F468714

General Info

Members Datasets Scaffolds Average Seq Length
607 192 607 233

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0213090|Ga0395899_0213090_315_1049
Length 244
Sequence MNARGGWIVAAVGGGVVGSILTTGILFFAVPNSVATRVVRQGMVSDPQILRDSAEALQKQDEEKAQQQQISALAVNRVAIETPFASSWKGAAKPDVTLVEFFDYACPYCKVTNPTVDRLLQEDKGLRVVYRELPIIGGQESEIAARLSLTASKAGRFAQFHDALWAAGRPAPETLVIASNAAGISPEPPPNDPDIEAEINRNLKLASQLRATGTPLFVVGDQVINAAVPYETLKKAIADARAKS

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
85 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
138 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
139 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
140 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
141 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
142 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
143 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
144 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
145 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
146 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
147 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
148 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
149 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
150 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
151 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
152 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
153 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
154 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
155 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
156 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
157 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
158 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
159 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
160 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
161 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
162 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
163 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
164 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
165 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
166 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
167 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
168 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
169 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
170 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
171 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
172 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
173 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
174 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
175 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
176 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
177 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
178 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
179 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
180 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
181 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
182 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
183 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
184 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
185 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
186 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
187 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
188 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
189 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
190 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
191 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
192 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.84
Metatranscriptomes 0.16
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.16
Nodule 0
Rhizoplane 0.82
Rhizosphere 98.35
Stem 0
Stem Tuber 0
Unclassified 0.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10003441 3300001979 Bacteria 6959
2 JGI24740J21852_10034876 3300001979 Bacteria 1579
3 JGI24739J22299_10008395 3300001989 Bacteria 3857
4 JGI24737J22298_10006404 3300001990 Bacteria 4023
5 JGI24737J22298_10013258 3300001990 Bacteria 2684
6 JGI24735J21928_10003670 3300002067 Bacteria 5205
7 JGI24735J21928_10010863 3300002067 Bacteria 2893
8 JGI24735J21928_10011066 3300002067 Bacteria 2865
9 JGI24735J21928_10011759 3300002067 Bacteria 2772
10 JGI24735J21928_10029852 3300002067 Bacteria 1621
11 JGI24738J21930_10004376 3300002075 Bacteria 3467
12 rootH1_10069393 3300003323 Bacteria 1250
13 Ga0065715_10035602 3300005293 Unclassified 1488
14 Ga0065715_10259893 3300005293 Bacteria 1141
15 Ga0070658_10000630 3300005327 Bacteria 30439
16 Ga0070658_10040656 3300005327 Bacteria 3752
17 Ga0070658_10045495 3300005327 Bacteria 3549
18 Ga0070658_10085988 3300005327 Bacteria 2586
19 Ga0070658_10123150 3300005327 Bacteria 2156
20 Ga0070658_10148503 3300005327 Bacteria 1961
21 Ga0070658_10156226 3300005327 Bacteria 1912
22 Ga0070658_10207539 3300005327 Bacteria 1654
23 Ga0070676_10000844 3300005328 Bacteria 15153
24 Ga0070683_100004208 3300005329 Bacteria 11798
25 Ga0070683_100032561 3300005329 Bacteria 4747
26 Ga0070683_100063728 3300005329 Bacteria 3430
27 Ga0070683_100279421 3300005329 Bacteria 1588
28 Ga0070670_100050234 3300005331 Bacteria 3584
29 Ga0070670_100091643 3300005331 Bacteria 2613
30 Ga0070670_100359228 3300005331 Bacteria 1280
31 Ga0068869_100013397 3300005334 Bacteria 5453
32 Ga0070666_10001869 3300005335 Bacteria 12812
33 Ga0070666_10090837 3300005335 Bacteria 2097
34 Ga0070680_100019606 3300005336 Bacteria 5363
35 Ga0070680_100102505 3300005336 Bacteria 2377
36 Ga0070680_100296193 3300005336 Bacteria 1371
37 Ga0070660_100000442 3300005339 Bacteria 27575
38 Ga0070660_100000852 3300005339 Bacteria 20293
39 Ga0070660_100003475 3300005339 Bacteria 10846
40 Ga0070660_100003993 3300005339 Bacteria 10189
41 Ga0070660_100024119 3300005339 Bacteria 4512
42 Ga0070660_100040467 3300005339 Bacteria 3547
43 Ga0070660_100061132 3300005339 Bacteria 2924
44 Ga0070660_100067751 3300005339 Bacteria 2781
45 Ga0070660_100598887 3300005339 Bacteria 921
46 Ga0070660_100606538 3300005339 Bacteria 915
47 Ga0070689_100047888 3300005340 Bacteria 3296
48 Ga0070689_100436739 3300005340 Bacteria 1112
49 Ga0070691_10001625 3300005341 Bacteria 9739
50 Ga0070691_10122167 3300005341 Bacteria 1312
51 Ga0070661_100002014 3300005344 Bacteria 14053
52 Ga0070661_100005153 3300005344 Bacteria 8998
53 Ga0070661_100011009 3300005344 Bacteria 6304
54 Ga0070661_100021787 3300005344 Bacteria 4583
55 Ga0070661_100243880 3300005344 Bacteria 1384
56 Ga0070692_10007131 3300005345 Bacteria 4906
57 Ga0070692_10051361 3300005345 Bacteria 2144
58 Ga0070668_100001624 3300005347 Bacteria 16261
59 Ga0070669_100028412 3300005353 Bacteria 4028
60 Ga0070669_100032257 3300005353 Bacteria 3784
61 Ga0070669_100095080 3300005353 Bacteria 2240
62 Ga0070675_100007674 3300005354 Bacteria 8351
63 Ga0070671_100080376 3300005355 Bacteria 2726
64 Ga0070674_100005819 3300005356 Bacteria 7162
65 Ga0070673_100025408 3300005364 Bacteria 4359
66 Ga0070673_100040383 3300005364 Bacteria 3579
67 Ga0070673_100144502 3300005364 Bacteria 2010
68 Ga0070673_100155588 3300005364 Bacteria 1940
69 Ga0070659_100000562 3300005366 Bacteria 27149
70 Ga0070659_100001332 3300005366 Bacteria 17806
71 Ga0070659_100005925 3300005366 Bacteria 8811
72 Ga0070659_100021128 3300005366 Bacteria 4952
73 Ga0070659_100060147 3300005366 Bacteria 3001
74 Ga0070659_100093786 3300005366 Bacteria 2409
75 Ga0070659_100126816 3300005366 Bacteria 2071
76 Ga0070659_100351892 3300005366 Bacteria 1236
77 Ga0070667_100035587 3300005367 Bacteria 4172
