
| 257 | Ga0105246_10021871 | 3300011119 | Bacteria | 4122 |
| 258 | Ga0105246_10028237 | 3300011119 | Bacteria | 3684 |
| 259 | Ga0157371_10043810 | 3300013102 | Bacteria | 3187 |
| 260 | Ga0157374_10215050 | 3300013296 | Bacteria | 1885 |
| 261 | Ga0157374_10264284 | 3300013296 | Bacteria | 1695 |
| 262 | Ga0157378_10099238 | 3300013297 | Bacteria | 2656 |
| 263 | Ga0157378_10216219 | 3300013297 | Bacteria | 1820 |
| 264 | Ga0163162_10033186 | 3300013306 | Bacteria | 5128 |
| 265 | Ga0163162_10168863 | 3300013306 | Bacteria | 2312 |
| 266 | Ga0163162_10182938 | 3300013306 | Bacteria | 2222 |
| 267 | Ga0157375_10018181 | 3300013308 | Bacteria | 6370 |
| 268 | Ga0157375_10033798 | 3300013308 | Bacteria | 4864 |
| 269 | Ga0157375_10062458 | 3300013308 | Bacteria | 3702 |
| 270 | Ga0157375_10164865 | 3300013308 | Bacteria | 2360 |
| 271 | Ga0157375_10209089 | 3300013308 | Bacteria | 2108 |
| 272 | Ga0157375_10301418 | 3300013308 | Bacteria | 1766 |
| 273 | Ga0157375_10348737 | 3300013308 | Bacteria | 1646 |
| 274 | Ga0163163_10074895 | 3300014325 | Bacteria | 3378 |
| 275 | Ga0163163_10140451 | 3300014325 | Bacteria | 2458 |
| 276 | Ga0163163_10842994 | 3300014325 | Bacteria | 980 |
| 277 | Ga0157380_10003886 | 3300014326 | Bacteria | 10304 |
| 278 | Ga0157380_10007439 | 3300014326 | Bacteria | 7775 |
| 279 | Ga0157380_10073267 | 3300014326 | Bacteria | 2776 |
| 280 | Ga0157380_10158137 | 3300014326 | Bacteria | 1966 |
| 281 | Ga0157380_10274561 | 3300014326 | Unclassified | 1539 |
| 282 | Ga0157380_10278188 | 3300014326 | Bacteria | 1530 |
| 283 | Ga0157380_10536658 | 3300014326 | Bacteria | 1144 |
| 284 | Ga0157377_10002991 | 3300014745 | Bacteria | 7572 |
| 285 | Ga0157377_10015219 | 3300014745 | Bacteria | 3929 |
| 286 | Ga0157377_10093693 | 3300014745 | Bacteria | 1778 |
| 287 | Ga0157379_10003739 | 3300014968 | Bacteria | 12939 |
| 288 | Ga0157379_10328573 | 3300014968 | Bacteria | 1397 |
| 289 | Ga0157376_10052484 | 3300014969 | Bacteria | 3390 |
| 290 | Ga0157376_10057545 | 3300014969 | Bacteria | 3253 |
| 291 | Ga0157376_10225378 | 3300014969 | Bacteria | 1738 |
| 292 | Ga0157376_10234502 | 3300014969 | Bacteria | 1706 |
| 293 | Ga0157376_10251963 | 3300014969 | Unclassified | 1649 |
| 294 | Ga0163161_10023461 | 3300017792 | Bacteria | 4352 |
| 295 | Ga0163161_10042869 | 3300017792 | Bacteria | 3256 |
| 296 | Ga0207697_10001514 | 3300025315 | Bacteria | 12621 |
| 297 | Ga0207697_10068491 | 3300025315 | Bacteria | 1485 |
| 298 | Ga0207697_10091137 | 3300025315 | Bacteria | 1292 |
| 299 | Ga0207682_10001841 | 3300025893 | Bacteria | 9661 |
| 300 | Ga0207682_10003394 | 3300025893 | Bacteria | 6930 |
| 301 | Ga0207682_10014594 | 3300025893 | Bacteria | 3062 |
| 302 | Ga0207682_10042777 | 3300025893 | Bacteria | 1851 |
| 303 | Ga0207682_10148890 | 3300025893 | Bacteria | 1055 |
| 304 | Ga0207642_10016929 | 3300025899 | Bacteria | 2760 |
| 305 | Ga0207642_10194784 | 3300025899 | Bacteria | 1115 |
| 306 | Ga0207688_10001443 | 3300025901 | Bacteria | 12425 |
| 307 | Ga0207680_10105873 | 3300025903 | Bacteria | 1815 |
| 308 | Ga0207647_10098223 | 3300025904 | Bacteria | 1740 |
| 309 | Ga0207699_10037961 | 3300025906 | Bacteria | 2757 |
| 310 | Ga0207645_10001881 | 3300025907 | Bacteria | 16948 |
| 311 | Ga0207645_10016937 | 3300025907 | Bacteria | 4815 |
| 312 | Ga0207645_10027133 | 3300025907 | Bacteria | 3700 |
| 313 | Ga0207645_10043765 | 3300025907 | Bacteria | 2866 |
| 314 | Ga0207643_10005281 | 3300025908 | Bacteria | 6909 |
| 315 | Ga0207643_10005748 | 3300025908 | Bacteria | 6631 |
| 316 | Ga0207643_10015261 | 3300025908 | Bacteria | 4179 |
| 317 | Ga0207643_10020319 | 3300025908 | Bacteria | 3644 |
| 318 | Ga0207643_10027240 | 3300025908 | Bacteria | 3167 |
| 319 | Ga0207643_10039643 | 3300025908 | Bacteria | 2650 |
| 320 | Ga0207705_10482681 | 3300025909 | Bacteria | 962 |
| 321 | Ga0207684_10568773 | 3300025910 | Bacteria | 969 |
| 322 | Ga0207660_10280256 | 3300025917 | Bacteria | 1323 |
| 323 | Ga0207662_10002054 | 3300025918 | Bacteria | 9973 |
| 324 | Ga0207662_10020005 | 3300025918 | Bacteria | 3816 |
| 325 | Ga0207649_10088325 | 3300025920 | Bacteria | 2024 |
| 326 | Ga0207652_10085534 | 3300025921 | Bacteria | 2764 |
| 327 | Ga0207646_10247413 | 3300025922 | Bacteria | 1610 |
| 328 | Ga0207646_10332477 | 3300025922 | Bacteria | 1373 |
| 329 | Ga0207681_10000566 | 3300025923 | Bacteria | 25276 |
| 330 | Ga0207681_10020352 | 3300025923 | Bacteria | 4203 |
| 331 | Ga0207681_10030926 | 3300025923 | Bacteria | 3494 |
| 332 | Ga0207681_10074125 | 3300025923 | Bacteria | 2383 |
| 333 | Ga0207681_10074279 | 3300025923 | Bacteria | 2381 |
| 334 | Ga0207681_10081612 | 3300025923 | Bacteria | 2283 |
| 335 | Ga0207681_10146939 | 3300025923 | Bacteria | 1762 |
| 336 | Ga0207694_10024715 | 3300025924 | Bacteria | 4563 |
| 337 | Ga0207650_10072055 | 3300025925 | Bacteria | 2600 |
| 338 | Ga0207650_10083205 | 3300025925 | Bacteria | 2430 |
| 339 | Ga0207650_10211843 | 3300025925 | Bacteria | 1556 |
| 340 | Ga0207659_10001222 | 3300025926 | Bacteria | 15363 |
| 341 | Ga0207659_10002242 | 3300025926 | Bacteria | 11514 |
| 342 | Ga0207659_10002762 | 3300025926 | Bacteria | 10460 |
| 343 | Ga0207659_10007569 | 3300025926 | Bacteria | 6690 |
| 344 | Ga0207659_10014600 | 3300025926 | Bacteria | 5071 |
| 345 | Ga0207659_10018603 | 3300025926 | Bacteria | 4558 |
| 346 | Ga0207659_10027625 | 3300025926 | Bacteria | 3845 |
| 347 | Ga0207659_10029682 | 3300025926 | Bacteria | 3729 |
| 348 | Ga0207659_10147555 | 3300025926 | Bacteria | 1833 |
| 349 | Ga0207659_10163944 | 3300025926 | Bacteria | 1748 |
| 350 | Ga0207659_10231190 | 3300025926 | Bacteria | 1491 |
| 351 | Ga0207659_10293757 | 3300025926 | Bacteria | 1332 |
| 352 | Ga0207659_10353734 | 3300025926 | Bacteria | 1219 |
| 353 | Ga0207687_10014295 | 3300025927 | Bacteria | 5193 |
| 354 | Ga0207690_10199165 | 3300025932 | Bacteria | 1520 |
| 355 | Ga0207706_10003425 | 3300025933 | Bacteria | 15142 |
| 356 | Ga0207706_10105521 | 3300025933 | Bacteria | 2479 |
| 357 | Ga0207706_10218302 | 3300025933 | Bacteria | 1670 |
| 358 | Ga0207706_10292309 | 3300025933 | Bacteria | 1421 |
| 359 | Ga0207686_10006753 | 3300025934 | Bacteria | 6180 |
| 360 | Ga0207686_10034387 | 3300025934 | Bacteria | 3034 |
| 361 | Ga0207709_10003920 | 3300025935 | Bacteria | 8690 |
| 362 | Ga0207670_10014557 | 3300025936 | Bacteria | 4674 |
| 363 | Ga0207670_10079787 | 3300025936 | Bacteria | 2286 |
| 364 | Ga0207670_10108480 | 3300025936 | Bacteria | 1996 |
| 365 | Ga0207670_10245445 | 3300025936 | Bacteria | 1381 |
| 366 | Ga0207670_10309284 | 3300025936 | Bacteria | 1240 |
| 367 | Ga0207669_10001529 | 3300025937 | Bacteria | 9860 |
| 368 | Ga0207669_10307745 | 3300025937 | Bacteria | 1207 |
| 369 | Ga0207704_10016569 | 3300025938 | Bacteria | 3790 |
| 370 | Ga0207704_10038855 | 3300025938 | Bacteria | 2765 |
| 371 | Ga0207691_10005705 | 3300025940 | Bacteria | 12037 |
| 372 | Ga0207691_10008285 | 3300025940 | Bacteria | 9981 |
| 373 | Ga0207691_10025779 | 3300025940 | Bacteria | 5518 |
| 374 | Ga0207691_10027241 | 3300025940 | Bacteria | 5361 |
| 375 | Ga0207691_10030625 | 3300025940 | Bacteria | 5026 |
| 376 | Ga0207691_10049189 | 3300025940 | Bacteria | 3863 |
| 377 | Ga0207691_10070544 | 3300025940 | Bacteria | 3155 |
| 378 | Ga0207691_10216928 | 3300025940 | Bacteria | 1660 |
| 379 | Ga0207691_10242069 | 3300025940 | Bacteria | 1559 |
| 380 | Ga0207691_10318015 | 3300025940 | Bacteria | 1335 |
| 381 | Ga0207711_10126377 | 3300025941 | Bacteria | 2288 |
| 382 | Ga0207711_10452056 | 3300025941 | Bacteria | 1196 |
| 383 | Ga0207689_10000831 | 3300025942 | Bacteria | 29759 |
| 384 | Ga0207689_10005795 | 3300025942 | Bacteria | 10963 |
| 385 | Ga0207689_10210793 | 3300025942 | Bacteria | 1605 |
| 386 | Ga0207689_10395547 | 3300025942 | Bacteria | 1152 |
| 387 | Ga0207689_10559836 | 3300025942 | Bacteria | 960 |
| 388 | Ga0207661_10020477 | 3300025944 | Bacteria | 4945 |
| 389 | Ga0207679_10026524 | 3300025945 | Bacteria | 3996 |
| 390 | Ga0207679_10366979 | 3300025945 | Bacteria | 1259 |
| 391 | Ga0207651_10015409 | 3300025960 | Bacteria | 4441 |
| 392 | Ga0207651_10061581 | 3300025960 | Bacteria | 2611 |
| 393 | Ga0207651_10118570 | 3300025960 | Bacteria | 2002 |
| 394 | Ga0207651_10135856 | 3300025960 | Bacteria | 1891 |
| 395 | Ga0207651_10217778 | 3300025960 | Bacteria | 1541 |
| 396 | Ga0207651_10323620 | 3300025960 | Bacteria | 1289 |
| 397 | Ga0207712_10002418 | 3300025961 | Bacteria | 12069 |
| 398 | Ga0207712_10029712 | 3300025961 | Bacteria | 3669 |
| 399 | Ga0207668_10050926 | 3300025972 | Bacteria | 2857 |
| 400 | Ga0207668_10063916 | 3300025972 | Bacteria | 2599 |
| 401 | Ga0207668_10294346 | 3300025972 | Bacteria | 1337 |
| 402 | Ga0207640_10125688 | 3300025981 | Bacteria | 1846 |
| 403 | Ga0207658_10281318 | 3300025986 | Bacteria | 1426 |
| 404 | Ga0207677_10056451 | 3300026023 | Bacteria | 2691 |
| 405 | Ga0207677_10074628 | 3300026023 | Bacteria | 2407 |
| 406 | Ga0207677_10277135 | 3300026023 | Bacteria | 1375 |
| 407 | Ga0207703_10033664 | 3300026035 | Bacteria | 4064 |
| 408 | Ga0207703_10086035 | 3300026035 | Bacteria | 2632 |
| 409 | Ga0207703_10103101 | 3300026035 | Bacteria | 2421 |
| 410 | Ga0207639_10142279 | 3300026041 | Bacteria | 2000 |
| 411 | Ga0207708_10003991 | 3300026075 | Bacteria | 10861 |
| 412 | Ga0207708_10070416 | 3300026075 | Bacteria | 2678 |
| 413 | Ga0207708_10089859 | 3300026075 | Bacteria | 2367 |
| 414 | Ga0207708_10111947 | 3300026075 | Bacteria | 2120 |
| 415 | Ga0207708_10198955 | 3300026075 | Bacteria | 1598 |
| 416 | Ga0207708_10251301 | 3300026075 | Bacteria | 1425 |
| 417 | Ga0207708_10348322 | 3300026075 | Bacteria | 1215 |
| 418 | Ga0207641_10042542 | 3300026088 | Bacteria | 3811 |
| 419 | Ga0207641_10093039 | 3300026088 | Bacteria | 2642 |
| 420 | Ga0207648_10000093 | 3300026089 | Bacteria | 84666 |
| 421 | Ga0207648_10000446 | 3300026089 | Bacteria | 45706 |
| 422 | Ga0207648_10048633 | 3300026089 | Bacteria | 3712 |
| 423 | Ga0207648_10087655 | 3300026089 | Bacteria | 2716 |
| 424 | Ga0207648_10305841 | 3300026089 | Bacteria | 1427 |
| 425 | Ga0207676_10120036 | 3300026095 | Bacteria | 2215 |
| 426 | Ga0207674_10043449 | 3300026116 | Bacteria | 4633 |
| 427 | Ga0207674_10057586 | 3300026116 | Bacteria | 3939 |
| 428 | Ga0207674_10089328 | 3300026116 | Bacteria | 3074 |
| 429 | Ga0207674_10095960 | 3300026116 | Bacteria | 2951 |
| 430 | Ga0207675_100001058 | 3300026118 | Bacteria | 27297 |
| 431 | Ga0207675_100004015 | 3300026118 | Bacteria | 14272 |
| 432 | Ga0207675_100060737 | 3300026118 | Bacteria | 3529 |
| 433 | Ga0207675_100093451 | 3300026118 | Bacteria | 2829 |
| 434 | Ga0207675_100323156 | 3300026118 | Bacteria | 1507 |
| 435 | Ga0207683_10021244 | 3300026121 | Bacteria | 5554 |
| 436 | Ga0207683_10038673 | 3300026121 | Bacteria | 4160 |
| 437 | Ga0207683_10045261 | 3300026121 | Bacteria | 3848 |
| 438 | Ga0207683_10059137 | 3300026121 | Bacteria | 3366 |
| 439 | Ga0207683_10093639 | 3300026121 | Bacteria | 2677 |
| 440 | Ga0207683_10112388 | 3300026121 | Bacteria | 2439 |
| 441 | Ga0207428_10000224 | 3300027907 | Bacteria | 78533 |
| 442 | Ga0207428_10000353 | 3300027907 | Bacteria | 59325 |
| 443 | Ga0207428_10002217 | 3300027907 | Bacteria | 19496 |
| 444 | Ga0207428_10004706 | 3300027907 | Bacteria | 12908 |
| 445 | Ga0207428_10069176 | 3300027907 | Bacteria | 2776 |
| 446 | Ga0268266_10211239 | 3300028379 | Bacteria | 1780 |
| 447 | Ga0268266_10336344 | 3300028379 | Bacteria | 1416 |
| 448 | Ga0268266_10471370 | 3300028379 | Bacteria | 1196 |
| 449 | Ga0268265_10000540 | 3300028380 | Bacteria | 38471 |
| 450 | Ga0268265_10058496 | 3300028380 | Bacteria | 2944 |
| 451 | Ga0268265_10062280 | 3300028380 | Bacteria | 2866 |
| 452 | Ga0268265_10066118 | 3300028380 | Bacteria | 2793 |
| 453 | Ga0268265_10196089 | 3300028380 | Bacteria | 1748 |
| 454 | Ga0268264_10036528 | 3300028381 | Bacteria | 4048 |
| 455 | Ga0268264_10071496 | 3300028381 | Bacteria | 2940 |
| 456 | Ga0268264_10088574 | 3300028381 | Bacteria | 2664 |
| 457 | Ga0265314_10084420 | 3300031711 | Bacteria | 2085 |
| 458 | Ga0307405_10036021 | 3300031731 | Bacteria | 2961 |
| 459 | Ga0316577_10001199 | 3300031733 | Bacteria | 11998 |
| 460 | Ga0307410_10009560 | 3300031852 | Bacteria | 5445 |
| 461 | Ga0307407_10042811 | 3300031903 | Bacteria | 2542 |
| 462 | Ga0307412_10010531 | 3300031911 | Bacteria | 5326 |
| 463 | Ga0307409_100011842 | 3300031995 | Bacteria | 5524 |
| 464 | Ga0307409_100670149 | 3300031995 | Bacteria | 1033 |
| 465 | Ga0307416_100004482 | 3300032002 | Bacteria | 8423 |
| 466 | Ga0307414_10044810 | 3300032004 | Bacteria | 3025 |
| 467 | Ga0307411_10016639 | 3300032005 | Bacteria | 4166 |
| 468 | Ga0307415_100053170 | 3300032126 | Bacteria | 2758 |
| 469 | Ga0373928_0020210 | 3300035084 | Bacteria | 1395 |
| 470 | Ga0373923_0040693 | 3300035111 | Bacteria | 1914 |
| 471 | Ga0373953_0148642 | 3300035117 | Bacteria | 1004 |
| 472 | Ga0373957_0135763 | 3300035120 | Bacteria | 1004 |
| 473 | Ga0373943_0003682 | 3300035170 | Bacteria | 6969 |
| 474 | Ga0373946_0009173 | 3300035171 | Bacteria | 3641 |
| 475 | Ga0373955_0004579 | 3300035172 | Bacteria | 6129 |
| 476 | Ga0373961_0006165 | 3300035241 | Bacteria | 2881 |
| 477 | Ga0373924_0003631 | 3300035410 | Bacteria | 5322 |
| 478 | Ga0373931_0022676 | 3300035691 | Bacteria | 3162 |
| 479 | Ga0373935_0178182 | 3300035692 | Bacteria | 1458 |
| 480 | Ga0373927_0371273 | 3300035695 | Bacteria | 943 |
| 481 | Ga0373925_0148733 | 3300037068 | Bacteria | 1837 |
| 482 | Ga0373925_0171535 | 3300037068 | Bacteria | 1713 |
| 483 | Ga0373925_0219320 | 3300037068 | Unclassified | 1518 |
| 484 | Ga0395900_0394320 | 3300037418 | Bacteria | 1350 |
| 485 | Ga0451853_1517139 | 3300041512 | Bacteria | 3345 |
| 486 | Ga0439441_015397 | 3300042001 | Bacteria | 1352 |
| 487 | Ga0439446_0057618 | 3300042156 | Bacteria | 1170 |
| 488 | Ga0439435_0060464 | 3300042436 | Bacteria | 1103 |
| 489 | Ga0450916_000840 | 3300042530 | Bacteria | 2881 |
| 490 | Ga0451577_0071562 | 3300042876 | Bacteria | 3092 |
| 491 | Ga0451577_0125389 | 3300042876 | Bacteria | 2301 |
| 492 | Ga0451577_0363512 | 3300042876 | Unclassified | 1313 |
| 493 | Ga0453684_0059299 | 3300044712 | Bacteria | 4936 |
| 494 | Ga0453684_0114534 | 3300044712 | Bacteria | 3268 |
| 495 | Ga0451576_0013731 | 3300045051 | Bacteria | 9047 |
| 496 | Ga0451576_0021675 | 3300045051 | Bacteria | 6980 |
| 497 | Ga0451576_0052019 | 3300045051 | Bacteria | 4292 |
| 498 | Ga0451576_0177479 | 3300045051 | Bacteria | 2224 |
| 499 | Ga0451576_0717339 | 3300045051 | Bacteria | 1050 |
| 500 | Ga0495580_0118487 | 3300046472 | Bacteria | 1838 |
| 501 | Ga0495608_0003468 | 3300046511 | Bacteria | 11288 |
| 502 | Ga0495628_0138285 | 3300046516 | Bacteria | 1860 |
| 503 | Ga0495630_0016655 | 3300046517 | Bacteria | 5375 |
| 504 | Ga0495663_0059105 | 3300046525 | Bacteria | 1202 |
| 505 | Ga0495652_0164291 | 3300046529 | Bacteria | 1720 |
| 506 | Ga0495587_0039508 | 3300046536 | Bacteria | 2823 |
| 507 | Ga0495598_0016109 | 3300046537 | Bacteria | 1901 |
| 508 | Ga0495621_0000539 | 3300046539 | Bacteria | 9397 |
| 509 | Ga0495621_0012526 | 3300046539 | Bacteria | 2645 |
| 510 | Ga0495633_0045317 | 3300046558 | Bacteria | 2083 |
| 511 | Ga0495656_0033659 | 3300046615 | Bacteria | 2093 |
| 512 | Ga0495656_0109244 | 3300046615 | Bacteria | 1291 |
| 513 | Ga0495659_0016434 | 3300046664 | Bacteria | 2441 |
| 514 | Ga0495659_0020455 | 3300046664 | Bacteria | 2223 |
| 515 | Ga0495659_0035277 | 3300046664 | Bacteria | 1762 |
| 516 | Ga0495647_0111633 | 3300046681 | Bacteria | 1142 |
| 517 | Ga0495658_0059852 | 3300046683 | Bacteria | 2183 |
| 518 | Ga0495658_0117678 | 3300046683 | Bacteria | 1604 |
| 519 | Ga0495669_0001215 | 3300046684 | Bacteria | 10716 |
| 520 | Ga0495669_0074664 | 3300046684 | Bacteria | 1550 |
| 521 | Ga0495613_0003695 | 3300046689 | Bacteria | 11476 |
| 522 | Ga0495604_0062959 | 3300047317 | Bacteria | 2832 |
| 523 | Ga0495636_0072670 | 3300047318 | Bacteria | 1470 |
| 524 | Ga0495674_0009481 | 3300047319 | Bacteria | 9249 |
| 525 | Ga0495674_0179328 | 3300047319 | Bacteria | 1765 |
| 526 | Ga0495677_0071882 | 3300047445 | Bacteria | 1290 |
| 527 | Ga0495684_0000601 | 3300047471 | Bacteria | 28931 |
| 528 | Ga0496104_0074080 | 3300048907 | Bacteria | 3241 |
| 529 | Ga0496109_0055599 | 3300048912 | Bacteria | 3611 |
| 530 | Ga0496113_0037187 | 3300048916 | Bacteria | 3570 |
| 531 | Ga0501039_0074972 | 3300049575 | Bacteria | 2630 |
| 532 | Ga0501039_0093895 | 3300049575 | Bacteria | 2338 |
| 533 | Ga0501040_0033029 | 3300049576 | Bacteria | 3504 |
| 534 | Ga0501041_0092802 | 3300049577 | Bacteria | 1864 |
| 535 | Ga0501042_0003889 | 3300049578 | Bacteria | 9445 |
| 536 | Ga0501042_0236178 | 3300049578 | Bacteria | 1319 |
| 537 | Ga0501042_0342725 | 3300049578 | Bacteria | 1080 |