78 Ga0070667_100051020 3300005367 Bacteria 3487
79 Ga0070667_100158924 3300005367 Bacteria 1989
80 Ga0070667_100176595 3300005367 Bacteria 1888
81 Ga0070667_100633021 3300005367 Bacteria 987
82 Ga0070714_100010052 3300005435 Bacteria 7465
83 Ga0070714_100038928 3300005435 Bacteria 4000
84 Ga0070714_100047071 3300005435 Bacteria 3662
85 Ga0070663_100001444 3300005455 Bacteria 13033
86 Ga0070663_100003322 3300005455 Bacteria 9274
87 Ga0070663_100054742 3300005455 Bacteria 2853
88 Ga0070663_100081880 3300005455 Bacteria 2374
89 Ga0070663_100166291 3300005455 Bacteria 1702
90 Ga0070663_100169404 3300005455 Bacteria 1687
91 Ga0070678_100398762 3300005456 Bacteria 1195
92 Ga0070662_100000517 3300005457 Bacteria 23238
93 Ga0070662_100009537 3300005457 Bacteria 6352
94 Ga0070662_100016343 3300005457 Bacteria 4982
95 Ga0070662_100214699 3300005457 Bacteria 1532
96 Ga0070662_100500004 3300005457 Bacteria 1014
97 Ga0070662_100640914 3300005457 Unclassified 896
98 Ga0070681_10006712 3300005458 Bacteria 11197
99 Ga0070681_10027941 3300005458 Bacteria 5671
100 Ga0070681_10118837 3300005458 Bacteria 2579
101 Ga0068867_100010532 3300005459 Bacteria 6524
102 Ga0070679_100075162 3300005530 Bacteria 3368
103 Ga0070679_100150717 3300005530 Bacteria 2302
104 Ga0070684_100005274 3300005535 Bacteria 9890
105 Ga0070684_100164680 3300005535 Bacteria 2012
106 Ga0068853_100002369 3300005539 Bacteria 14090
107 Ga0068853_100013398 3300005539 Bacteria 6694
108 Ga0068853_100086401 3300005539 Bacteria 2751
109 Ga0068853_100087893 3300005539 Bacteria 2728
110 Ga0068853_100112273 3300005539 Bacteria 2422
111 Ga0070672_100044303 3300005543 Bacteria 3435
112 Ga0070672_100058024 3300005543 Bacteria 3040
113 Ga0070695_100124620 3300005545 Bacteria 1768
114 Ga0070696_100020697 3300005546 Bacteria 4458
115 Ga0070693_100000698 3300005547 Bacteria 14813
116 Ga0068855_100000860 3300005563 Bacteria 37683
117 Ga0068855_100001245 3300005563 Bacteria 31618
118 Ga0068855_100006498 3300005563 Bacteria 14216
119 Ga0068855_100020508 3300005563 Bacteria 7925
120 Ga0068855_100095169 3300005563 Bacteria 3433
121 Ga0068855_100170389 3300005563 Bacteria 2466
122 Ga0068855_100213355 3300005563 Bacteria 2168
123 Ga0070664_100000609 3300005564 Bacteria 27376
124 Ga0070664_100019308 3300005564 Bacteria 5607
125 Ga0070664_100048348 3300005564 Bacteria 3595
126 Ga0070664_100065197 3300005564 Bacteria 3107
127 Ga0070664_100107333 3300005564 Bacteria 2434
128 Ga0070664_100232361 3300005564 Unclassified 1653
129 Ga0070664_100415589 3300005564 Bacteria 1231
130 Ga0068857_100010802 3300005577 Bacteria 7948
131 Ga0068857_100049166 3300005577 Bacteria 3742
132 Ga0068857_100091135 3300005577 Bacteria 2728
133 Ga0068857_100244236 3300005577 Bacteria 1644
134 Ga0068854_100004546 3300005578 Bacteria 8752
135 Ga0068854_100017678 3300005578 Bacteria 4775
136 Ga0068854_100021815 3300005578 Bacteria 4352
137 Ga0068854_100035667 3300005578 Bacteria 3483
138 Ga0068854_100067295 3300005578 Bacteria 2609
139 Ga0068856_100001106 3300005614 Bacteria 28451
140 Ga0068856_100013686 3300005614 Bacteria 7844
141 Ga0068856_100021818 3300005614 Bacteria 6223
142 Ga0068856_100073208 3300005614 Bacteria 3393
143 Ga0068856_100208385 3300005614 Bacteria 1970
144 Ga0068856_100225925 3300005614 Bacteria 1887
145 Ga0068856_100281138 3300005614 Unclassified 1681
146 Ga0068856_100334806 3300005614 Bacteria 1531
147 Ga0068856_100534295 3300005614 Bacteria 1194
148 Ga0068852_100000738 3300005616 Bacteria 21461
149 Ga0068852_100003209 3300005616 Bacteria 11419
150 Ga0068852_100010498 3300005616 Bacteria 6925
151 Ga0068852_100016299 3300005616 Bacteria 5789
152 Ga0068852_100028155 3300005616 Bacteria 4594
153 Ga0068852_100071064 3300005616 Bacteria 3055
154 Ga0068852_100471572 3300005616 Bacteria 1246
155 Ga0068859_100004262 3300005617 Bacteria 14606
156 Ga0068859_100052942 3300005617 Bacteria 4082
157 Ga0068859_100113219 3300005617 Bacteria 2777
158 Ga0068859_100644527 3300005617 Bacteria 1151
159 Ga0068864_100037532 3300005618 Bacteria 4135
160 Ga0068866_10010258 3300005718 Bacteria 4011
161 Ga0068866_10122142 3300005718 Bacteria 1469
162 Ga0068851_10009840 3300005834 Bacteria 4453
163 Ga0068863_100024184 3300005841 Bacteria 5794
164 Ga0068863_100034262 3300005841 Bacteria 4837
165 Ga0068863_100277740 3300005841 Bacteria 1622
166 Ga0068863_100355262 3300005841 Unclassified 1428
167 Ga0068863_100503974 3300005841 Bacteria 1192
168 Ga0068858_100005310 3300005842 Bacteria 12630
169 Ga0068858_100033191 3300005842 Bacteria 4792
170 Ga0068858_100460359 3300005842 Unclassified 1226
171 Ga0068860_100006525 3300005843 Bacteria 11714
172 Ga0068860_100022168 3300005843 Bacteria 6148
173 Ga0068860_100022692 3300005843 Bacteria 6067
174 Ga0068860_100103217 3300005843 Bacteria 2721
175 Ga0068860_100147886 3300005843 Bacteria 2261
176 Ga0068860_100665969 3300005843 Unclassified 1049
177 Ga0068862_100005046 3300005844 Bacteria 11103
178 Ga0068862_100018767 3300005844 Bacteria 5763
179 Ga0068862_100048971 3300005844 Bacteria 3608
180 Ga0068862_100109489 3300005844 Bacteria 2423
181 Ga0097621_100048916 3300006237 Bacteria 3433
182 Ga0097621_100090679 3300006237 Bacteria 2558
183 Ga0097621_100154520 3300006237 Bacteria 1969
184 Ga0068871_100044110 3300006358 Bacteria 3584
185 Ga0075428_100087492 3300006844 Bacteria 3399
186 Ga0075428_100353252 3300006844 Bacteria 1578
187 Ga0075433_10005530 3300006852 Bacteria 9921
188 Ga0068865_100066735 3300006881 Bacteria 2539
189 Ga0097620_100004262 3300006931 Bacteria 14606
190 Ga0097620_100052938 3300006931 Bacteria 4082
191 Ga0097620_100113220 3300006931 Bacteria 2777
192 Ga0097620_100644530 3300006931 Bacteria 1151
193 Ga0105240_10010468 3300009093 Bacteria 13036
194 Ga0105240_10047593 3300009093 Bacteria 5426
195 Ga0111539_10021300 3300009094 Bacteria 7982
196 Ga0111539_10247971 3300009094 Bacteria 2073
197 Ga0114129_10149838 3300009147 Bacteria 3193
198 Ga0105243_10892249 3300009148 Bacteria 884
199 Ga0105241_10172870 3300009174 Bacteria 1786
200 Ga0105241_10186850 3300009174 Bacteria 1723
201 Ga0105242_10111211 3300009176 Bacteria 2335
202 Ga0105248_10003929 3300009177 Bacteria 16433
203 Ga0105248_10013316 3300009177 Bacteria 9053
204 Ga0105248_10077795 3300009177 Bacteria 3729
205 Ga0105248_10629299 3300009177 Bacteria 1211
206 Ga0105237_10024621 3300009545 Bacteria 6155
207 Ga0105237_10340239 3300009545 Bacteria 1505
208 Ga0105238_10018345 3300009551 Bacteria 7121
209 Ga0105238_10032686 3300009551 Bacteria 5295
210 Ga0105238_10482333 3300009551 Bacteria 1239
211 Ga0105249_10045875 3300009553 Bacteria 3977
212 Ga0105249_10111142 3300009553 Bacteria 2591
213 Ga0105249_10327323 3300009553 Bacteria 1545
214 Ga0105239_10039727 3300010375 Bacteria 5155
215 Ga0105239_10106732 3300010375 Bacteria 3102
216 Ga0105239_10220845 3300010375 Bacteria 2125
217 Ga0105246_10129197 3300011119 Unclassified 1884
218 Ga0157373_10019515 3300013100 Bacteria 4932
219 Ga0157373_10019667 3300013100 Bacteria 4912
220 Ga0157373_10052548 3300013100 Bacteria 2899
221 Ga0157373_10080440 3300013100 Bacteria 2298
222 Ga0157373_10246038 3300013100 Bacteria 1264
223 Ga0157371_10002006 3300013102 Bacteria 20133
224 Ga0157371_10003298 3300013102 Bacteria 14771
225 Ga0157371_10077595 3300013102 Bacteria 2352
226 Ga0157371_10153199 3300013102 Bacteria 1644
227 Ga0157370_10020968 3300013104 Bacteria 6517
228 Ga0157370_10026825 3300013104 Bacteria 5683
229 Ga0157370_10035761 3300013104 Bacteria 4825
230 Ga0157370_10236549 3300013104 Bacteria 1690
231 Ga0157370_10347223 3300013104 Bacteria 1368
232 Ga0157370_10434068 3300013104 Bacteria 1208
233 Ga0157370_10594021 3300013104 Bacteria 1014