| 538 | Ga0501046_0075810 | 3300049580 | Bacteria | 2607 |
| 539 | Ga0501046_0348896 | 3300049580 | Bacteria | 1075 |
| 540 | Ga0501071_0158449 | 3300049587 | Bacteria | 1691 |
| 541 | Ga0501074_0330732 | 3300049590 | Bacteria | 1082 |
| 542 | Ga0501075_0310479 | 3300049591 | Bacteria | 1202 |
| 543 | Ga0501076_0190632 | 3300049592 | Bacteria | 1673 |
| 544 | Ga0501077_0051690 | 3300049593 | Bacteria | 2611 |
| 545 | Ga0501077_0132067 | 3300049593 | Bacteria | 1583 |
| 546 | Ga0501079_0262337 | 3300049741 | Bacteria | 1350 |
| 547 | Ga0501045_0089081 | 3300049824 | Bacteria | 2279 |
| 548 | nmdc:mga05p37_136169_c1 | 3300050507 | Bacteria | 3012 |
| 549 | nmdc:mga05p37_17011_c1 | 3300050507 | Bacteria | 8770 |
| 550 | nmdc:mga05p37_282105_c1 | 3300050507 | Bacteria | 1981 |
| 551 | nmdc:mga05p37_28799_c1 | 3300050507 | Bacteria | 6776 |
| 552 | nmdc:mga05p37_35576_c1 | 3300050507 | Bacteria | 3243 |
| 553 | nmdc:mga05p37_358361_c1 | 3300050507 | Bacteria | 1715 |
| 554 | nmdc:mga05p37_429140_c1 | 3300050507 | Bacteria | 1536 |
| 555 | nmdc:mga05p37_84584_c1 | 3300050507 | Bacteria | 3908 |
| 556 | nmdc:mga05p37_92576_c1 | 3300050507 | Bacteria | 3725 |
| 557 | nmdc:mga09592_106396_c1 | 3300050508 | Bacteria | 2406 |
| 558 | nmdc:mga09592_135869_c1 | 3300050508 | Bacteria | 2118 |
| 559 | nmdc:mga09592_164039_c1 | 3300050508 | Bacteria | 1920 |
| 560 | nmdc:mga09592_18887_c1 | 3300050508 | Bacteria | 5655 |
| 561 | nmdc:mga09592_274532_c1 | 3300050508 | Bacteria | 1462 |
| 562 | nmdc:mga09592_316135_c1 | 3300050508 | Bacteria | 1353 |
| 563 | nmdc:mga09592_393425_c1 | 3300050508 | Bacteria | 1198 |
| 564 | nmdc:mga0qj67_4306_c2 | 3300050509 | Bacteria | 8212 |
| 565 | nmdc:mga0qj67_66977_c1 | 3300050509 | Bacteria | 2861 |
| 566 | nmdc:mga0qj67_93568_c1 | 3300050509 | Bacteria | 2417 |
| 567 | nmdc:mga06r32_206675_c1 | 3300050510 | Bacteria | 1952 |
| 568 | nmdc:mga06r32_209770_c1 | 3300050510 | Bacteria | 1936 |
| 569 | nmdc:mga08y16_12914_c1 | 3300050511 | Bacteria | 8786 |
| 570 | nmdc:mga08y16_15575_c1 | 3300050511 | Bacteria | 7995 |
| 571 | nmdc:mga08y16_273023_c1 | 3300050511 | Bacteria | 1745 |
| 572 | nmdc:mga08y16_32226_c1 | 3300050511 | Bacteria | 5511 |
| 573 | nmdc:mga08y16_375226_c1 | 3300050511 | Bacteria | 1458 |
| 574 | nmdc:mga08y16_40195_c1 | 3300050511 | Bacteria | 4903 |
| 575 | nmdc:mga08y16_48255_c1 | 3300050511 | Bacteria | 4456 |
| 576 | nmdc:mga08y16_50424_c1 | 3300050511 | Bacteria | 4355 |
| 577 | nmdc:mga08y16_5828_c1 | 3300050511 | Bacteria | 12911 |
| 578 | nmdc:mga08y16_945_c1 | 3300050511 | Bacteria | 28237 |
| 579 | nmdc:mga0n895_10821_c1 | 3300050512 | Bacteria | 8096 |
| 580 | nmdc:mga0n895_27620_c1 | 3300050512 | Bacteria | 5394 |
| 581 | nmdc:mga0n895_39130_c1 | 3300050512 | Bacteria | 4599 |
| 582 | nmdc:mga0n895_4485_c1 | 3300050512 | Bacteria | 11475 |
| 583 | nmdc:mga0n895_467810_c1 | 3300050512 | Bacteria | 1272 |
| 584 | nmdc:mga0n895_6752_c1 | 3300050512 | Bacteria | 9788 |
| 585 | nmdc:mga0n895_802454_c1 | 3300050512 | Bacteria | 932 |
| 586 | nmdc:mga0n895_81489_c1 | 3300050512 | Bacteria | 3225 |
| 587 | nmdc:mga0n895_86092_c1 | 3300050512 | Bacteria | 3139 |
| 588 | nmdc:mga0n895_98386_c1 | 3300050512 | Bacteria | 2932 |
| 589 | nmdc:mga0rr50_108527_c1 | 3300050513 | Bacteria | 2193 |
| 590 | nmdc:mga0rr50_119416_c1 | 3300050513 | Bacteria | 2096 |
| 591 | nmdc:mga0rr50_190578_c1 | 3300050513 | Bacteria | 1680 |
| 592 | nmdc:mga0rr50_21346_c1 | 3300050513 | Bacteria | 4419 |
| 593 | nmdc:mga08x19_123848_c1 | 3300050514 | Bacteria | 1735 |
| 594 | nmdc:mga0a205_129737_c1 | 3300050515 | Bacteria | 2422 |
| 595 | nmdc:mga0a205_1497_c1 | 3300050515 | Bacteria | 19917 |
| 596 | nmdc:mga0a205_210015_c1 | 3300050515 | Bacteria | 1835 |
| 597 | nmdc:mga0a205_220729_c1 | 3300050515 | Bacteria | 1781 |
| 598 | nmdc:mga0a205_44250_c1 | 3300050515 | Bacteria | 4291 |
| 599 | nmdc:mga0a205_4601_c1 | 3300050515 | Bacteria | 12370 |
| 600 | nmdc:mga0a205_71273_c1 | 3300050515 | Bacteria | 3356 |
| 601 | nmdc:mga0a205_808_c1 | 3300050515 | Bacteria | 25457 |
| 602 | Ga0495601_0055214 | 3300053077 | Bacteria | 2514 |
| 603 | Ga0495601_0105419 | 3300053077 | Bacteria | 1823 |
| 604 | Ga0495619_0000386 | 3300053085 | Bacteria | 30136 |
| 605 | Ga0495619_0078744 | 3300053085 | Bacteria | 2216 |
| 606 | Ga0501082_0006994 | 3300060353 | Bacteria | 9740 |
| 607 | Ga0530510_0004934 | 3300061734 | Bacteria | 9214 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006880 | Ga0075429_100393126 | Ga0075429_1003931262 | 237 |
| 2 | 3300025899 | Ga0207642_10194784 | Ga0207642_101947842 | 256 |
| 3 | 3300026075 | Ga0207708_10348322 | Ga0207708_103483222 | 258 |
| 4 | 3300005456 | Ga0070678_100168194 | Ga0070678_1001681943 | 259 |
| 5 | 3300042876 | Ga0451577_0125389 | Ga0451577_0125389_1502_2284 | 259 |
| 6 | 3300044712 | Ga0453684_0114534 | Ga0453684_0114534_169_951 | 259 |
| 7 | 3300053077 | Ga0495601_0105419 | Ga0495601_0105419_11_850 | 263 |
| 8 | 3300031733 | Ga0316577_10001199 | Ga0316577_100011993 | 264 |
| 9 | 3300037068 | Ga0373925_0219320 | Ga0373925_0219320_560_1399 | 264 |
| 10 | 3300005518 | Ga0070699_100214118 | Ga0070699_1002141182 | 265 |
| 11 | 3300009174 | Ga0105241_10568125 | Ga0105241_105681251 | 265 |
| 12 | 3300025936 | Ga0207670_10309284 | Ga0207670_103092842 | 265 |
| 13 | 3300053085 | Ga0495619_0078744 | Ga0495619_0078744_28_867 | 265 |
| 14 | 3300005293 | Ga0065715_10150770 | Ga0065715_101507702 | 266 |
| 15 | 3300005331 | Ga0070670_100039805 | Ga0070670_1000398054 | 266 |
| 16 | 3300005456 | Ga0070678_100142803 | Ga0070678_1001428031 | 266 |
| 17 | 3300005456 | Ga0070678_100177709 | Ga0070678_1001777091 | 266 |
| 18 | 3300005617 | Ga0068859_100258832 | Ga0068859_1002588322 | 266 |
| 19 | 3300006237 | Ga0097621_100190319 | Ga0097621_1001903192 | 266 |
| 20 | 3300006358 | Ga0068871_100167506 | Ga0068871_1001675062 | 266 |
| 21 | 3300006931 | Ga0097620_100258834 | Ga0097620_1002588342 | 266 |
| 22 | 3300014968 | Ga0157379_10328573 | Ga0157379_103285732 | 266 |
| 23 | 3300014969 | Ga0157376_10251963 | Ga0157376_102519632 | 266 |
| 24 | 3300025906 | Ga0207699_10037961 | Ga0207699_100379612 | 266 |
| 25 | 3300025926 | Ga0207659_10027625 | Ga0207659_100276254 | 266 |
| 26 | 3300025926 | Ga0207659_10163944 | Ga0207659_101639442 | 266 |
| 27 | 3300025940 | Ga0207691_10070544 | Ga0207691_100705444 | 266 |
| 28 | 3300025945 | Ga0207679_10026524 | Ga0207679_100265244 | 266 |
| 29 | 3300025960 | Ga0207651_10135856 | Ga0207651_101358562 | 266 |
| 30 | 3300026121 | Ga0207683_10045261 | Ga0207683_100452614 | 266 |
| 31 | 3300031995 | Ga0307409_100670149 | Ga0307409_1006701492 | 266 |
| 32 | 3300035117 | Ga0373953_0148642 | Ga0373953_0148642_71_880 | 266 |
| 33 | 3300041512 | Ga0451853_1517139 | Ga0451853_1517139_896_1711 | 266 |
| 34 | 3300045051 | Ga0451576_0717339 | Ga0451576_0717339_168_974 | 266 |
| 35 | 3300046516 | Ga0495628_0138285 | Ga0495628_0138285_119_928 | 266 |
| 36 | 3300048907 | Ga0496104_0074080 | Ga0496104_0074080_256_1065 | 266 |
| 37 | 3300005327 | Ga0070658_10283380 | Ga0070658_102833801 | 267 |
| 38 | 3300005328 | Ga0070676_10018577 | Ga0070676_100185773 | 267 |
| 39 | 3300005330 | Ga0070690_100033795 | Ga0070690_1000337952 | 267 |
| 40 | 3300005331 | Ga0070670_100002877 | Ga0070670_10000287712 | 267 |
| 41 | 3300005334 | Ga0068869_100005463 | Ga0068869_1000054633 | 267 |
| 42 | 3300005338 | Ga0068868_100202796 | Ga0068868_1002027963 | 267 |
| 43 | 3300005353 | Ga0070669_100026198 | Ga0070669_1000261984 | 267 |
| 44 | 3300005353 | Ga0070669_100075890 | Ga0070669_1000758902 | 267 |
| 45 | 3300005353 | Ga0070669_100157077 | Ga0070669_1001570771 | 267 |
| 46 | 3300005354 | Ga0070675_100000537 | Ga0070675_10000053713 | 267 |
| 47 | 3300005354 | Ga0070675_100003145 | Ga0070675_1000031459 | 267 |
| 48 | 3300005354 | Ga0070675_100027847 | Ga0070675_1000278474 | 267 |
| 49 | 3300005354 | Ga0070675_100118918 | Ga0070675_1001189182 | 267 |
| 50 | 3300005364 | Ga0070673_100173764 | Ga0070673_1001737643 | 267 |
| 51 | 3300005364 | Ga0070673_100178630 | Ga0070673_1001786303 | 267 |
| 52 | 3300005365 | Ga0070688_100009604 | Ga0070688_1000096042 | 267 |
| 53 | 3300005438 | Ga0070701_10002485 | Ga0070701_100024854 | 267 |
| 54 | 3300005441 | Ga0070700_100015111 | Ga0070700_1000151113 | 267 |
| 55 | 3300005457 | Ga0070662_100306350 | Ga0070662_1003063501 | 267 |
| 56 | 3300005459 | Ga0068867_100003422 | Ga0068867_1000034228 | 267 |
| 57 | 3300005543 | Ga0070672_100003678 | Ga0070672_1000036787 | 267 |
| 58 | 3300005545 | Ga0070695_100231791 | Ga0070695_1002317912 | 267 |
| 59 | 3300005578 | Ga0068854_100055078 | Ga0068854_1000550783 | 267 |
| 60 | 3300005615 | Ga0070702_100022601 | Ga0070702_1000226013 | 267 |
| 61 | 3300005617 | Ga0068859_100080631 | Ga0068859_1000806312 | 267 |
| 62 | 3300005718 | Ga0068866_10004135 | Ga0068866_100041356 | 267 |
| 63 | 3300005719 | Ga0068861_100035291 | Ga0068861_1000352912 | 267 |
| 64 | 3300005719 | Ga0068861_100288460 | Ga0068861_1002884602 | 267 |
| 65 | 3300005842 | Ga0068858_100066511 | Ga0068858_1000665112 | 267 |
| 66 | 3300005843 | Ga0068860_100082640 | Ga0068860_1000826403 | 267 |
| 67 | 3300006237 | Ga0097621_100092943 | Ga0097621_1000929432 | 267 |
| 68 | 3300006881 | Ga0068865_100005178 | Ga0068865_1000051789 | 267 |
| 69 | 3300006931 | Ga0097620_100080627 | Ga0097620_1000806272 | 267 |
| 70 | 3300009148 | Ga0105243_10008157 | Ga0105243_100081573 | 267 |
| 71 | 3300009176 | Ga0105242_10002921 | Ga0105242_100029212 | 267 |
| 72 | 3300009551 | Ga0105238_10043505 | Ga0105238_100435052 | 267 |
| 73 | 3300014325 | Ga0163163_10074895 | Ga0163163_100748953 | 267 |
| 74 | 3300014325 | Ga0163163_10842994 | Ga0163163_108429942 | 267 |
| 75 | 3300014326 | Ga0157380_10073267 | Ga0157380_100732672 | 267 |
| 76 | 3300014326 | Ga0157380_10158137 | Ga0157380_101581373 | 267 |
| 77 | 3300014969 | Ga0157376_10234502 | Ga0157376_102345022 | 267 |
| 78 | 3300025893 | Ga0207682_10042777 | Ga0207682_100427771 | 267 |
| 79 | 3300025899 | Ga0207642_10016929 | Ga0207642_100169293 | 267 |
| 80 | 3300025907 | Ga0207645_10016937 | Ga0207645_100169376 | 267 |
| 81 | 3300025908 | Ga0207643_10027240 | Ga0207643_100272402 | 267 |
| 82 | 3300025909 | Ga0207705_10482681 | Ga0207705_104826811 | 267 |
| 83 | 3300025923 | Ga0207681_10020352 | Ga0207681_100203524 | 267 |
| 84 | 3300025923 | Ga0207681_10030926 | Ga0207681_100309264 | 267 |
| 85 | 3300025923 | Ga0207681_10074279 | Ga0207681_100742792 | 267 |
| 86 | 3300025924 | Ga0207694_10024715 | Ga0207694_100247154 | 267 |
| 87 | 3300025925 | Ga0207650_10072055 | Ga0207650_100720552 | 267 |
| 88 | 3300025926 | Ga0207659_10002762 | Ga0207659_1000276212 | 267 |
| 89 | 3300025926 | Ga0207659_10007569 | Ga0207659_100075694 | 267 |
| 90 | 3300025926 | Ga0207659_10018603 | Ga0207659_100186033 | 267 |
| 91 | 3300025926 | Ga0207659_10353734 | Ga0207659_103537342 | 267 |
| 92 | 3300025933 | Ga0207706_10105521 | Ga0207706_101055212 | 267 |
| 93 | 3300025934 | Ga0207686_10006753 | Ga0207686_100067534 | 267 |
| 94 | 3300025935 | Ga0207709_10003920 | Ga0207709_100039209 | 267 |
| 95 | 3300025940 | Ga0207691_10008285 | Ga0207691_100082857 | 267 |
| 96 | 3300025940 | Ga0207691_10216928 | Ga0207691_102169282 | 267 |
| 97 | 3300025940 | Ga0207691_10242069 | Ga0207691_102420692 | 267 |
| 98 | 3300025940 | Ga0207691_10318015 | Ga0207691_103180152 | 267 |
| 99 | 3300025941 | Ga0207711_10452056 | Ga0207711_104520562 | 267 |
| 100 | 3300025942 | Ga0207689_10005795 | Ga0207689_1000579512 | 267 |
| 101 | 3300025942 | Ga0207689_10559836 | Ga0207689_105598361 | 267 |
| 102 | 3300025960 | Ga0207651_10015409 | Ga0207651_100154092 | 267 |
| 103 | 3300025972 | Ga0207668_10294346 | Ga0207668_102943462 | 267 |
| 104 | 3300025981 | Ga0207640_10125688 | Ga0207640_101256883 | 267 |
| 105 | 3300026035 | Ga0207703_10033664 | Ga0207703_100336643 | 267 |
| 106 | 3300026035 | Ga0207703_10103101 | Ga0207703_101031012 | 267 |
| 107 | 3300026075 | Ga0207708_10003991 | Ga0207708_100039914 | 267 |
| 108 | 3300026088 | Ga0207641_10093039 | Ga0207641_100930393 | 267 |
| 109 | 3300026089 | Ga0207648_10000093 | Ga0207648_1000009316 | 267 |
| 110 | 3300026118 | Ga0207675_100060737 | Ga0207675_1000607372 | 267 |
| 111 | 3300026121 | Ga0207683_10112388 | Ga0207683_101123883 | 267 |
| 112 | 3300028379 | Ga0268266_10471370 | Ga0268266_104713702 | 267 |
| 113 | 3300028381 | Ga0268264_10071496 | Ga0268264_100714963 | 267 |
| 114 | 3300042436 | Ga0439435_0060464 | Ga0439435_0060464_251_1060 | 267 |
| 115 | 3300005336 | Ga0070680_100323441 | Ga0070680_1003234412 | 269 |
| 116 | 3300005985 | Ga0081539_10013539 | Ga0081539_100135392 | 269 |
| 117 | 3300005290 | Ga0065712_10093172 | Ga0065712_100931722 | 270 |
| 118 | 3300005335 | Ga0070666_10115833 | Ga0070666_101158331 | 270 |
| 119 | 3300005354 | Ga0070675_100005576 | Ga0070675_1000055763 | 270 |
| 120 | 3300005354 | Ga0070675_100212814 | Ga0070675_1002128142 | 270 |
| 121 | 3300005364 | Ga0070673_100011067 | Ga0070673_1000110674 | 270 |
| 122 | 3300005440 | Ga0070705_100135440 | Ga0070705_1001354402 | 270 |
| 123 | 3300005466 | Ga0070685_10143686 | Ga0070685_101436863 | 270 |
| 124 | 3300005471 | Ga0070698_100049505 | Ga0070698_1000495052 | 270 |
| 125 | 3300005518 | Ga0070699_100000339 | Ga0070699_10000033912 | 270 |
| 126 | 3300005546 | Ga0070696_100125184 | Ga0070696_1001251842 | 270 |
| 127 | 3300005549 | Ga0070704_100116285 | Ga0070704_1001162852 | 270 |
| 128 | 3300005617 | Ga0068859_100101945 | Ga0068859_1001019454 | 270 |
| 129 | 3300006844 | Ga0075428_100051934 | Ga0075428_1000519343 | 270 |
| 130 | 3300006846 | Ga0075430_100040989 | Ga0075430_1000409892 | 270 |
| 131 | 3300006847 | Ga0075431_100090962 | Ga0075431_1000909623 | 270 |
| 132 | 3300006847 | Ga0075431_100204632 | Ga0075431_1002046323 | 270 |
| 133 | 3300006847 | Ga0075431_100329722 | Ga0075431_1003297222 | 270 |
| 134 | 3300006852 | Ga0075433_10202027 | Ga0075433_102020272 | 270 |
| 135 | 3300006880 | Ga0075429_100052468 | Ga0075429_1000524684 | 270 |
| 136 | 3300006880 | Ga0075429_100196292 | Ga0075429_1001962922 | 270 |
| 137 | 3300006931 | Ga0097620_100101943 | Ga0097620_1001019434 | 270 |
| 138 | 3300009094 | Ga0111539_10000044 | Ga0111539_1000004472 | 270 |
| 139 | 3300009094 | Ga0111539_10001774 | Ga0111539_1000177426 | 270 |
| 140 | 3300009094 | Ga0111539_10055455 | Ga0111539_100554553 | 270 |
| 141 | 3300009094 | Ga0111539_10324706 | Ga0111539_103247062 | 270 |
| 142 | 3300009147 | Ga0114129_10003198 | Ga0114129_100031982 | 270 |
| 143 | 3300009147 | Ga0114129_10009872 | Ga0114129_1000987212 | 270 |
| 144 | 3300009147 | Ga0114129_10029480 | Ga0114129_100294808 | 270 |
| 145 | 3300013308 | Ga0157375_10062458 | Ga0157375_100624582 | 270 |
| 146 | 3300014326 | Ga0157380_10536658 | Ga0157380_105366582 | 270 |
| 147 | 3300025315 | Ga0207697_10068491 | Ga0207697_100684912 | 270 |
| 148 | 3300025926 | Ga0207659_10029682 | Ga0207659_100296824 | 270 |
| 149 | 3300025933 | Ga0207706_10218302 | Ga0207706_102183022 | 270 |
| 150 | 3300025936 | Ga0207670_10079787 | Ga0207670_100797872 | 270 |
| 151 | 3300025936 | Ga0207670_10108480 | Ga0207670_101084802 | 270 |
| 152 | 3300025940 | Ga0207691_10049189 | Ga0207691_100491895 | 270 |
| 153 | 3300026089 | Ga0207648_10305841 | Ga0207648_103058412 | 270 |
| 154 | 3300027907 | Ga0207428_10000353 | Ga0207428_1000035322 | 270 |
| 155 | 3300027907 | Ga0207428_10069176 | Ga0207428_100691762 | 270 |
| 156 | 3300028380 | Ga0268265_10196089 | Ga0268265_101960892 | 270 |
| 157 | 3300037418 | Ga0395900_0394320 | Ga0395900_0394320_13_846 | 270 |
| 158 | 3300042001 | Ga0439441_015397 | Ga0439441_015397_198_1031 | 270 |
| 159 | 3300042530 | Ga0450916_000840 | Ga0450916_000840_223_1056 | 270 |
| 160 | 3300042876 | Ga0451577_0071562 | Ga0451577_0071562_762_1580 | 270 |
| 161 | 3300044712 | Ga0453684_0059299 | Ga0453684_0059299_1075_1893 | 270 |
| 162 | 3300046615 | Ga0495656_0033659 | Ga0495656_0033659_537_1370 | 270 |
| 163 | 3300046664 | Ga0495659_0020455 | Ga0495659_0020455_584_1417 | 270 |
| 164 | 3300048912 | Ga0496109_0055599 | Ga0496109_0055599_1341_2174 | 270 |
| 165 | 3300048916 | Ga0496113_0037187 | Ga0496113_0037187_2238_3071 | 270 |
| 166 | 3300049575 | Ga0501039_0093895 | Ga0501039_0093895_509_1342 | 270 |
| 167 | 3300049578 | Ga0501042_0003889 | Ga0501042_0003889_6261_7094 | 270 |
| 168 | 3300049580 | Ga0501046_0348896 | Ga0501046_0348896_78_911 | 270 |
| 169 | 3300049587 | Ga0501071_0158449 | Ga0501071_0158449_482_1315 | 270 |
| 170 | 3300049590 | Ga0501074_0330732 | Ga0501074_0330732_142_975 | 270 |
| 171 | 3300049593 | Ga0501077_0132067 | Ga0501077_0132067_501_1334 | 270 |
| 172 | 3300049741 | Ga0501079_0262337 | Ga0501079_0262337_421_1254 | 270 |
| 173 | 3300049824 | Ga0501045_0089081 | Ga0501045_0089081_891_1724 | 270 |
| 174 | 3300050507 | nmdc:mga05p37_282105_c1 | nmdc:mga05p37_282105_c1_859_1692 | 270 |