234 Ga0157370_10761185 3300013104 Bacteria 882
235 Ga0157369_10000213 3300013105 Bacteria 80715
236 Ga0157369_10026269 3300013105 Bacteria 6461
237 Ga0157369_10032758 3300013105 Bacteria 5711
238 Ga0157369_10064308 3300013105 Bacteria 3951
239 Ga0157369_10064372 3300013105 Bacteria 3949
240 Ga0157369_10081026 3300013105 Bacteria 3474
241 Ga0157369_10195922 3300013105 Bacteria 2122
242 Ga0157372_10007219 3300013307 Bacteria 11830
243 Ga0157372_10137707 3300013307 Bacteria 2812
244 Ga0157372_10279675 3300013307 Unclassified 1940
245 Ga0157372_10355401 3300013307 Bacteria 1707
246 Ga0157372_10760430 3300013307 Bacteria 1126
247 Ga0157375_10115659 3300013308 Bacteria 2785
248 Ga0157375_10279009 3300013308 Bacteria 1834
249 Ga0163163_10019596 3300014325 Bacteria 6354
250 Ga0163163_10029533 3300014325 Bacteria 5275
251 Ga0163163_10034454 3300014325 Bacteria 4904
252 Ga0157377_10032193 3300014745 Bacteria 2854
253 Ga0157377_10153415 3300014745 Bacteria 1426
254 Ga0157379_10064767 3300014968 Bacteria 3266
255 Ga0157379_10140765 3300014968 Bacteria 2175
256 Ga0157379_10779418 3300014968 Bacteria 901
257 Ga0157376_10008878 3300014969 Bacteria 7275
258 Ga0163161_10036353 3300017792 Bacteria 3527
259 Ga0163161_10363566 3300017792 Bacteria 1153
260 Ga0213875_10002686 3300021388 Bacteria 10496
261 Ga0224712_10006016 3300022467 Bacteria 3428
262 Ga0207697_10042232 3300025315 Bacteria 1873
263 Ga0207697_10046998 3300025315 Bacteria 1779
264 Ga0207656_10189642 3300025321 Bacteria 989
265 Ga0207642_10158414 3300025899 Bacteria 1213
266 Ga0207642_10342355 3300025899 Bacteria 879
267 Ga0207688_10124724 3300025901 Bacteria 1505
268 Ga0207680_10007304 3300025903 Bacteria 5378
269 Ga0207680_10292101 3300025903 Bacteria 1135
270 Ga0207647_10001074 3300025904 Bacteria 21074
271 Ga0207647_10007658 3300025904 Bacteria 7783
272 Ga0207647_10010181 3300025904 Bacteria 6646
273 Ga0207647_10028550 3300025904 Bacteria 3621
274 Ga0207647_10037564 3300025904 Bacteria 3069
275 Ga0207647_10061924 3300025904 Bacteria 2281
276 Ga0207647_10136350 3300025904 Bacteria 1440
277 Ga0207647_10139118 3300025904 Bacteria 1423
278 Ga0207645_10002872 3300025907 Bacteria 13336
279 Ga0207645_10021417 3300025907 Bacteria 4215
280 Ga0207645_10058455 3300025907 Bacteria 2462
281 Ga0207705_10001214 3300025909 Bacteria 20873
282 Ga0207705_10002368 3300025909 Bacteria 14572
283 Ga0207705_10017404 3300025909 Bacteria 5148
284 Ga0207705_10020215 3300025909 Bacteria 4762
285 Ga0207705_10020627 3300025909 Bacteria 4705
286 Ga0207705_10024090 3300025909 Bacteria 4343
287 Ga0207705_10030128 3300025909 Bacteria 3870
288 Ga0207705_10059327 3300025909 Bacteria 2761
289 Ga0207705_10099561 3300025909 Bacteria 2137
290 Ga0207705_10129899 3300025909 Unclassified 1874
291 Ga0207705_10153741 3300025909 Bacteria 1725
292 Ga0207705_10167832 3300025909 Bacteria 1651
293 Ga0207705_10232687 3300025909 Bacteria 1402
294 Ga0207705_10288038 3300025909 Bacteria 1258
295 Ga0207654_10027334 3300025911 Bacteria 3100
296 Ga0207707_10008385 3300025912 Bacteria 8968
297 Ga0207695_10013682 3300025913 Bacteria 9659
298 Ga0207695_10017532 3300025913 Bacteria 8328
299 Ga0207671_10054465 3300025914 Bacteria 2964
300 Ga0207660_10004911 3300025917 Bacteria 8709
301 Ga0207660_10210578 3300025917 Bacteria 1522
302 Ga0207662_10138279 3300025918 Bacteria 1541
303 Ga0207657_10001247 3300025919 Bacteria 27200
304 Ga0207657_10002236 3300025919 Bacteria 20990
305 Ga0207657_10002430 3300025919 Bacteria 20114
306 Ga0207657_10003232 3300025919 Bacteria 17438
307 Ga0207657_10010524 3300025919 Bacteria 9224
308 Ga0207657_10015442 3300025919 Bacteria 7398
309 Ga0207657_10018639 3300025919 Bacteria 6617
310 Ga0207657_10020641 3300025919 Bacteria 6220
311 Ga0207657_10028856 3300025919 Bacteria 5056
312 Ga0207657_10036391 3300025919 Bacteria 4406
313 Ga0207657_10331216 3300025919 Bacteria 1202
314 Ga0207649_10000609 3300025920 Bacteria 24164
315 Ga0207649_10000647 3300025920 Bacteria 23229
316 Ga0207649_10007796 3300025920 Bacteria 5824
317 Ga0207649_10008776 3300025920 Bacteria 5517
318 Ga0207649_10020707 3300025920 Bacteria 3774
319 Ga0207649_10027575 3300025920 Bacteria 3334
320 Ga0207649_10029742 3300025920 Bacteria 3228
321 Ga0207649_10089167 3300025920 Bacteria 2016
322 Ga0207649_10658121 3300025920 Bacteria 810
323 Ga0207652_10088360 3300025921 Bacteria 2719
324 Ga0207681_10022979 3300025923 Bacteria 3982
325 Ga0207681_10094032 3300025923 Bacteria 2147
326 Ga0207681_10199614 3300025923 Bacteria 1535
327 Ga0207694_10002362 3300025924 Bacteria 15426
328 Ga0207650_10008694 3300025925 Bacteria 6932
329 Ga0207650_10316094 3300025925 Bacteria 1278
330 Ga0207659_10013978 3300025926 Bacteria 5165
331 Ga0207664_10083139 3300025929 Bacteria 2609
332 Ga0207664_10100330 3300025929 Bacteria 2390
333 Ga0207644_10038322 3300025931 Bacteria 3376
334 Ga0207690_10000614 3300025932 Bacteria 23026
335 Ga0207690_10004774 3300025932 Bacteria 7992
336 Ga0207690_10005086 3300025932 Bacteria 7768
337 Ga0207690_10020996 3300025932 Bacteria 4045
338 Ga0207690_10024846 3300025932 Bacteria 3756
339 Ga0207690_10041290 3300025932 Bacteria 3022
340 Ga0207690_10062818 3300025932 Bacteria 2530
341 Ga0207690_10070101 3300025932 Bacteria 2414
342 Ga0207690_10200781 3300025932 Bacteria 1514
343 Ga0207690_10489928 3300025932 Bacteria 993
344 Ga0207706_10000862 3300025933 Bacteria 31208
345 Ga0207706_10007589 3300025933 Bacteria 10033
346 Ga0207706_10024926 3300025933 Bacteria 5362
347 Ga0207706_10033765 3300025933 Bacteria 4553
348 Ga0207706_10116236 3300025933 Bacteria 2353
349 Ga0207669_10004190 3300025937 Bacteria 6322
350 Ga0207704_10014589 3300025938 Bacteria 3972
351 Ga0207691_10012508 3300025940 Bacteria 8136
352 Ga0207691_10116513 3300025940 Bacteria 2371
353 Ga0207691_10146298 3300025940 Bacteria 2080
354 Ga0207691_10215694 3300025940 Bacteria 1665
355 Ga0207691_10357101 3300025940 Bacteria 1250
356 Ga0207711_10001010 3300025941 Bacteria 26975
357 Ga0207711_10005718 3300025941 Bacteria 10492
358 Ga0207711_10314175 3300025941 Bacteria 1447
359 Ga0207689_10147227 3300025942 Bacteria 1940
360 Ga0207661_10024940 3300025944 Bacteria 4540
361 Ga0207661_10288568 3300025944 Bacteria 1468
362 Ga0207679_10000410 3300025945 Bacteria 30698
363 Ga0207679_10004536 3300025945 Bacteria 8651
364 Ga0207679_10004905 3300025945 Bacteria 8340
365 Ga0207679_10025323 3300025945 Bacteria 4078
366 Ga0207679_10034412 3300025945 Bacteria 3574
367 Ga0207679_10050055 3300025945 Bacteria 3051
368 Ga0207679_10314650 3300025945 Unclassified 1354
369 Ga0207667_10010674 3300025949 Bacteria 10720
370 Ga0207667_10017086 3300025949 Bacteria 8181
371 Ga0207667_10018840 3300025949 Bacteria 7728
372 Ga0207667_10111446 3300025949 Bacteria 2822
373 Ga0207667_10233779 3300025949 Bacteria 1882
374 Ga0207651_10055442 3300025960 Bacteria 2722
375 Ga0207651_10182940 3300025960 Bacteria 1664
376 Ga0207712_10001750 3300025961 Bacteria 14499
377 Ga0207712_10110152 3300025961 Bacteria 2064
378 Ga0207712_10761407 3300025961 Unclassified 849
379 Ga0207668_10000281 3300025972 Bacteria 33444
380 Ga0207668_10204772 3300025972 Bacteria 1574
381 Ga0207640_10004228 3300025981 Bacteria 7768
382 Ga0207640_10013237 3300025981 Bacteria 4723
383 Ga0207640_10023817 3300025981 Bacteria 3685
384 Ga0207640_10024044 3300025981 Bacteria 3670
385 Ga0207640_10102653 3300025981 Bacteria 2009
386 Ga0207640_10117933 3300025981 Bacteria 1895
387 Ga0207658_10006330 3300025986 Bacteria 8083
388 Ga0207658_10030150 3300025986 Bacteria 3838
389 Ga0207658_10062898 3300025986 Bacteria 2779
390 Ga0207658_10528371 3300025986 Bacteria 1053
391 Ga0207677_10249592 3300026023 Bacteria 1440
392 Ga0207639_10000559 3300026041 Bacteria 25570