| 175 | 3300050507 | nmdc:mga05p37_28799_c1 | nmdc:mga05p37_28799_c1_887_1720 | 270 |
| 176 | 3300050507 | nmdc:mga05p37_35576_c1 | nmdc:mga05p37_35576_c1_292_1125 | 270 |
| 177 | 3300050507 | nmdc:mga05p37_92576_c1 | nmdc:mga05p37_92576_c1_2818_3660 | 270 |
| 178 | 3300050508 | nmdc:mga09592_106396_c1 | nmdc:mga09592_106396_c1_1027_1860 | 270 |
| 179 | 3300050508 | nmdc:mga09592_164039_c1 | nmdc:mga09592_164039_c1_1017_1850 | 270 |
| 180 | 3300050508 | nmdc:mga09592_316135_c1 | nmdc:mga09592_316135_c1_105_938 | 270 |
| 181 | 3300050508 | nmdc:mga09592_393425_c1 | nmdc:mga09592_393425_c1_309_1142 | 270 |
| 182 | 3300050509 | nmdc:mga0qj67_66977_c1 | nmdc:mga0qj67_66977_c1_653_1486 | 270 |
| 183 | 3300050510 | nmdc:mga06r32_206675_c1 | nmdc:mga06r32_206675_c1_1027_1860 | 270 |
| 184 | 3300050510 | nmdc:mga06r32_209770_c1 | nmdc:mga06r32_209770_c1_684_1517 | 270 |
| 185 | 3300050511 | nmdc:mga08y16_32226_c1 | nmdc:mga08y16_32226_c1_497_1330 | 270 |
| 186 | 3300050511 | nmdc:mga08y16_375226_c1 | nmdc:mga08y16_375226_c1_331_1164 | 270 |
| 187 | 3300050511 | nmdc:mga08y16_40195_c1 | nmdc:mga08y16_40195_c1_1575_2408 | 270 |
| 188 | 3300050511 | nmdc:mga08y16_945_c1 | nmdc:mga08y16_945_c1_26152_26985 | 270 |
| 189 | 3300050512 | nmdc:mga0n895_467810_c1 | nmdc:mga0n895_467810_c1_57_890 | 270 |
| 190 | 3300050515 | nmdc:mga0a205_220729_c1 | nmdc:mga0a205_220729_c1_167_1000 | 270 |
| 191 | 3300060353 | Ga0501082_0006994 | Ga0501082_0006994_8350_9183 | 270 |
| 192 | 3300005344 | Ga0070661_100215027 | Ga0070661_1002150272 | 271 |
| 193 | 3300005364 | Ga0070673_100174804 | Ga0070673_1001748042 | 271 |
| 194 | 3300005364 | Ga0070673_100330612 | Ga0070673_1003306121 | 271 |
| 195 | 3300005366 | Ga0070659_100064075 | Ga0070659_1000640753 | 271 |
| 196 | 3300005456 | Ga0070678_100165541 | Ga0070678_1001655413 | 271 |
| 197 | 3300005459 | Ga0068867_100071966 | Ga0068867_1000719662 | 271 |
| 198 | 3300005471 | Ga0070698_100022784 | Ga0070698_1000227847 | 271 |
| 199 | 3300005471 | Ga0070698_100059186 | Ga0070698_1000591862 | 271 |
| 200 | 3300005546 | Ga0070696_100062338 | Ga0070696_1000623382 | 271 |
| 201 | 3300005548 | Ga0070665_100031333 | Ga0070665_1000313331 | 271 |
| 202 | 3300005564 | Ga0070664_100027774 | Ga0070664_1000277744 | 271 |
| 203 | 3300005719 | Ga0068861_100120742 | Ga0068861_1001207423 | 271 |
| 204 | 3300006173 | Ga0070716_100262996 | Ga0070716_1002629962 | 271 |
| 205 | 3300006846 | Ga0075430_100022848 | Ga0075430_1000228482 | 271 |
| 206 | 3300006871 | Ga0075434_100038568 | Ga0075434_1000385683 | 271 |
| 207 | 3300006871 | Ga0075434_100255165 | Ga0075434_1002551652 | 271 |
| 208 | 3300006881 | Ga0068865_100112314 | Ga0068865_1001123142 | 271 |
| 209 | 3300006881 | Ga0068865_100241631 | Ga0068865_1002416312 | 271 |
| 210 | 3300006914 | Ga0075436_100125073 | Ga0075436_1001250732 | 271 |
| 211 | 3300007076 | Ga0075435_100010574 | Ga0075435_1000105743 | 271 |
| 212 | 3300009098 | Ga0105245_10008629 | Ga0105245_1000862911 | 271 |
| 213 | 3300009147 | Ga0114129_10160493 | Ga0114129_101604933 | 271 |
| 214 | 3300009176 | Ga0105242_10290514 | Ga0105242_102905141 | 271 |
| 215 | 3300009176 | Ga0105242_10476981 | Ga0105242_104769811 | 271 |
| 216 | 3300009177 | Ga0105248_10647238 | Ga0105248_106472381 | 271 |
| 217 | 3300009553 | Ga0105249_10043919 | Ga0105249_100439194 | 271 |
| 218 | 3300013306 | Ga0163162_10168863 | Ga0163162_101688632 | 271 |
| 219 | 3300013308 | Ga0157375_10209089 | Ga0157375_102090892 | 271 |
| 220 | 3300014969 | Ga0157376_10057545 | Ga0157376_100575452 | 271 |
| 221 | 3300025910 | Ga0207684_10568773 | Ga0207684_105687732 | 271 |
| 222 | 3300025922 | Ga0207646_10332477 | Ga0207646_103324771 | 271 |
| 223 | 3300025927 | Ga0207687_10014295 | Ga0207687_100142954 | 271 |
| 224 | 3300025932 | Ga0207690_10199165 | Ga0207690_101991652 | 271 |
| 225 | 3300025934 | Ga0207686_10034387 | Ga0207686_100343872 | 271 |
| 226 | 3300025938 | Ga0207704_10038855 | Ga0207704_100388552 | 271 |
| 227 | 3300026023 | Ga0207677_10056451 | Ga0207677_100564511 | 271 |
| 228 | 3300026075 | Ga0207708_10111947 | Ga0207708_101119471 | 271 |
| 229 | 3300026089 | Ga0207648_10087655 | Ga0207648_100876552 | 271 |
| 230 | 3300028379 | Ga0268266_10211239 | Ga0268266_102112391 | 271 |
| 231 | 3300028380 | Ga0268265_10066118 | Ga0268265_100661182 | 271 |
| 232 | 3300031711 | Ga0265314_10084420 | Ga0265314_100844201 | 271 |
| 233 | 3300035111 | Ga0373923_0040693 | Ga0373923_0040693_1074_1904 | 271 |
| 234 | 3300035120 | Ga0373957_0135763 | Ga0373957_0135763_58_891 | 271 |
| 235 | 3300035170 | Ga0373943_0003682 | Ga0373943_0003682_593_1423 | 271 |
| 236 | 3300035171 | Ga0373946_0009173 | Ga0373946_0009173_1884_2714 | 271 |
| 237 | 3300035172 | Ga0373955_0004579 | Ga0373955_0004579_3847_4677 | 271 |
| 238 | 3300035410 | Ga0373924_0003631 | Ga0373924_0003631_740_1570 | 271 |
| 239 | 3300035692 | Ga0373935_0178182 | Ga0373935_0178182_606_1436 | 271 |
| 240 | 3300035695 | Ga0373927_0371273 | Ga0373927_0371273_58_888 | 271 |
| 241 | 3300037068 | Ga0373925_0148733 | Ga0373925_0148733_10_840 | 271 |
| 242 | 3300037068 | Ga0373925_0171535 | Ga0373925_0171535_197_1027 | 271 |
| 243 | 3300046472 | Ga0495580_0118487 | Ga0495580_0118487_299_1129 | 271 |
| 244 | 3300046511 | Ga0495608_0003468 | Ga0495608_0003468_6247_7077 | 271 |
| 245 | 3300046517 | Ga0495630_0016655 | Ga0495630_0016655_3894_4724 | 271 |
| 246 | 3300046529 | Ga0495652_0164291 | Ga0495652_0164291_220_1050 | 271 |
| 247 | 3300046536 | Ga0495587_0039508 | Ga0495587_0039508_1371_2201 | 271 |
| 248 | 3300046681 | Ga0495647_0111633 | Ga0495647_0111633_87_917 | 271 |
| 249 | 3300046683 | Ga0495658_0117678 | Ga0495658_0117678_174_1004 | 271 |
| 250 | 3300046684 | Ga0495669_0001215 | Ga0495669_0001215_4023_4853 | 271 |
| 251 | 3300046689 | Ga0495613_0003695 | Ga0495613_0003695_6377_7207 | 271 |
| 252 | 3300047317 | Ga0495604_0062959 | Ga0495604_0062959_1755_2585 | 271 |
| 253 | 3300047319 | Ga0495674_0009481 | Ga0495674_0009481_2524_3354 | 271 |
| 254 | 3300047319 | Ga0495674_0179328 | Ga0495674_0179328_46_876 | 271 |
| 255 | 3300047471 | Ga0495684_0000601 | Ga0495684_0000601_978_1808 | 271 |
| 256 | 3300050507 | nmdc:mga05p37_84584_c1 | nmdc:mga05p37_84584_c1_888_1715 | 271 |
| 257 | 3300050509 | nmdc:mga0qj67_4306_c2 | nmdc:mga0qj67_4306_c2_4286_5116 | 271 |
| 258 | 3300050511 | nmdc:mga08y16_273023_c1 | nmdc:mga08y16_273023_c1_513_1343 | 271 |
| 259 | 3300050512 | nmdc:mga0n895_10821_c1 | nmdc:mga0n895_10821_c1_7132_7971 | 271 |
| 260 | 3300050512 | nmdc:mga0n895_39130_c1 | nmdc:mga0n895_39130_c1_2788_3615 | 271 |
| 261 | 3300050513 | nmdc:mga0rr50_21346_c1 | nmdc:mga0rr50_21346_c1_2903_3730 | 271 |
| 262 | 3300050514 | nmdc:mga08x19_123848_c1 | nmdc:mga08x19_123848_c1_387_1214 | 271 |
| 263 | 3300050515 | nmdc:mga0a205_210015_c1 | nmdc:mga0a205_210015_c1_816_1646 | 271 |
| 264 | 3300050515 | nmdc:mga0a205_4601_c1 | nmdc:mga0a205_4601_c1_10490_11317 | 271 |
| 265 | 3300053077 | Ga0495601_0055214 | Ga0495601_0055214_88_918 | 271 |
| 266 | 3300053085 | Ga0495619_0000386 | Ga0495619_0000386_9833_10663 | 271 |
| 267 | 3300003203 | JGI25406J46586_10000188 | JGI25406J46586_1000018824 | 272 |
| 268 | 3300005338 | Ga0068868_100366735 | Ga0068868_1003667351 | 272 |
| 269 | 3300005344 | Ga0070661_100114605 | Ga0070661_1001146052 | 272 |
| 270 | 3300005536 | Ga0070697_100269293 | Ga0070697_1002692932 | 272 |
| 271 | 3300005985 | Ga0081539_10000013 | Ga0081539_10000013362 | 272 |
| 272 | 3300026023 | Ga0207677_10277135 | Ga0207677_102771352 | 272 |
| 273 | 3300049575 | Ga0501039_0074972 | Ga0501039_0074972_63_902 | 273 |
| 274 | 3300049576 | Ga0501040_0033029 | Ga0501040_0033029_2085_2924 | 273 |
| 275 | 3300049577 | Ga0501041_0092802 | Ga0501041_0092802_438_1277 | 273 |
| 276 | 3300049578 | Ga0501042_0342725 | Ga0501042_0342725_63_902 | 273 |
| 277 | 3300049580 | Ga0501046_0075810 | Ga0501046_0075810_931_1770 | 273 |
| 278 | 3300049592 | Ga0501076_0190632 | Ga0501076_0190632_685_1524 | 273 |
| 279 | 3300049593 | Ga0501077_0051690 | Ga0501077_0051690_321_1160 | 273 |
| 280 | 3300061734 | Ga0530510_0004934 | Ga0530510_0004934_560_1399 | 273 |
| 281 | 3300001977 | JGI24746J21847_1005383 | JGI24746J21847_10053832 | 275 |
| 282 | 3300005288 | Ga0065714_10108694 | Ga0065714_101086942 | 275 |
| 283 | 3300005290 | Ga0065712_10071830 | Ga0065712_100718302 | 275 |
| 284 | 3300005290 | Ga0065712_10097785 | Ga0065712_100977852 | 275 |