393 Ga0207639_10000810 3300026041 Bacteria 21238
394 Ga0207639_10097795 3300026041 Bacteria 2364
395 Ga0207639_10122256 3300026041 Bacteria 2140
396 Ga0207678_10001544 3300026067 Bacteria 21123
397 Ga0207678_10004968 3300026067 Bacteria 11935
398 Ga0207678_10008333 3300026067 Bacteria 9137
399 Ga0207678_10028774 3300026067 Bacteria 4851
400 Ga0207678_10030479 3300026067 Bacteria 4708
401 Ga0207678_10036802 3300026067 Bacteria 4260
402 Ga0207678_10037554 3300026067 Bacteria 4212
403 Ga0207678_10060426 3300026067 Bacteria 3260
404 Ga0207702_10001481 3300026078 Bacteria 23260
405 Ga0207702_10004991 3300026078 Bacteria 11657
406 Ga0207702_10016055 3300026078 Bacteria 6200
407 Ga0207702_10029543 3300026078 Bacteria 4562
408 Ga0207702_10056453 3300026078 Bacteria 3334
409 Ga0207702_10066637 3300026078 Bacteria 3087
410 Ga0207702_10071331 3300026078 Bacteria 2991
411 Ga0207702_10315225 3300026078 Bacteria 1488
412 Ga0207641_10027877 3300026088 Bacteria 4665
413 Ga0207641_10117368 3300026088 Bacteria 2369
414 Ga0207648_10014655 3300026089 Bacteria 7238
415 Ga0207676_10083926 3300026095 Bacteria 2595
416 Ga0207674_10002478 3300026116 Bacteria 23285
417 Ga0207674_10003401 3300026116 Bacteria 19514
418 Ga0207674_10015606 3300026116 Bacteria 8338
419 Ga0207674_10142777 3300026116 Bacteria 2353
420 Ga0207674_10182513 3300026116 Bacteria 2050
421 Ga0207674_10187407 3300026116 Bacteria 2019
422 Ga0207683_10014890 3300026121 Bacteria 6620
423 Ga0207683_10048317 3300026121 Bacteria 3726
424 Ga0207683_10063547 3300026121 Bacteria 3252
425 Ga0207698_10002979 3300026142 Bacteria 10149
426 Ga0207698_10010517 3300026142 Bacteria 5953
427 Ga0207698_10030678 3300026142 Bacteria 3870
428 Ga0207698_10032434 3300026142 Bacteria 3784
429 Ga0207698_10098883 3300026142 Bacteria 2412
430 Ga0207698_10138579 3300026142 Bacteria 2092
431 Ga0207698_10421929 3300026142 Bacteria 1280
432 Ga0268266_10030760 3300028379 Bacteria 4560
433 Ga0268265_10008286 3300028380 Bacteria 7021
434 Ga0268265_10008905 3300028380 Bacteria 6783
435 Ga0268265_10020028 3300028380 Bacteria 4662
436 Ga0268265_10049567 3300028380 Bacteria 3159
437 Ga0268265_10571021 3300028380 Viruses 1076
438 Ga0268265_10886885 3300028380 Bacteria 875
439 Ga0268264_10001669 3300028381 Bacteria 20437
440 Ga0268264_10002107 3300028381 Bacteria 17736
441 Ga0268264_10088773 3300028381 Bacteria 2661
442 Ga0268264_10103969 3300028381 Bacteria 2475
443 Ga0268264_10884468 3300028381 Bacteria 896
444 Ga0316182_1064693 3300030745 Bacteria 1923
445 Ga0307513_10300636 3300031456 Bacteria 1372
446 Ga0307408_100056804 3300031548 Bacteria 2839
447 Ga0307408_100488907 3300031548 Unclassified 1075
448 Ga0307405_10097566 3300031731 Bacteria 1963
449 Ga0307413_10242292 3300031824 Bacteria 1332
450 Ga0307410_10000497 3300031852 Bacteria 15987
451 Ga0307410_10004834 3300031852 Bacteria 7038
452 Ga0307410_10548036 3300031852 Bacteria 958
453 Ga0307406_10034965 3300031901 Bacteria 3086
454 Ga0307407_10060161 3300031903 Bacteria 2216
455 Ga0307407_10081135 3300031903 Unclassified 1962
456 Ga0307412_10140319 3300031911 Bacteria 1769
457 Ga0307412_10172572 3300031911 Bacteria 1618
458 Ga0307409_100005023 3300031995 Bacteria 7537
459 Ga0307409_100023796 3300031995 Bacteria 4254
460 Ga0307409_100056326 3300031995 Bacteria 3039
461 Ga0307416_100207293 3300032002 Bacteria 1866
462 Ga0307416_100694729 3300032002 Bacteria 1106
463 Ga0307416_100839658 3300032002 Bacteria 1016
464 Ga0307414_10043247 3300032004 Bacteria 3067
465 Ga0307414_10203662 3300032004 Bacteria 1612
466 Ga0307411_10010086 3300032005 Bacteria 5014
467 Ga0307411_10014648 3300032005 Bacteria 4372
468 Ga0307411_10030736 3300032005 Bacteria 3296
469 Ga0307411_10223975 3300032005 Bacteria 1461
470 Ga0307415_100048132 3300032126 Bacteria 2875
471 Ga0307415_100088732 3300032126 Bacteria 2232
472 Ga0307415_100247511 3300032126 Bacteria 1446
473 Ga0307415_100268999 3300032126 Bacteria 1395
474 Ga0307415_100383596 3300032126 Bacteria 1194
475 Ga0373959_0020634 3300034820 Bacteria 1258
476 Ga0373931_0006935 3300035691 Bacteria 5330
477 Ga0373935_0411513 3300035692 Bacteria 972
478 Ga0373927_0044621 3300035695 Bacteria 2868
479 Ga0373947_0020526 3300035725 Bacteria 3815
480 Ga0395899_0002597 3300037312 Bacteria 14556
481 Ga0395899_0012036 3300037312 Bacteria 6629
482 Ga0395899_0012049 3300037312 Bacteria 6627
483 Ga0395899_0145790 3300037312 Bacteria 1681
484 Ga0395899_0172296 3300037312 Bacteria 1523
485 Ga0395899_0172852 3300037312 Bacteria 1520
486 Ga0395899_0184350 3300037312 Bacteria 1463
487 Ga0395899_0188507 3300037312 Bacteria 1444
488 Ga0395899_0213090 3300037312 Bacteria 1341
489 Ga0395899_0263291 3300037312 Bacteria 1178
490 Ga0395900_0000777 3300037418 Bacteria 42484
491 Ga0395900_0003388 3300037418 Bacteria 17216
492 Ga0395900_0006010 3300037418 Bacteria 12663
493 Ga0395900_0008568 3300037418 Bacteria 10513
494 Ga0395900_0017042 3300037418 Bacteria 7417
495 Ga0395900_0027310 3300037418 Bacteria 5845
496 Ga0395900_0039722 3300037418 Bacteria 4848
497 Ga0395900_0045115 3300037418 Bacteria 4540
498 Ga0395900_0098367 3300037418 Bacteria 3006
499 Ga0395900_0142029 3300037418 Bacteria 2458
500 Ga0395900_0159697 3300037418 Bacteria 2300
501 Ga0395900_0214946 3300037418 Bacteria 1940
502 Ga0395900_0287889 3300037418 Bacteria 1632
503 Ga0395900_0353482 3300037418 Bacteria 1442
504 Ga0395900_0353494 3300037418 Bacteria 1442
505 Ga0395898_0016194 3300037466 Bacteria 7635
506 Ga0395898_0016372 3300037466 Bacteria 7587
507 Ga0395898_0021176 3300037466 Bacteria 6596
508 Ga0395898_0136755 3300037466 Bacteria 2346
509 Ga0395898_0217299 3300037466 Bacteria 1823
510 Ga0395898_0284049 3300037466 Bacteria 1579
511 Ga0395898_0335171 3300037466 Bacteria 1442
512 Ga0395898_0340154 3300037466 Bacteria 1431
513 Ga0395898_0403397 3300037466 Bacteria 1303
514 Ga0395898_0442312 3300037466 Bacteria 1238
515 Ga0395898_0454356 3300037466 Bacteria 1220
516 Ga0395898_0472188 3300037466 Bacteria 1194
517 Ga0395898_0561431 3300037466 Unclassified 1084
518 Ga0395898_0838705 3300037466 Unclassified 859
519 Ga0395898_1069160 3300037466 Unclassified 741
520 Ga0395905_0001949 3300037471 Bacteria 23650
521 Ga0395905_0010016 3300037471 Bacteria 9238
522 Ga0395905_0038240 3300037471 Bacteria 4502
523 Ga0395905_0047223 3300037471 Bacteria 4036
524 Ga0395905_0048004 3300037471 Bacteria 4001
525 Ga0395905_0208844 3300037471 Bacteria 1830
526 Ga0395905_0322114 3300037471 Bacteria 1435
527 Ga0395905_0385345 3300037471 Bacteria 1296
528 Ga0395905_0821345 3300037471 Bacteria 832
529 Ga0436364_0920172 3300037853 Bacteria 27253
530 Ga0395901_0000260 3300038443 Bacteria 66084
531 Ga0395901_0000440 3300038443 Bacteria 48641
532 Ga0395901_0009148 3300038443 Bacteria 10034
533 Ga0395901_0019723 3300038443 Bacteria 6893
534 Ga0395901_0021910 3300038443 Bacteria 6549
535 Ga0395901_0030900 3300038443 Bacteria 5519
536 Ga0395901_0038690 3300038443 Bacteria 4934
537 Ga0395901_0043715 3300038443 Bacteria 4646
538 Ga0395901_0054623 3300038443 Bacteria 4151
539 Ga0395901_0181580 3300038443 Bacteria 2207
540 Ga0395901_0182007 3300038443 Bacteria 2204
541 Ga0395901_0204780 3300038443 Bacteria 2067
542 Ga0395901_0210770 3300038443 Bacteria 2034
543 Ga0395901_0303054 3300038443 Bacteria 1656
544 Ga0395901_0324728 3300038443 Bacteria 1592
545 Ga0395901_0489369 3300038443 Bacteria 1253
546 Ga0395901_0489397 3300038443 Bacteria 1253
547 Ga0395901_1140465 3300038443 Bacteria 748
548 Ga0439436_0031558 3300041404 Bacteria 1538
549 Ga0439439_0103608 3300041406 Bacteria 785
550 Ga0439455_0037464 3300042012 Bacteria 1230
551 Ga0450898_020400 3300042134 Bacteria 1161
552 Ga0450905_003095 3300042142 Bacteria 2172
553 Ga0466969_0007721 3300044656 Bacteria 5719
554 Ga0466966_0004035 3300044684 Bacteria 9695
555 Ga0466961_0008379 3300044693 Bacteria 6583
556 Ga0466963_0008103 3300044694 Bacteria 6292
557 Ga0466963_0011384 3300044694 Bacteria 5416
558 Ga0466963_0013712 3300044694 Bacteria 4984
559 Ga0466963_0032077 3300044694 Bacteria 3399
560 Ga0466963_0041559 3300044694 Bacteria 3016
561 Ga0466963_0049002 3300044694 Bacteria 2792
562 Ga0466964_0053997 3300044706 Bacteria 1655
563 Ga0466971_0015072 3300044719 Bacteria 3400
564 Ga0466971_0030755 3300044719 Bacteria 2403
565 Ga0466970_0001410 3300044765 Bacteria 11620
566 Ga0466957_0000119 3300044842 Bacteria 32814
567 Ga0466957_0008553 3300044842 Bacteria 5825
568 Ga0466957_0013148 3300044842 Bacteria 4799
569 Ga0466957_0021041 3300044842 Bacteria 3840
570 Ga0466957_0025502 3300044842 Bacteria 3505
571 Ga0466957_0028622 3300044842 Bacteria 3318
572 Ga0466957_0100659 3300044842 Bacteria 1821
573 Ga0466958_0001880 3300045836 Bacteria 10259
574 Ga0466958_0010624 3300045836 Bacteria 5161
575 Ga0466958_0014058 3300045836 Bacteria 4566
576 Ga0466967_0012381 3300045976 Bacteria 6521
577 Ga0466967_0014248 3300045976 Bacteria 6185
578 Ga0466967_0043397 3300045976 Bacteria 3893
579 Ga0466967_0044392 3300045976 Bacteria 3855
580 Ga0466967_0100831 3300045976 Bacteria 2638
581 Ga0466967_0116142 3300045976 Bacteria 2465
582 Ga0466967_0177754 3300045976 Bacteria 2005
583 Ga0466967_0346008 3300045976 Bacteria 1438
584 Ga0466967_0380745 3300045976 Bacteria 1370
585 Ga0466967_0576987 3300045976 Bacteria 1108
586 Ga0466967_0596897 3300045976 Bacteria 1090
587 Ga0466967_0940675 3300045976 Bacteria 860
588 Ga0495668_0004735 3300046616 Bacteria 9531
589 Ga0495625_0142714 3300046660 Bacteria 1615
590 Ga0495669_0023707 3300046684 Bacteria 2673
591 Ga0495669_0025964 3300046684 Bacteria 2558
592 Ga0495677_0084672 3300047445 Bacteria 1191
593 Ga0496107_0424944 3300048910 Bacteria 988
594 Ga0496107_0463200 3300048910 Bacteria 941
595 Ga0496109_0228285 3300048912 Bacteria 1751
596 Ga0496109_0875459 3300048912 Unclassified 836
597 Ga0496112_0379706 3300048915 Bacteria 1354
598 Ga0501067_0067887 3300049583 Bacteria 1974
599 Ga0501068_0077224 3300049584 Bacteria 2039
600 Ga0501069_0087184 3300049585 Bacteria 1763
601 Ga0501070_0012968 3300049586 Bacteria 7025
602 nmdc:mga08y16_230136_c1 3300050511 Bacteria 1917
603 nmdc:mga0n895_76452_c1 3300050512 Bacteria 3329
604 nmdc:mga0a205_14292_c1 3300050515 Bacteria 7403
605 Ga0500658_0000023 3300053134 Bacteria 123176
606 Ga0466962_0005903 3300061719 Bacteria 5883
607 Ga0466962_0008845 3300061719 Bacteria 4826

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005564 Ga0070664_100415589 Ga0070664_1004155892 198
2 3300025945 Ga0207679_10004536 Ga0207679_1000453610 198
3 3300037471 Ga0395905_0821345 Ga0395905_0821345_203_814 203
4 3300001990 JGI24737J22298_10013258 JGI24737J22298_100132582 206
5 3300002067 JGI24735J21928_10010863 JGI24735J21928_100108632 206
6 3300005339 Ga0070660_100598887 Ga0070660_1005988871 206
7 3300005614 Ga0068856_100208385 Ga0068856_1002083852 206
8 3300025909 Ga0207705_10129899 Ga0207705_101298992 206
9 3300025919 Ga0207657_10020641 Ga0207657_100206412 206
10 3300037418 Ga0395900_0027310 Ga0395900_0027310_4585_5205 206
11 3300037466 Ga0395898_0561431 Ga0395898_0561431_145_765 206
12 3300038443 Ga0395901_0204780 Ga0395901_0204780_1159_1779 206
13 3300025321 Ga0207656_10189642 Ga0207656_101896422 210
14 3300025904 Ga0207647_10139118 Ga0207647_101391182 210
15 3300025909 Ga0207705_10153741 Ga0207705_101537412 210
16 3300025919 Ga0207657_10036391 Ga0207657_100363912 210
17 3300025920 Ga0207649_10029742 Ga0207649_100297423 210
18 3300025932 Ga0207690_10200781 Ga0207690_102007812 210
19 3300025981 Ga0207640_10117933 Ga0207640_101179332 210
20 3300026067 Ga0207678_10030479 Ga0207678_100304793 210
21 3300026078 Ga0207702_10066637 Ga0207702_100666373 210
22 3300026142 Ga0207698_10421929 Ga0207698_104219292 210
23 3300037853 Ga0436364_0920172 Ga0436364_0920172_4821_5465 210
24 3300038443 Ga0395901_0210770 Ga0395901_0210770_1241_1966 210
25 3300045976 Ga0466967_0940675 Ga0466967_0940675_55_780 210
26 3300046616 Ga0495668_0004735 Ga0495668_0004735_3279_3911 210
27 3300053134 Ga0500658_0000023 Ga0500658_0000023_36124_36756 210
28 3300026078 Ga0207702_10315225 Ga0207702_103152252 211
29 3300005366 Ga0070659_100093786 Ga0070659_1000937861 212
30 3300005545 Ga0070695_100124620 Ga0070695_1001246202 212
31 3300005546 Ga0070696_100020697 Ga0070696_1000206972 212
32 3300009094 Ga0111539_10021300 Ga0111539_100213007 212
33 3300009147 Ga0114129_10149838 Ga0114129_101498382 212
34 3300042142 Ga0450905_003095 Ga0450905_003095_832_1545 212
35 3300050511 nmdc:mga08y16_230136_c1 nmdc:mga08y16_230136_c1_370_1083 212
36 3300010375 Ga0105239_10220845 Ga0105239_102208452 214
37 3300013104 Ga0157370_10761185 Ga0157370_107611852 214
38 3300013105 Ga0157369_10000213 Ga0157369_1000021345 214
39 3300013307 Ga0157372_10137707 Ga0157372_101377072 214
40 3300013307 Ga0157372_10355401 Ga0157372_103554013 214
41 3300026078 Ga0207702_10029543 Ga0207702_100295436 214
42 3300045976 Ga0466967_0012381 Ga0466967_0012381_1821_2549 214
43 3300005614 Ga0068856_100021818 Ga0068856_1000218182 215
44 3300005616 Ga0068852_100471572 Ga0068852_1004715722 215
45 3300013102 Ga0157371_10077595 Ga0157371_100775953 215
46 3300013104 Ga0157370_10347223 Ga0157370_103472232 215
47 3300013105 Ga0157369_10081026 Ga0157369_100810264 215
48 3300025949 Ga0207667_10233779 Ga0207667_102337792 215
49 3300002067 JGI24735J21928_10029852 JGI24735J21928_100298523 216
50 3300005327 Ga0070658_10085988 Ga0070658_100859883 216
51 3300005329 Ga0070683_100032561 Ga0070683_1000325612 216
52 3300005336 Ga0070680_100296193 Ga0070680_1002961931 216
53 3300005339 Ga0070660_100606538 Ga0070660_1006065381 216
54 3300005341 Ga0070691_10001625 Ga0070691_1000162510 216
55 3300005344 Ga0070661_100243880 Ga0070661_1002438801 216
56 3300005455 Ga0070663_100169404 Ga0070663_1001694042 216
57 3300005535 Ga0070684_100164680 Ga0070684_1001646802 216
58 3300005539 Ga0068853_100112273 Ga0068853_1001122732 216
59 3300005564 Ga0070664_100065197 Ga0070664_1000651972 216
60 3300005578 Ga0068854_100004546 Ga0068854_1000045469 216
61 3300005614 Ga0068856_100334806 Ga0068856_1003348062 216
62 3300005616 Ga0068852_100071064 Ga0068852_1000710641 216
63 3300005834 Ga0068851_10009840 Ga0068851_100098405 216
64 3300009545 Ga0105237_10340239 Ga0105237_103402392 216
65 3300013100 Ga0157373_10080440 Ga0157373_100804402 216
66 3300025909 Ga0207705_10030128 Ga0207705_100301283 216
67 3300046660 Ga0495625_0142714 Ga0495625_0142714_109_759 216
68 3300046684 Ga0495669_0023707 Ga0495669_0023707_1586_2236 216
69 3300048912 Ga0496109_0875459 Ga0496109_0875459_102_821 216
70 3300005327 Ga0070658_10040656 Ga0070658_100406562 217
71 3300013102 Ga0157371_10153199 Ga0157371_101531992 217
72 3300025909 Ga0207705_10059327 Ga0207705_100593272 217
73 3300005578 Ga0068854_100017678 Ga0068854_1000176783 218
74 3300009093 Ga0105240_10010468 Ga0105240_1001046812 218
75 3300013104 Ga0157370_10035761 Ga0157370_100357612 218
76 3300013105 Ga0157369_10064308 Ga0157369_100643082 218
77 3300025913 Ga0207695_10013682 Ga0207695_100136829 218
78 3300025981 Ga0207640_10013237 Ga0207640_100132371 218
79 3300032005 Ga0307411_10223975 Ga0307411_102239752 218
80 3300037312 Ga0395899_0012049 Ga0395899_0012049_2306_3025 218
81 3300037466 Ga0395898_0340154 Ga0395898_0340154_24_743 218
82 3300025920 Ga0207649_10658121 Ga0207649_106581211 219
83 3300037418 Ga0395900_0039722 Ga0395900_0039722_1664_2389 219
84 3300005353 Ga0070669_100095080 Ga0070669_1000950802 220