| 285 | 3300005293 | Ga0065715_10009149 | Ga0065715_100091493 | 275 |
| 286 | 3300005293 | Ga0065715_10198750 | Ga0065715_101987502 | 275 |
| 287 | 3300005328 | Ga0070676_10046293 | Ga0070676_100462932 | 275 |
| 288 | 3300005330 | Ga0070690_100026105 | Ga0070690_1000261052 | 275 |
| 289 | 3300005330 | Ga0070690_100224517 | Ga0070690_1002245172 | 275 |
| 290 | 3300005331 | Ga0070670_100008188 | Ga0070670_1000081889 | 275 |
| 291 | 3300005331 | Ga0070670_100077047 | Ga0070670_1000770472 | 275 |
| 292 | 3300005333 | Ga0070677_10021822 | Ga0070677_100218222 | 275 |
| 293 | 3300005334 | Ga0068869_100003236 | Ga0068869_1000032362 | 275 |
| 294 | 3300005338 | Ga0068868_100008101 | Ga0068868_1000081013 | 275 |
| 295 | 3300005340 | Ga0070689_100051308 | Ga0070689_1000513083 | 275 |
| 296 | 3300005340 | Ga0070689_100062586 | Ga0070689_1000625863 | 275 |
| 297 | 3300005340 | Ga0070689_100134546 | Ga0070689_1001345462 | 275 |
| 298 | 3300005343 | Ga0070687_100016036 | Ga0070687_1000160364 | 275 |
| 299 | 3300005344 | Ga0070661_100037274 | Ga0070661_1000372742 | 275 |
| 300 | 3300005345 | Ga0070692_10064233 | Ga0070692_100642332 | 275 |
| 301 | 3300005353 | Ga0070669_100164344 | Ga0070669_1001643442 | 275 |
| 302 | 3300005354 | Ga0070675_100083050 | Ga0070675_1000830502 | 275 |
| 303 | 3300005356 | Ga0070674_100202005 | Ga0070674_1002020052 | 275 |
| 304 | 3300005364 | Ga0070673_100152749 | Ga0070673_1001527492 | 275 |
| 305 | 3300005365 | Ga0070688_100056574 | Ga0070688_1000565742 | 275 |
| 306 | 3300005365 | Ga0070688_100099110 | Ga0070688_1000991102 | 275 |
| 307 | 3300005366 | Ga0070659_100146248 | Ga0070659_1001462482 | 275 |
| 308 | 3300005367 | Ga0070667_100010567 | Ga0070667_1000105678 | 275 |
| 309 | 3300005441 | Ga0070700_100094208 | Ga0070700_1000942082 | 275 |
| 310 | 3300005441 | Ga0070700_100409431 | Ga0070700_1004094311 | 275 |
| 311 | 3300005456 | Ga0070678_100039934 | Ga0070678_1000399344 | 275 |
| 312 | 3300005457 | Ga0070662_100085345 | Ga0070662_1000853452 | 275 |
| 313 | 3300005459 | Ga0068867_100089238 | Ga0068867_1000892382 | 275 |
| 314 | 3300005466 | Ga0070685_10017893 | Ga0070685_100178932 | 275 |
| 315 | 3300005466 | Ga0070685_10180385 | Ga0070685_101803851 | 275 |
| 316 | 3300005471 | Ga0070698_100420067 | Ga0070698_1004200672 | 275 |
| 317 | 3300005518 | Ga0070699_100275613 | Ga0070699_1002756133 | 275 |
| 318 | 3300005543 | Ga0070672_100020041 | Ga0070672_1000200414 | 275 |
| 319 | 3300005543 | Ga0070672_100097480 | Ga0070672_1000974803 | 275 |
| 320 | 3300005544 | Ga0070686_100074620 | Ga0070686_1000746202 | 275 |
| 321 | 3300005548 | Ga0070665_100012196 | Ga0070665_1000121963 | 275 |
| 322 | 3300005564 | Ga0070664_100011751 | Ga0070664_1000117517 | 275 |
| 323 | 3300005564 | Ga0070664_100130213 | Ga0070664_1001302132 | 275 |
| 324 | 3300005577 | Ga0068857_100256147 | Ga0068857_1002561472 | 275 |
| 325 | 3300005617 | Ga0068859_100044995 | Ga0068859_1000449955 | 275 |
| 326 | 3300005617 | Ga0068859_100046545 | Ga0068859_1000465454 | 275 |
| 327 | 3300005719 | Ga0068861_100060837 | Ga0068861_1000608373 | 275 |
| 328 | 3300005840 | Ga0068870_10033511 | Ga0068870_100335113 | 275 |
| 329 | 3300005840 | Ga0068870_10062119 | Ga0068870_100621192 | 275 |
| 330 | 3300005840 | Ga0068870_10131221 | Ga0068870_101312212 | 275 |
| 331 | 3300005841 | Ga0068863_100133676 | Ga0068863_1001336763 | 275 |
| 332 | 3300005844 | Ga0068862_100466306 | Ga0068862_1004663062 | 275 |
| 333 | 3300006237 | Ga0097621_100191446 | Ga0097621_1001914463 | 275 |
| 334 | 3300006844 | Ga0075428_100000869 | Ga0075428_10000086915 | 275 |
| 335 | 3300006844 | Ga0075428_100008219 | Ga0075428_1000082193 | 275 |
| 336 | 3300006844 | Ga0075428_100760395 | Ga0075428_1007603951 | 275 |
| 337 | 3300006846 | Ga0075430_100492171 | Ga0075430_1004921712 | 275 |
| 338 | 3300006847 | Ga0075431_100049128 | Ga0075431_1000491283 | 275 |
| 339 | 3300006871 | Ga0075434_100078720 | Ga0075434_1000787202 | 275 |
| 340 | 3300006880 | Ga0075429_100079071 | Ga0075429_1000790713 | 275 |
| 341 | 3300006880 | Ga0075429_100096904 | Ga0075429_1000969042 | 275 |
| 342 | 3300006880 | Ga0075429_100463729 | Ga0075429_1004637291 | 275 |
| 343 | 3300006881 | Ga0068865_100017474 | Ga0068865_1000174744 | 275 |
| 344 | 3300006931 | Ga0097620_100044994 | Ga0097620_1000449945 | 275 |
| 345 | 3300006931 | Ga0097620_100046547 | Ga0097620_1000465474 | 275 |
| 346 | 3300009094 | Ga0111539_10000769 | Ga0111539_100007698 | 275 |
| 347 | 3300009094 | Ga0111539_10100266 | Ga0111539_101002664 | 275 |
| 348 | 3300009094 | Ga0111539_10242372 | Ga0111539_102423722 | 275 |
| 349 | 3300009098 | Ga0105245_10459839 | Ga0105245_104598392 | 275 |
| 350 | 3300009147 | Ga0114129_10132600 | Ga0114129_101326003 | 275 |
| 351 | 3300009147 | Ga0114129_11101553 | Ga0114129_111015532 | 275 |
| 352 | 3300009177 | Ga0105248_10241039 | Ga0105248_102410392 | 275 |
| 353 | 3300009553 | Ga0105249_10001334 | Ga0105249_1000133415 | 275 |
| 354 | 3300011119 | Ga0105246_10021871 | Ga0105246_100218712 | 275 |
| 355 | 3300013102 | Ga0157371_10043810 | Ga0157371_100438102 | 275 |
| 356 | 3300013296 | Ga0157374_10215050 | Ga0157374_102150503 | 275 |
| 357 | 3300013306 | Ga0163162_10033186 | Ga0163162_100331863 | 275 |
| 358 | 3300013306 | Ga0163162_10182938 | Ga0163162_101829382 | 275 |
| 359 | 3300013308 | Ga0157375_10018181 | Ga0157375_100181812 | 275 |
| 360 | 3300013308 | Ga0157375_10301418 | Ga0157375_103014182 | 275 |
| 361 | 3300014325 | Ga0163163_10140451 | Ga0163163_101404512 | 275 |
| 362 | 3300014326 | Ga0157380_10007439 | Ga0157380_100074398 | 275 |
| 363 | 3300014326 | Ga0157380_10274561 | Ga0157380_102745612 | 275 |
| 364 | 3300014745 | Ga0157377_10015219 | Ga0157377_100152193 | 275 |
| 365 | 3300014968 | Ga0157379_10003739 | Ga0157379_100037393 | 275 |
| 366 | 3300014969 | Ga0157376_10052484 | Ga0157376_100524844 | 275 |
| 367 | 3300017792 | Ga0163161_10023461 | Ga0163161_100234614 | 275 |
| 368 | 3300017792 | Ga0163161_10042869 | Ga0163161_100428692 | 275 |
| 369 | 3300025315 | Ga0207697_10001514 | Ga0207697_1000151413 | 275 |
| 370 | 3300025315 | Ga0207697_10091137 | Ga0207697_100911372 | 275 |
| 371 | 3300025893 | Ga0207682_10001841 | Ga0207682_100018419 | 275 |
| 372 | 3300025893 | Ga0207682_10003394 | Ga0207682_100033948 | 275 |
| 373 | 3300025901 | Ga0207688_10001443 | Ga0207688_100014438 | 275 |
| 374 | 3300025903 | Ga0207680_10105873 | Ga0207680_101058732 | 275 |
| 375 | 3300025907 | Ga0207645_10001881 | Ga0207645_100018818 | 275 |
| 376 | 3300025907 | Ga0207645_10043765 | Ga0207645_100437653 | 275 |
| 377 | 3300025908 | Ga0207643_10005281 | Ga0207643_100052818 | 275 |
| 378 | 3300025908 | Ga0207643_10015261 | Ga0207643_100152613 | 275 |
| 379 | 3300025908 | Ga0207643_10039643 | Ga0207643_100396433 | 275 |
| 380 | 3300025918 | Ga0207662_10002054 | Ga0207662_100020546 | 275 |
| 381 | 3300025920 | Ga0207649_10088325 | Ga0207649_100883252 | 275 |
| 382 | 3300025923 | Ga0207681_10074125 | Ga0207681_100741252 | 275 |
| 383 | 3300025923 | Ga0207681_10081612 | Ga0207681_100816122 | 275 |
| 384 | 3300025923 | Ga0207681_10146939 | Ga0207681_101469392 | 275 |
| 385 | 3300025925 | Ga0207650_10083205 | Ga0207650_100832053 | 275 |
| 386 | 3300025925 | Ga0207650_10211843 | Ga0207650_102118432 | 275 |
| 387 | 3300025926 | Ga0207659_10002242 | Ga0207659_100022422 | 275 |
| 388 | 3300025926 | Ga0207659_10147555 | Ga0207659_101475552 | 275 |
| 389 | 3300025926 | Ga0207659_10293757 | Ga0207659_102937572 | 275 |
| 390 | 3300025933 | Ga0207706_10003425 | Ga0207706_1000342511 | 275 |
| 391 | 3300025936 | Ga0207670_10245445 | Ga0207670_102454452 | 275 |
| 392 | 3300025937 | Ga0207669_10307745 | Ga0207669_103077452 | 275 |
| 393 | 3300025938 | Ga0207704_10016569 | Ga0207704_100165694 | 275 |
| 394 | 3300025940 | Ga0207691_10005705 | Ga0207691_1000570513 | 275 |
| 395 | 3300025940 | Ga0207691_10027241 | Ga0207691_100272415 | 275 |
| 396 | 3300025940 | Ga0207691_10030625 | Ga0207691_100306253 | 275 |
| 397 | 3300025941 | Ga0207711_10126377 | Ga0207711_101263772 | 275 |
| 398 | 3300025942 | Ga0207689_10000831 | Ga0207689_100008317 | 275 |
| 399 | 3300025942 | Ga0207689_10395547 | Ga0207689_103955471 | 275 |
| 400 | 3300025960 | Ga0207651_10061581 | Ga0207651_100615812 | 275 |
| 401 | 3300025960 | Ga0207651_10217778 | Ga0207651_102177782 | 275 |
| 402 | 3300025960 | Ga0207651_10323620 | Ga0207651_103236201 | 275 |
| 403 | 3300025961 | Ga0207712_10002418 | Ga0207712_100024188 | 275 |
| 404 | 3300025972 | Ga0207668_10063916 | Ga0207668_100639163 | 275 |
| 405 | 3300026023 | Ga0207677_10074628 | Ga0207677_100746283 | 275 |
| 406 | 3300026035 | Ga0207703_10086035 | Ga0207703_100860352 | 275 |
| 407 | 3300026075 | Ga0207708_10198955 | Ga0207708_101989552 | 275 |
| 408 | 3300026075 | Ga0207708_10251301 | Ga0207708_102513011 | 275 |
| 409 | 3300026088 | Ga0207641_10042542 | Ga0207641_100425424 | 275 |
| 410 | 3300026089 | Ga0207648_10048633 | Ga0207648_100486332 | 275 |
| 411 | 3300026116 | Ga0207674_10089328 | Ga0207674_100893284 | 275 |
| 412 | 3300026118 | Ga0207675_100004015 | Ga0207675_1000040158 | 275 |
| 413 | 3300026118 | Ga0207675_100093451 | Ga0207675_1000934513 | 275 |
| 414 | 3300026118 | Ga0207675_100323156 | Ga0207675_1003231562 | 275 |
| 415 | 3300026121 | Ga0207683_10021244 | Ga0207683_100212442 | 275 |
| 416 | 3300026121 | Ga0207683_10093639 | Ga0207683_100936392 | 275 |
| 417 | 3300027907 | Ga0207428_10002217 | Ga0207428_1000221717 | 275 |
| 418 | 3300027907 | Ga0207428_10004706 | Ga0207428_1000470610 | 275 |
| 419 | 3300028379 | Ga0268266_10336344 | Ga0268266_103363442 | 275 |
| 420 | 3300028380 | Ga0268265_10058496 | Ga0268265_100584963 | 275 |
| 421 | 3300028380 | Ga0268265_10062280 | Ga0268265_100622802 | 275 |
| 422 | 3300028381 | Ga0268264_10088574 | Ga0268264_100885742 | 275 |
| 423 | 3300031731 | Ga0307405_10036021 | Ga0307405_100360212 | 275 |
| 424 | 3300031852 | Ga0307410_10009560 | Ga0307410_100095606 | 275 |
| 425 | 3300031903 | Ga0307407_10042811 | Ga0307407_100428113 | 275 |
| 426 | 3300031911 | Ga0307412_10010531 | Ga0307412_100105316 | 275 |
| 427 | 3300031995 | Ga0307409_100011842 | Ga0307409_1000118426 | 275 |
| 428 | 3300032002 | Ga0307416_100004482 | Ga0307416_1000044822 | 275 |
| 429 | 3300032004 | Ga0307414_10044810 | Ga0307414_100448102 | 275 |
| 430 | 3300032005 | Ga0307411_10016639 | Ga0307411_100166393 | 275 |
| 431 | 3300032126 | Ga0307415_100053170 | Ga0307415_1000531702 | 275 |
| 432 | 3300035084 | Ga0373928_0020210 | Ga0373928_0020210_227_1063 | 275 |
| 433 | 3300035241 | Ga0373961_0006165 | Ga0373961_0006165_1841_2677 | 275 |
| 434 | 3300035691 | Ga0373931_0022676 | Ga0373931_0022676_1756_2592 | 275 |
| 435 | 3300042156 | Ga0439446_0057618 | Ga0439446_0057618_209_1051 | 275 |
| 436 | 3300046537 | Ga0495598_0016109 | Ga0495598_0016109_630_1472 | 275 |
| 437 | 3300046558 | Ga0495633_0045317 | Ga0495633_0045317_714_1556 | 275 |
| 438 | 3300046615 | Ga0495656_0109244 | Ga0495656_0109244_318_1148 | 275 |
| 439 | 3300049578 | Ga0501042_0236178 | Ga0501042_0236178_448_1275 | 275 |
| 440 | 3300049591 | Ga0501075_0310479 | Ga0501075_0310479_150_977 | 275 |
| 441 | 3300050508 | nmdc:mga09592_18887_c1 | nmdc:mga09592_18887_c1_4232_5074 | 275 |
| 442 | 3300050509 | nmdc:mga0qj67_93568_c1 | nmdc:mga0qj67_93568_c1_1483_2325 | 275 |
| 443 | 3300050511 | nmdc:mga08y16_12914_c1 | nmdc:mga08y16_12914_c1_336_1172 | 275 |
| 444 | 3300050511 | nmdc:mga08y16_50424_c1 | nmdc:mga08y16_50424_c1_2804_3646 | 275 |
| 445 | 3300050511 | nmdc:mga08y16_5828_c1 | nmdc:mga08y16_5828_c1_6894_7733 | 275 |
| 446 | 3300050512 | nmdc:mga0n895_81489_c1 | nmdc:mga0n895_81489_c1_2137_2973 | 275 |
| 447 | 3300050515 | nmdc:mga0a205_1497_c1 | nmdc:mga0a205_1497_c1_7417_8253 | 275 |
| 448 | 3300005333 | Ga0070677_10044875 | Ga0070677_100448753 | 276 |
| 449 | 3300005336 | Ga0070680_100065511 | Ga0070680_1000655112 | 276 |
| 450 | 3300005343 | Ga0070687_100013368 | Ga0070687_1000133684 | 276 |
| 451 | 3300005356 | Ga0070674_100001500 | Ga0070674_1000015008 | 276 |
| 452 | 3300005459 | Ga0068867_100186096 | Ga0068867_1001860962 | 276 |
| 453 | 3300005577 | Ga0068857_100033732 | Ga0068857_1000337323 | 276 |
| 454 | 3300005577 | Ga0068857_100181226 | Ga0068857_1001812262 | 276 |
| 455 | 3300006844 | Ga0075428_100119341 | Ga0075428_1001193412 | 276 |
| 456 | 3300006871 | Ga0075434_100008828 | Ga0075434_1000088287 | 276 |
| 457 | 3300006871 | Ga0075434_100109915 | Ga0075434_1001099152 | 276 |
| 458 | 3300007076 | Ga0075435_100050563 | Ga0075435_1000505634 | 276 |
| 459 | 3300009147 | Ga0114129_10006054 | Ga0114129_100060543 | 276 |
| 460 | 3300009147 | Ga0114129_10176742 | Ga0114129_101767422 | 276 |
| 461 | 3300014326 | Ga0157380_10003886 | Ga0157380_1000388611 | 276 |
| 462 | 3300014326 | Ga0157380_10278188 | Ga0157380_102781882 | 276 |
| 463 | 3300025893 | Ga0207682_10148890 | Ga0207682_101488902 | 276 |
| 464 | 3300025908 | Ga0207643_10020319 | Ga0207643_100203193 | 276 |
| 465 | 3300025917 | Ga0207660_10280256 | Ga0207660_102802562 | 276 |
| 466 | 3300025926 | Ga0207659_10014600 | Ga0207659_100146002 | 276 |
| 467 | 3300025933 | Ga0207706_10292309 | Ga0207706_102923092 | 276 |
| 468 | 3300025937 | Ga0207669_10001529 | Ga0207669_100015296 | 276 |
| 469 | 3300025942 | Ga0207689_10210793 | Ga0207689_102107932 | 276 |
| 470 | 3300026116 | Ga0207674_10043449 | Ga0207674_100434493 | 276 |
| 471 | 3300026116 | Ga0207674_10095960 | Ga0207674_100959603 | 276 |
| 472 | 3300026121 | Ga0207683_10059137 | Ga0207683_100591373 | 276 |
| 473 | 3300045051 | Ga0451576_0013731 | Ga0451576_0013731_875_1705 | 276 |
| 474 | 3300046525 | Ga0495663_0059105 | Ga0495663_0059105_117_947 | 276 |
| 475 | 3300046664 | Ga0495659_0035277 | Ga0495659_0035277_831_1661 | 276 |
| 476 | 3300046683 | Ga0495658_0059852 | Ga0495658_0059852_409_1239 | 276 |
| 477 | 3300050507 | nmdc:mga05p37_17011_c1 | nmdc:mga05p37_17011_c1_2298_3128 | 276 |
| 478 | 3300050508 | nmdc:mga09592_135869_c1 | nmdc:mga09592_135869_c1_871_1701 | 276 |
| 479 | 3300050512 | nmdc:mga0n895_27620_c1 | nmdc:mga0n895_27620_c1_1973_2803 | 276 |
| 480 | 3300050512 | nmdc:mga0n895_86092_c1 | nmdc:mga0n895_86092_c1_2153_2986 | 276 |
| 481 | 3300050513 | nmdc:mga0rr50_119416_c1 | nmdc:mga0rr50_119416_c1_496_1326 | 276 |
| 482 | 3300050515 | nmdc:mga0a205_44250_c1 | nmdc:mga0a205_44250_c1_26_859 | 276 |
| 483 | 3300050515 | nmdc:mga0a205_71273_c1 | nmdc:mga0a205_71273_c1_2176_3006 | 276 |
| 484 | 2162886007 | SwRhRL2b_contig_3495822 | SwRhRL2b_0361.00002870 | 277 |
| 485 | 2162886007 | SwRhRL2b_contig_757619 | SwRhRL2b_0133.00005430 | 277 |
| 486 | 3300005289 | Ga0065704_10242024 | Ga0065704_102420241 | 277 |
| 487 | 3300005295 | Ga0065707_10006880 | Ga0065707_100068803 | 277 |
| 488 | 3300005295 | Ga0065707_10095648 | Ga0065707_100956482 | 277 |
| 489 | 3300005328 | Ga0070676_10023781 | Ga0070676_100237812 | 277 |
| 490 | 3300005329 | Ga0070683_100201078 | Ga0070683_1002010782 | 277 |
| 491 | 3300005329 | Ga0070683_100440231 | Ga0070683_1004402311 | 277 |
| 492 | 3300005340 | Ga0070689_100014552 | Ga0070689_1000145524 | 277 |
| 493 | 3300005353 | Ga0070669_100002727 | Ga0070669_10000272713 | 277 |
| 494 | 3300005355 | Ga0070671_100029642 | Ga0070671_1000296422 | 277 |
| 495 | 3300005355 | Ga0070671_100544321 | Ga0070671_1005443211 | 277 |
| 496 | 3300005364 | Ga0070673_100273664 | Ga0070673_1002736642 | 277 |
| 497 | 3300005365 | Ga0070688_100157964 | Ga0070688_1001579642 | 277 |
| 498 | 3300005367 | Ga0070667_100484271 | Ga0070667_1004842712 | 277 |
| 499 | 3300005438 | Ga0070701_10021663 | Ga0070701_100216634 | 277 |
| 500 | 3300005441 | Ga0070700_100018991 | Ga0070700_1000189914 | 277 |
| 501 | 3300005444 | Ga0070694_100300369 | Ga0070694_1003003692 | 277 |
| 502 | 3300005458 | Ga0070681_10025905 | Ga0070681_100259056 | 277 |
| 503 | 3300005459 | Ga0068867_100000147 | Ga0068867_10000014727 | 277 |
| 504 | 3300005468 | Ga0070707_100228446 | Ga0070707_1002284463 | 277 |
| 505 | 3300005468 | Ga0070707_100283272 | Ga0070707_1002832722 | 277 |
| 506 | 3300005518 | Ga0070699_100024512 | Ga0070699_1000245124 | 277 |
| 507 | 3300005518 | Ga0070699_100192061 | Ga0070699_1001920612 | 277 |
| 508 | 3300005530 | Ga0070679_100054537 | Ga0070679_1000545373 | 277 |
| 509 | 3300005536 | Ga0070697_100204128 | Ga0070697_1002041282 | 277 |
| 510 | 3300005543 | Ga0070672_100074274 | Ga0070672_1000742743 | 277 |
| 511 | 3300005544 | Ga0070686_100104497 | Ga0070686_1001044972 | 277 |
| 512 | 3300005549 | Ga0070704_100028361 | Ga0070704_1000283613 | 277 |
| 513 | 3300005549 | Ga0070704_100059667 | Ga0070704_1000596672 | 277 |
| 514 | 3300005564 | Ga0070664_100010031 | Ga0070664_1000100319 | 277 |
| 515 | 3300005564 | Ga0070664_100160666 | Ga0070664_1001606662 | 277 |
| 516 | 3300005577 | Ga0068857_100078821 | Ga0068857_1000788213 | 277 |
| 517 | 3300005617 | Ga0068859_100002533 | Ga0068859_1000025332 | 277 |