85 3300005354 Ga0070675_100007674 Ga0070675_1000076745 220
86 3300005364 Ga0070673_100144502 Ga0070673_1001445022 220
87 3300005366 Ga0070659_100126816 Ga0070659_1001268162 220
88 3300005578 Ga0068854_100021815 Ga0068854_1000218153 220
89 3300022467 Ga0224712_10006016 Ga0224712_100060163 220
90 3300025899 Ga0207642_10342355 Ga0207642_103423551 220
91 3300025919 Ga0207657_10010524 Ga0207657_1001052412 220
92 3300025920 Ga0207649_10000609 Ga0207649_1000060919 220
93 3300025929 Ga0207664_10083139 Ga0207664_100831392 220
94 3300025932 Ga0207690_10024846 Ga0207690_100248463 220
95 3300025933 Ga0207706_10116236 Ga0207706_101162362 220
96 3300025940 Ga0207691_10146298 Ga0207691_101462982 220
97 3300025981 Ga0207640_10004228 Ga0207640_100042284 220
98 3300026067 Ga0207678_10004968 Ga0207678_100049688 220
99 3300026078 Ga0207702_10016055 Ga0207702_100160553 220
100 3300026116 Ga0207674_10187407 Ga0207674_101874072 220
101 3300026142 Ga0207698_10098883 Ga0207698_100988833 220
102 3300037312 Ga0395899_0145790 Ga0395899_0145790_109_771 220
103 3300037418 Ga0395900_0287889 Ga0395900_0287889_548_1210 220
104 3300037466 Ga0395898_0136755 Ga0395898_0136755_548_1210 220
105 3300037466 Ga0395898_1069160 Ga0395898_1069160_32_694 220
106 3300038443 Ga0395901_0303054 Ga0395901_0303054_410_1072 220
107 3300038443 Ga0395901_1140465 Ga0395901_1140465_74_736 220
108 3300044694 Ga0466963_0032077 Ga0466963_0032077_1574_2236 220
109 3300045976 Ga0466967_0380745 Ga0466967_0380745_522_1184 220
110 3300005327 Ga0070658_10148503 Ga0070658_101485032 221
111 3300005339 Ga0070660_100061132 Ga0070660_1000611322 221
112 3300006237 Ga0097621_100154520 Ga0097621_1001545203 221
113 3300028380 Ga0268265_10886885 Ga0268265_108868852 221
114 3300037418 Ga0395900_0159697 Ga0395900_0159697_402_1127 221
115 3300044719 Ga0466971_0015072 Ga0466971_0015072_345_1070 221
116 3300044842 Ga0466957_0028622 Ga0466957_0028622_1195_1920 221
117 3300045836 Ga0466958_0014058 Ga0466958_0014058_518_1243 221
118 3300005435 Ga0070714_100047071 Ga0070714_1000470712 222
119 3300005339 Ga0070660_100000852 Ga0070660_10000085217 223
120 3300005455 Ga0070663_100166291 Ga0070663_1001662912 223
121 3300005563 Ga0068855_100000860 Ga0068855_10000086014 223
122 3300021388 Ga0213875_10002686 Ga0213875_100026867 223
123 3300025904 Ga0207647_10037564 Ga0207647_100375643 223
124 3300025907 Ga0207645_10058455 Ga0207645_100584552 223
125 3300025909 Ga0207705_10001214 Ga0207705_100012149 223
126 3300025909 Ga0207705_10167832 Ga0207705_101678322 223
127 3300025919 Ga0207657_10003232 Ga0207657_1000323221 223
128 3300025949 Ga0207667_10111446 Ga0207667_101114463 223
129 3300026067 Ga0207678_10036802 Ga0207678_100368024 223
130 3300045976 Ga0466967_0596897 Ga0466967_0596897_298_969 223
131 3300047445 Ga0495677_0084672 Ga0495677_0084672_238_963 223
132 3300005435 Ga0070714_100010052 Ga0070714_1000100522 224
133 3300013102 Ga0157371_10003298 Ga0157371_100032982 224
134 3300013104 Ga0157370_10236549 Ga0157370_102365493 224
135 3300037312 Ga0395899_0184350 Ga0395899_0184350_687_1400 225
136 3300002067 JGI24735J21928_10011066 JGI24735J21928_100110661 227
137 3300005329 Ga0070683_100279421 Ga0070683_1002794212 227
138 3300005457 Ga0070662_100214699 Ga0070662_1002146992 227
139 3300005563 Ga0068855_100170389 Ga0068855_1001703893 227
140 3300005578 Ga0068854_100067295 Ga0068854_1000672952 227
141 3300025901 Ga0207688_10124724 Ga0207688_101247241 227
142 3300025917 Ga0207660_10004911 Ga0207660_100049112 227
143 3300025944 Ga0207661_10288568 Ga0207661_102885682 227
144 3300026067 Ga0207678_10060426 Ga0207678_100604262 227
145 3300026116 Ga0207674_10182513 Ga0207674_101825132 227
146 3300041404 Ga0439436_0031558 Ga0439436_0031558_347_1030 227
147 3300041406 Ga0439439_0103608 Ga0439439_0103608_59_742 227
148 3300005564 Ga0070664_100048348 Ga0070664_1000483482 228
149 3300005614 Ga0068856_100534295 Ga0068856_1005342951 228
150 3300025315 Ga0207697_10046998 Ga0207697_100469982 228
151 3300025926 Ga0207659_10013978 Ga0207659_100139782 228
152 3300025932 Ga0207690_10020996 Ga0207690_100209964 228
153 3300025945 Ga0207679_10034412 Ga0207679_100344123 228
154 3300025960 Ga0207651_10182940 Ga0207651_101829402 228
155 3300037312 Ga0395899_0263291 Ga0395899_0263291_290_976 228
156 3300037466 Ga0395898_0838705 Ga0395898_0838705_130_816 228
157 3300009094 Ga0111539_10247971 Ga0111539_102479712 229
158 3300013105 Ga0157369_10195922 Ga0157369_101959223 229
159 3300031548 Ga0307408_100488907 Ga0307408_1004889072 229
160 3300037471 Ga0395905_0385345 Ga0395905_0385345_241_930 229
161 3300038443 Ga0395901_0324728 Ga0395901_0324728_63_752 229
162 3300001979 JGI24740J21852_10034876 JGI24740J21852_100348761 230
163 3300001989 JGI24739J22299_10008395 JGI24739J22299_100083955 230
164 3300001990 JGI24737J22298_10006404 JGI24737J22298_100064044 230
165 3300002067 JGI24735J21928_10011759 JGI24735J21928_100117593 230
166 3300002075 JGI24738J21930_10004376 JGI24738J21930_100043762 230
167 3300005327 Ga0070658_10000630 Ga0070658_1000063012 230
168 3300005327 Ga0070658_10156226 Ga0070658_101562262 230
169 3300005329 Ga0070683_100004208 Ga0070683_10000420811 230
170 3300005335 Ga0070666_10001869 Ga0070666_1000186910 230
171 3300005339 Ga0070660_100000442 Ga0070660_10000044211 230
172 3300005344 Ga0070661_100002014 Ga0070661_1000020143 230
173 3300005344 Ga0070661_100021787 Ga0070661_1000217872 230
174 3300005364 Ga0070673_100040383 Ga0070673_1000403831 230
175 3300005366 Ga0070659_100000562 Ga0070659_10000056210 230
176 3300005366 Ga0070659_100351892 Ga0070659_1003518921 230
177 3300005367 Ga0070667_100633021 Ga0070667_1006330212 230
178 3300005455 Ga0070663_100003322 Ga0070663_1000033228 230
179 3300005455 Ga0070663_100054742 Ga0070663_1000547422 230
180 3300005457 Ga0070662_100000517 Ga0070662_10000051715 230
181 3300005535 Ga0070684_100005274 Ga0070684_1000052749 230
182 3300005539 Ga0068853_100002369 Ga0068853_1000023693 230
183 3300005547 Ga0070693_100000698 Ga0070693_10000069811 230
184 3300005563 Ga0068855_100001245 Ga0068855_10000124512 230
185 3300005564 Ga0070664_100000609 Ga0070664_10000060915 230
186 3300005614 Ga0068856_100001106 Ga0068856_10000110611 230
187 3300005614 Ga0068856_100225925 Ga0068856_1002259252 230
188 3300005616 Ga0068852_100000738 Ga0068852_10000073812 230
189 3300005616 Ga0068852_100016299 Ga0068852_1000162993 230
190 3300005618 Ga0068864_100037532 Ga0068864_1000375323 230
191 3300006237 Ga0097621_100090679 Ga0097621_1000906792 230
192 3300009177 Ga0105248_10003929 Ga0105248_100039293 230
193 3300009551 Ga0105238_10482333 Ga0105238_104823331 230
194 3300013100 Ga0157373_10246038 Ga0157373_102460381 230
195 3300013102 Ga0157371_10002006 Ga0157371_100020064 230
196 3300013307 Ga0157372_10760430 Ga0157372_107604302 230
197 3300014325 Ga0163163_10019596 Ga0163163_100195965 230
198 3300014968 Ga0157379_10064767 Ga0157379_100647673 230
199 3300025903 Ga0207680_10007304 Ga0207680_100073043 230
200 3300025904 Ga0207647_10061924 Ga0207647_100619242 230
201 3300025909 Ga0207705_10002368 Ga0207705_100023685 230
202 3300025919 Ga0207657_10002430 Ga0207657_100024304 230
203 3300025920 Ga0207649_10000647 Ga0207649_100006475 230
204 3300025920 Ga0207649_10027575 Ga0207649_100275752 230
205 3300025925 Ga0207650_10008694 Ga0207650_100086943 230
206 3300025932 Ga0207690_10004774 Ga0207690_100047743 230
207 3300025933 Ga0207706_10000862 Ga0207706_1000086212 230
208 3300025941 Ga0207711_10001010 Ga0207711_1000101011 230
209 3300025944 Ga0207661_10024940 Ga0207661_100249402 230
210 3300025945 Ga0207679_10000410 Ga0207679_1000041015 230
211 3300025981 Ga0207640_10102653 Ga0207640_101026532 230
212 3300025986 Ga0207658_10528371 Ga0207658_105283712 230
213 3300026041 Ga0207639_10000559 Ga0207639_100005598 230
214 3300026067 Ga0207678_10001544 Ga0207678_1000154411 230
215 3300026067 Ga0207678_10037554 Ga0207678_100375542 230
216 3300026078 Ga0207702_10001481 Ga0207702_100014815 230
217 3300026078 Ga0207702_10056453 Ga0207702_100564532 230
218 3300026142 Ga0207698_10002979 Ga0207698_100029798 230
219 3300026142 Ga0207698_10138579 Ga0207698_101385792 230
220 3300028379 Ga0268266_10030760 Ga0268266_100307602 230
221 3300034820 Ga0373959_0020634 Ga0373959_0020634_56_748 230
222 3300035691 Ga0373931_0006935 Ga0373931_0006935_3680_4372 230
223 3300037312 Ga0395899_0172852 Ga0395899_0172852_605_1297 230
224 3300037418 Ga0395900_0214946 Ga0395900_0214946_406_1098 230
225 3300037466 Ga0395898_0403397 Ga0395898_0403397_174_866 230
226 3300037466 Ga0395898_0442312 Ga0395898_0442312_382_1074 230
227 3300037471 Ga0395905_0208844 Ga0395905_0208844_161_853 230
228 3300037471 Ga0395905_0322114 Ga0395905_0322114_338_1030 230
229 3300038443 Ga0395901_0181580 Ga0395901_0181580_1005_1700 230
230 3300038443 Ga0395901_0489369 Ga0395901_0489369_156_848 230
231 3300038443 Ga0395901_0489397 Ga0395901_0489397_156_848 230
232 3300045976 Ga0466967_0177754 Ga0466967_0177754_549_1241 230
233 3300045976 Ga0466967_0346008 Ga0466967_0346008_13_705 230
234 3300048915 Ga0496112_0379706 Ga0496112_0379706_575_1309 231
235 3300031548 Ga0307408_100056804 Ga0307408_1000568042 234
236 3300031901 Ga0307406_10034965 Ga0307406_100349654 234
237 3300031911 Ga0307412_10172572 Ga0307412_101725722 234
238 3300032002 Ga0307416_100207293 Ga0307416_1002072932 234
239 3300032126 Ga0307415_100048132 Ga0307415_1000481322 234
240 3300037312 Ga0395899_0213090 Ga0395899_0213090_315_1049 234
241 3300037418 Ga0395900_0098367 Ga0395900_0098367_2120_2854 234
242 3300037466 Ga0395898_0454356 Ga0395898_0454356_309_1043 234
243 3300037471 Ga0395905_0047223 Ga0395905_0047223_2527_3261 234
244 3300038443 Ga0395901_0038690 Ga0395901_0038690_2591_3325 234
245 3300005293 Ga0065715_10259893 Ga0065715_102598932 235
246 3300005328 Ga0070676_10000844 Ga0070676_1000084413 235
247 3300005334 Ga0068869_100013397 Ga0068869_1000133972 235
248 3300005347 Ga0070668_100001624 Ga0070668_1000016245 235
249 3300005353 Ga0070669_100028412 Ga0070669_1000284124 235
250 3300005356 Ga0070674_100005819 Ga0070674_1000058193 235
251 3300005364 Ga0070673_100025408 Ga0070673_1000254082 235
252 3300005364 Ga0070673_100155588 Ga0070673_1001555883 235
253 3300005367 Ga0070667_100035587 Ga0070667_1000355872 235
254 3300005367 Ga0070667_100051020 Ga0070667_1000510204 235
255 3300005457 Ga0070662_100640914 Ga0070662_1006409142 235
256 3300005459 Ga0068867_100010532 Ga0068867_1000105323 235
257 3300005617 Ga0068859_100113219 Ga0068859_1001132192 235
258 3300005718 Ga0068866_10122142 Ga0068866_101221422 235
259 3300005841 Ga0068863_100503974 Ga0068863_1005039742 235
260 3300005843 Ga0068860_100022692 Ga0068860_1000226924 235
261 3300005844 Ga0068862_100005046 Ga0068862_1000050464 235
262 3300005844 Ga0068862_100018767 Ga0068862_1000187673 235
263 3300006237 Ga0097621_100048916 Ga0097621_1000489162 235
264 3300006358 Ga0068871_100044110 Ga0068871_1000441102 235
265 3300006844 Ga0075428_100087492 Ga0075428_1000874922 235
266 3300006881 Ga0068865_100066735 Ga0068865_1000667352 235
267 3300006931 Ga0097620_100113220 Ga0097620_1001132202 235
268 3300009177 Ga0105248_10077795 Ga0105248_100777952 235
269 3300013308 Ga0157375_10115659 Ga0157375_101156593 235
270 3300025315 Ga0207697_10042232 Ga0207697_100422322 235
271 3300025899 Ga0207642_10158414 Ga0207642_101584142 235
272 3300025907 Ga0207645_10002872 Ga0207645_100028725 235
273 3300025923 Ga0207681_10022979 Ga0207681_100229794 235
274 3300025937 Ga0207669_10004190 Ga0207669_100041902 235
275 3300025938 Ga0207704_10014589 Ga0207704_100145892 235
276 3300025940 Ga0207691_10012508 Ga0207691_1001250810 235
277 3300025941 Ga0207711_10314175 Ga0207711_103141752 235
278 3300025942 Ga0207689_10147227 Ga0207689_101472272 235
279 3300025945 Ga0207679_10004905 Ga0207679_100049053 235
280 3300025960 Ga0207651_10055442 Ga0207651_100554422 235
281 3300025972 Ga0207668_10000281 Ga0207668_1000028117 235
282 3300025972 Ga0207668_10204772 Ga0207668_102047722 235
283 3300025986 Ga0207658_10006330 Ga0207658_100063302 235
284 3300025986 Ga0207658_10062898 Ga0207658_100628984 235
285 3300026089 Ga0207648_10014655 Ga0207648_1001465511 235
286 3300026121 Ga0207683_10048317 Ga0207683_100483172 235
287 3300028380 Ga0268265_10008286 Ga0268265_100082865 235
288 3300028381 Ga0268264_10001669 Ga0268264_100016695 235
289 3300031731 Ga0307405_10097566 Ga0307405_100975663 235
290 3300031852 Ga0307410_10004834 Ga0307410_100048347 235
291 3300031995 Ga0307409_100056326 Ga0307409_1000563263 235
292 3300032004 Ga0307414_10043247 Ga0307414_100432473 235
293 3300032005 Ga0307411_10014648 Ga0307411_100146485 235
294 3300032126 Ga0307415_100268999 Ga0307415_1002689992 235
295 3300005335 Ga0070666_10090837 Ga0070666_100908372 236
296 3300005367 Ga0070667_100158924 Ga0070667_1001589243 236
297 3300005367 Ga0070667_100176595 Ga0070667_1001765952 236
298 3300005456 Ga0070678_100398762 Ga0070678_1003987621 236
299 3300005617 Ga0068859_100644527 Ga0068859_1006445271 236
300 3300005841 Ga0068863_100277740 Ga0068863_1002777402 236
301 3300005843 Ga0068860_100147886 Ga0068860_1001478864 236
302 3300005844 Ga0068862_100048971 Ga0068862_1000489713 236
303 3300006931 Ga0097620_100644530 Ga0097620_1006445301 236
304 3300009177 Ga0105248_10013316 Ga0105248_100133165 236
305 3300009553 Ga0105249_10111142 Ga0105249_101111422 236
306 3300009553 Ga0105249_10327323 Ga0105249_103273232 236
307 3300013308 Ga0157375_10279009 Ga0157375_102790092 236
308 3300025903 Ga0207680_10292101 Ga0207680_102921012 236
309 3300025918 Ga0207662_10138279 Ga0207662_101382792 236
310 3300025941 Ga0207711_10005718 Ga0207711_100057182 236
311 3300025961 Ga0207712_10110152 Ga0207712_101101522 236
312 3300025986 Ga0207658_10030150 Ga0207658_100301502 236
313 3300026121 Ga0207683_10063547 Ga0207683_100635473 236
314 3300028380 Ga0268265_10008905 Ga0268265_100089054 236
315 3300028380 Ga0268265_10049567 Ga0268265_100495671 236
316 3300028381 Ga0268264_10088773 Ga0268264_100887734 236
317 3300048910 Ga0496107_0463200 Ga0496107_0463200_176_886 236
318 3300011119 Ga0105246_10129197 Ga0105246_101291972 237
319 3300014745 Ga0157377_10032193 Ga0157377_100321931 237
320 3300031456 Ga0307513_10300636 Ga0307513_103006362 237
321 3300031824 Ga0307413_10242292 Ga0307413_102422922 237
322 3300032002 Ga0307416_100694729 Ga0307416_1006947292 237
323 3300032004 Ga0307414_10203662 Ga0307414_102036622 237
324 3300032005 Ga0307411_10010086 Ga0307411_100100866 237
325 3300032126 Ga0307415_100088732 Ga0307415_1000887323 237
326 3300032126 Ga0307415_100247511 Ga0307415_1002475111 237
327 3300046684 Ga0495669_0025964 Ga0495669_0025964_1611_2324 237
328 3300005293 Ga0065715_10035602 Ga0065715_100356022 238
329 3300005340 Ga0070689_100047888 Ga0070689_1000478884 238
330 3300005353 Ga0070669_100032257 Ga0070669_1000322572 238
331 3300005366 Ga0070659_100021128 Ga0070659_1000211285 238
332 3300005455 Ga0070663_100081880 Ga0070663_1000818802 238
333 3300005457 Ga0070662_100009537 Ga0070662_1000095374 238
334 3300005457 Ga0070662_100500004 Ga0070662_1005000042 238
335 3300005458 Ga0070681_10118837 Ga0070681_101188372 238
336 3300005543 Ga0070672_100058024 Ga0070672_1000580243 238
337 3300005563 Ga0068855_100095169 Ga0068855_1000951693 238
338 3300005564 Ga0070664_100107333 Ga0070664_1001073332 238
339 3300005577 Ga0068857_100049166 Ga0068857_1000491664 238
340 3300005577 Ga0068857_100091135 Ga0068857_1000911352 238
341 3300005578 Ga0068854_100035667 Ga0068854_1000356672 238
342 3300005617 Ga0068859_100004262 Ga0068859_1000042627 238
343 3300005617 Ga0068859_100052942 Ga0068859_1000529425 238
344 3300005718 Ga0068866_10010258 Ga0068866_100102583 238
345 3300005841 Ga0068863_100024184 Ga0068863_1000241843 238
346 3300005841 Ga0068863_100034262 Ga0068863_1000342623 238
347 3300005841 Ga0068863_100355262 Ga0068863_1003552622 238
348 3300005842 Ga0068858_100005310 Ga0068858_1000053106 238
349 3300005842 Ga0068858_100033191 Ga0068858_1000331912 238
350 3300005843 Ga0068860_100006525 Ga0068860_1000065257 238
351 3300005843 Ga0068860_100022168 Ga0068860_1000221681 238
352 3300005843 Ga0068860_100103217 Ga0068860_1001032173 238
353 3300005843 Ga0068860_100665969 Ga0068860_1006659692 238
354 3300005844 Ga0068862_100109489 Ga0068862_1001094892 238
355 3300006844 Ga0075428_100353252 Ga0075428_1003532521 238
356 3300006852 Ga0075433_10005530 Ga0075433_100055305 238
357 3300006931 Ga0097620_100004262 Ga0097620_1000042627 238
358 3300006931 Ga0097620_100052938 Ga0097620_1000529385 238
359 3300009148 Ga0105243_10892249 Ga0105243_108922492 238
360 3300009174 Ga0105241_10172870 Ga0105241_101728702 238
361 3300009176 Ga0105242_10111211 Ga0105242_101112113 238
362 3300009177 Ga0105248_10629299 Ga0105248_106292991 238
363 3300009553 Ga0105249_10045875 Ga0105249_100458754 238
364 3300010375 Ga0105239_10106732 Ga0105239_101067323 238
365 3300013100 Ga0157373_10052548 Ga0157373_100525482 238
366 3300014968 Ga0157379_10779418 Ga0157379_107794182 238
367 3300017792 Ga0163161_10363566 Ga0163161_103635662 238
368 3300025904 Ga0207647_10001074 Ga0207647_1000107410 238
369 3300025907 Ga0207645_10021417 Ga0207645_100214173 238
370 3300025909 Ga0207705_10024090 Ga0207705_100240903 238
371 3300025909 Ga0207705_10099561 Ga0207705_100995612 238
372 3300025909 Ga0207705_10288038 Ga0207705_102880381 238
373 3300025919 Ga0207657_10015442 Ga0207657_100154428 238
374 3300025920 Ga0207649_10020707 Ga0207649_100207074 238
375 3300025923 Ga0207681_10094032 Ga0207681_100940322 238
376 3300025923 Ga0207681_10199614 Ga0207681_101996142 238
377 3300025932 Ga0207690_10000614 Ga0207690_100006142 238
378 3300025933 Ga0207706_10024926 Ga0207706_100249267 238
379 3300025933 Ga0207706_10033765 Ga0207706_100337653 238
380 3300025940 Ga0207691_10116513 Ga0207691_101165132 238
381 3300025940 Ga0207691_10357101 Ga0207691_103571011 238
382 3300025945 Ga0207679_10025323 Ga0207679_100253232 238
383 3300025945 Ga0207679_10314650 Ga0207679_103146502 238
384 3300025949 Ga0207667_10018840 Ga0207667_100188403 238
385 3300025961 Ga0207712_10001750 Ga0207712_100017507 238
386 3300025961 Ga0207712_10761407 Ga0207712_107614071 238
387 3300025981 Ga0207640_10023817 Ga0207640_100238172 238
388 3300026023 Ga0207677_10249592 Ga0207677_102495922 238
389 3300026041 Ga0207639_10097795 Ga0207639_100977952 238
390 3300026067 Ga0207678_10028774 Ga0207678_100287742 238
391 3300026088 Ga0207641_10027877 Ga0207641_100278773 238
392 3300026095 Ga0207676_10083926 Ga0207676_100839263 238
393 3300026116 Ga0207674_10003401 Ga0207674_100034013 238
394 3300026116 Ga0207674_10142777 Ga0207674_101427773 238
395 3300028380 Ga0268265_10020028 Ga0268265_100200287 238
396 3300028380 Ga0268265_10571021 Ga0268265_105710212 238
397 3300028381 Ga0268264_10002107 Ga0268264_1000210719 238
398 3300028381 Ga0268264_10103969 Ga0268264_101039692 238
399 3300028381 Ga0268264_10884468 Ga0268264_108844682 238
400 3300037418 Ga0395900_0142029 Ga0395900_0142029_1331_2047 238
401 3300037466 Ga0395898_0284049 Ga0395898_0284049_269_985 238
402 3300037471 Ga0395905_0048004 Ga0395905_0048004_2453_3169 238
403 3300038443 Ga0395901_0182007 Ga0395901_0182007_938_1654 238
404 3300042012 Ga0439455_0037464 Ga0439455_0037464_208_924 238
405 3300048912 Ga0496109_0228285 Ga0496109_0228285_826_1542 238
406 3300049583 Ga0501067_0067887 Ga0501067_0067887_352_1068 238
407 3300049584 Ga0501068_0077224 Ga0501068_0077224_107_823 238
408 3300049585 Ga0501069_0087184 Ga0501069_0087184_401_1117 238
409 3300050512 nmdc:mga0n895_76452_c1 nmdc:mga0n895_76452_c1_327_1052 238
410 3300050515 nmdc:mga0a205_14292_c1 nmdc:mga0a205_14292_c1_4689_5414 238
411 3300005329 Ga0070683_100063728 Ga0070683_1000637281 239
412 3300005339 Ga0070660_100003993 Ga0070660_1000039933 239
413 3300005339 Ga0070660_100024119 Ga0070660_1000241193 239
414 3300005344 Ga0070661_100011009 Ga0070661_1000110092 239
415 3300005345 Ga0070692_10007131 Ga0070692_100071312 239
416 3300005366 Ga0070659_100001332 Ga0070659_10000133221 239
417 3300005455 Ga0070663_100001444 Ga0070663_10000144417 239
418 3300005539 Ga0068853_100086401 Ga0068853_1000864012 239
419 3300005563 Ga0068855_100020508 Ga0068855_1000205083 239
420 3300005564 Ga0070664_100232361 Ga0070664_1002323611 239
421 3300005614 Ga0068856_100013686 Ga0068856_1000136863 239
422 3300005616 Ga0068852_100003209 Ga0068852_10000320915 239
423 3300025904 Ga0207647_10010181 Ga0207647_100101812 239
424 3300025904 Ga0207647_10136350 Ga0207647_101363502 239
425 3300025909 Ga0207705_10017404 Ga0207705_100174043 239
426 3300025909 Ga0207705_10232687 Ga0207705_102326872 239
427 3300025911 Ga0207654_10027334 Ga0207654_100273342 239
428 3300025919 Ga0207657_10001247 Ga0207657_1000124729 239
429 3300025920 Ga0207649_10089167 Ga0207649_100891672 239
430 3300025949 Ga0207667_10010674 Ga0207667_1001067410 239
431 3300026041 Ga0207639_10122256 Ga0207639_101222562 239
432 3300026067 Ga0207678_10008333 Ga0207678_100083333 239
433 3300026078 Ga0207702_10004991 Ga0207702_100049916 239
434 3300037312 Ga0395899_0002597 Ga0395899_0002597_4521_5240 239
435 3300037312 Ga0395899_0172296 Ga0395899_0172296_690_1409 239
436 3300037418 Ga0395900_0000777 Ga0395900_0000777_15295_16014 239
437 3300037418 Ga0395900_0353482 Ga0395900_0353482_65_784 239
438 3300037418 Ga0395900_0353494 Ga0395900_0353494_65_784 239
439 3300037466 Ga0395898_0021176 Ga0395898_0021176_592_1311 239
440 3300037466 Ga0395898_0217299 Ga0395898_0217299_757_1476 239
441 3300037466 Ga0395898_0335171 Ga0395898_0335171_659_1378 239
442 3300038443 Ga0395901_0000260 Ga0395901_0000260_8367_9086 239
443 3300038443 Ga0395901_0009148 Ga0395901_0009148_8994_9713 239
444 3300038443 Ga0395901_0054623 Ga0395901_0054623_3064_3783 239
445 3300044656 Ga0466969_0007721 Ga0466969_0007721_3302_4021 239
446 3300044684 Ga0466966_0004035 Ga0466966_0004035_47_766 239
447 3300044693 Ga0466961_0008379 Ga0466961_0008379_4285_5004 239
448 3300044694 Ga0466963_0008103 Ga0466963_0008103_3005_3724 239
449 3300044765 Ga0466970_0001410 Ga0466970_0001410_585_1304 239
450 3300044842 Ga0466957_0000119 Ga0466957_0000119_19117_19836 239
451 3300045836 Ga0466958_0001880 Ga0466958_0001880_7675_8394 239
452 3300061719 Ga0466962_0005903 Ga0466962_0005903_2966_3685 239
453 3300005331 Ga0070670_100050234 Ga0070670_1000502342 240
454 3300014325 Ga0163163_10029533 Ga0163163_100295332 240
455 3300014745 Ga0157377_10153415 Ga0157377_101534152 240
456 3300025904 Ga0207647_10028550 Ga0207647_100285502 240
457 3300025919 Ga0207657_10331216 Ga0207657_103312162 240
458 3300025925 Ga0207650_10316094 Ga0207650_103160941 240
459 3300026088 Ga0207641_10117368 Ga0207641_101173682 240
460 3300026116 Ga0207674_10002478 Ga0207674_1000247817 240
461 3300031852 Ga0307410_10548036 Ga0307410_105480362 240
462 3300031911 Ga0307412_10140319 Ga0307412_101403191 240
463 3300032126 Ga0307415_100383596 Ga0307415_1003835961 240
464 3300044842 Ga0466957_0100659 Ga0466957_0100659_229_957 240
465 3300003323 rootH1_10069393 rootH1_100693932 241
466 3300005327 Ga0070658_10045495 Ga0070658_100454955 241