| 518 | 3300005617 | Ga0068859_100068989 | Ga0068859_1000689892 | 277 |
| 519 | 3300005618 | Ga0068864_100112652 | Ga0068864_1001126522 | 277 |
| 520 | 3300005618 | Ga0068864_100223612 | Ga0068864_1002236122 | 277 |
| 521 | 3300005719 | Ga0068861_100001293 | Ga0068861_10000129310 | 277 |
| 522 | 3300005840 | Ga0068870_10008632 | Ga0068870_100086322 | 277 |
| 523 | 3300005842 | Ga0068858_100185150 | Ga0068858_1001851502 | 277 |
| 524 | 3300005843 | Ga0068860_100086446 | Ga0068860_1000864463 | 277 |
| 525 | 3300005844 | Ga0068862_100001293 | Ga0068862_10000129319 | 277 |
| 526 | 3300006852 | Ga0075433_10002009 | Ga0075433_100020093 | 277 |
| 527 | 3300006852 | Ga0075433_10013571 | Ga0075433_100135712 | 277 |
| 528 | 3300006852 | Ga0075433_10184104 | Ga0075433_101841042 | 277 |
| 529 | 3300006852 | Ga0075433_10493710 | Ga0075433_104937102 | 277 |
| 530 | 3300006871 | Ga0075434_100005716 | Ga0075434_1000057168 | 277 |
| 531 | 3300006871 | Ga0075434_100008044 | Ga0075434_1000080445 | 277 |
| 532 | 3300006880 | Ga0075429_100091302 | Ga0075429_1000913022 | 277 |
| 533 | 3300006881 | Ga0068865_100077390 | Ga0068865_1000773902 | 277 |
| 534 | 3300006931 | Ga0097620_100002533 | Ga0097620_10000253319 | 277 |
| 535 | 3300006931 | Ga0097620_100068989 | Ga0097620_1000689892 | 277 |
| 536 | 3300007076 | Ga0075435_100005714 | Ga0075435_1000057146 | 277 |
| 537 | 3300007076 | Ga0075435_100065813 | Ga0075435_1000658132 | 277 |
| 538 | 3300007076 | Ga0075435_100158714 | Ga0075435_1001587142 | 277 |
| 539 | 3300009094 | Ga0111539_10022455 | Ga0111539_100224555 | 277 |
| 540 | 3300009094 | Ga0111539_10266868 | Ga0111539_102668682 | 277 |
| 541 | 3300009147 | Ga0114129_10003276 | Ga0114129_1000327611 | 277 |
| 542 | 3300009147 | Ga0114129_10096834 | Ga0114129_100968344 | 277 |
| 543 | 3300009147 | Ga0114129_10846750 | Ga0114129_108467502 | 277 |
| 544 | 3300009553 | Ga0105249_10087301 | Ga0105249_100873013 | 277 |
| 545 | 3300011119 | Ga0105246_10028237 | Ga0105246_100282372 | 277 |
| 546 | 3300013296 | Ga0157374_10264284 | Ga0157374_102642842 | 277 |
| 547 | 3300013297 | Ga0157378_10099238 | Ga0157378_100992383 | 277 |
| 548 | 3300013297 | Ga0157378_10216219 | Ga0157378_102162192 | 277 |
| 549 | 3300013308 | Ga0157375_10033798 | Ga0157375_100337984 | 277 |
| 550 | 3300013308 | Ga0157375_10164865 | Ga0157375_101648652 | 277 |
| 551 | 3300013308 | Ga0157375_10348737 | Ga0157375_103487372 | 277 |
| 552 | 3300014745 | Ga0157377_10002991 | Ga0157377_100029912 | 277 |
| 553 | 3300014745 | Ga0157377_10093693 | Ga0157377_100936932 | 277 |
| 554 | 3300014969 | Ga0157376_10225378 | Ga0157376_102253782 | 277 |
| 555 | 3300025893 | Ga0207682_10014594 | Ga0207682_100145942 | 277 |
| 556 | 3300025904 | Ga0207647_10098223 | Ga0207647_100982232 | 277 |
| 557 | 3300025907 | Ga0207645_10027133 | Ga0207645_100271331 | 277 |
| 558 | 3300025908 | Ga0207643_10005748 | Ga0207643_100057485 | 277 |
| 559 | 3300025918 | Ga0207662_10020005 | Ga0207662_100200051 | 277 |
| 560 | 3300025921 | Ga0207652_10085534 | Ga0207652_100855342 | 277 |
| 561 | 3300025922 | Ga0207646_10247413 | Ga0207646_102474132 | 277 |
| 562 | 3300025923 | Ga0207681_10000566 | Ga0207681_1000056616 | 277 |
| 563 | 3300025926 | Ga0207659_10001222 | Ga0207659_100012228 | 277 |
| 564 | 3300025926 | Ga0207659_10231190 | Ga0207659_102311902 | 277 |
| 565 | 3300025936 | Ga0207670_10014557 | Ga0207670_100145574 | 277 |
| 566 | 3300025940 | Ga0207691_10025779 | Ga0207691_100257794 | 277 |
| 567 | 3300025944 | Ga0207661_10020477 | Ga0207661_100204776 | 277 |
| 568 | 3300025945 | Ga0207679_10366979 | Ga0207679_103669792 | 277 |
| 569 | 3300025960 | Ga0207651_10118570 | Ga0207651_101185702 | 277 |
| 570 | 3300025961 | Ga0207712_10029712 | Ga0207712_100297123 | 277 |
| 571 | 3300025972 | Ga0207668_10050926 | Ga0207668_100509263 | 277 |
| 572 | 3300025986 | Ga0207658_10281318 | Ga0207658_102813182 | 277 |
| 573 | 3300026041 | Ga0207639_10142279 | Ga0207639_101422792 | 277 |
| 574 | 3300026075 | Ga0207708_10070416 | Ga0207708_100704162 | 277 |
| 575 | 3300026075 | Ga0207708_10089859 | Ga0207708_100898592 | 277 |
| 576 | 3300026089 | Ga0207648_10000446 | Ga0207648_1000044627 | 277 |
| 577 | 3300026095 | Ga0207676_10120036 | Ga0207676_101200363 | 277 |
| 578 | 3300026116 | Ga0207674_10057586 | Ga0207674_100575863 | 277 |
| 579 | 3300026118 | Ga0207675_100001058 | Ga0207675_10000105810 | 277 |
| 580 | 3300026121 | Ga0207683_10038673 | Ga0207683_100386733 | 277 |
| 581 | 3300027907 | Ga0207428_10000224 | Ga0207428_1000022464 | 277 |
| 582 | 3300028380 | Ga0268265_10000540 | Ga0268265_1000054024 | 277 |
| 583 | 3300028381 | Ga0268264_10036528 | Ga0268264_100365282 | 277 |
| 584 | 3300042876 | Ga0451577_0363512 | Ga0451577_0363512_422_1255 | 277 |
| 585 | 3300045051 | Ga0451576_0021675 | Ga0451576_0021675_505_1338 | 277 |
| 586 | 3300045051 | Ga0451576_0052019 | Ga0451576_0052019_549_1382 | 277 |
| 587 | 3300045051 | Ga0451576_0177479 | Ga0451576_0177479_1258_2091 | 277 |
| 588 | 3300046539 | Ga0495621_0000539 | Ga0495621_0000539_1435_2268 | 277 |
| 589 | 3300046539 | Ga0495621_0012526 | Ga0495621_0012526_1168_2001 | 277 |
| 590 | 3300046664 | Ga0495659_0016434 | Ga0495659_0016434_689_1522 | 277 |
| 591 | 3300046684 | Ga0495669_0074664 | Ga0495669_0074664_86_919 | 277 |
| 592 | 3300047318 | Ga0495636_0072670 | Ga0495636_0072670_141_974 | 277 |
| 593 | 3300047445 | Ga0495677_0071882 | Ga0495677_0071882_107_940 | 277 |
| 594 | 3300050507 | nmdc:mga05p37_136169_c1 | nmdc:mga05p37_136169_c1_1770_2606 | 277 |
| 595 | 3300050507 | nmdc:mga05p37_358361_c1 | nmdc:mga05p37_358361_c1_199_1059 | 277 |
| 596 | 3300050507 | nmdc:mga05p37_429140_c1 | nmdc:mga05p37_429140_c1_471_1304 | 277 |
| 597 | 3300050508 | nmdc:mga09592_274532_c1 | nmdc:mga09592_274532_c1_101_934 | 277 |
| 598 | 3300050511 | nmdc:mga08y16_15575_c1 | nmdc:mga08y16_15575_c1_3362_4195 | 277 |
| 599 | 3300050511 | nmdc:mga08y16_48255_c1 | nmdc:mga08y16_48255_c1_2164_3030 | 277 |
| 600 | 3300050512 | nmdc:mga0n895_4485_c1 | nmdc:mga0n895_4485_c1_660_1520 | 277 |
| 601 | 3300050512 | nmdc:mga0n895_6752_c1 | nmdc:mga0n895_6752_c1_8285_9145 | 277 |
| 602 | 3300050512 | nmdc:mga0n895_802454_c1 | nmdc:mga0n895_802454_c1_58_894 | 277 |
| 603 | 3300050512 | nmdc:mga0n895_98386_c1 | nmdc:mga0n895_98386_c1_432_1265 | 277 |
| 604 | 3300050513 | nmdc:mga0rr50_108527_c1 | nmdc:mga0rr50_108527_c1_510_1346 | 277 |
| 605 | 3300050513 | nmdc:mga0rr50_190578_c1 | nmdc:mga0rr50_190578_c1_822_1655 | 277 |
| 606 | 3300050515 | nmdc:mga0a205_129737_c1 | nmdc:mga0a205_129737_c1_788_1624 | 277 |
| 607 | 3300050515 | nmdc:mga0a205_808_c1 | nmdc:mga0a205_808_c1_14195_15055 | 277 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4b2o-assembly1.cif.gz_D | crystal structure of bacillus subtilis ymdb, a global regulator of late adaptive responses. | 0.902 | 1 | 261 |
| 4b2o-assembly1.cif.gz_D | crystal structure of bacillus subtilis ymdb, a global regulator of late adaptive responses. | 0.8858 | 1 | 261 |
| 1t70-assembly3.cif.gz_E | crystal structure of a novel phosphatase from deinococcus radiodurans | 0.8755 | 1 | 258 |
| 1t70-assembly3.cif.gz_E | crystal structure of a novel phosphatase from deinococcus radiodurans | 0.8668 | 1 | 258 |
| 1t71-assembly1.cif.gz_A | crystal structure of a novel phosphatase mycoplasma pneumoniaefrom | 0.8605 | 1 | 258 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4b2oD00 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.902 | 1 | 261 | 3.60.21.10 |
| 4b2oD00 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.8858 | 1 | 261 | 3.60.21.10 |
| 1t71A00 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.8605 | 1 | 258 | 3.60.21.10 |
| 2z06B00 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.8563 | 1 | 258 | 3.60.21.10 |
| 2z06B00 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.8467 | 1 | 258 | 3.60.21.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A383ALH3-F1-model_v4 | Calcineurin-like phosphoesterase domain-containing protein | 1.002 | 1 | 79 |
GO:0004113
|
| AF-A0A3B0PD68-F1-model_v4 | Metallophosphoesterase YmdB | 0.9972 | 1 | 70 |
GO:0004113
|
| AF-A0A2V6E159-F1-model_v4 | Metallophosphoesterase | 0.996 | 1 | 102 |
GO:0004113
|
| AF-A0A538H8X2-F1-model_v4 | YmdB family metallophosphoesterase | 0.9951 | 1 | 99 |
GO:0004113
|
| AF-A0A7Y2JDI4-F1-model_v4 | Metallophosphoesterase | 0.9942 | 1 | 61 |
GO:0004113
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar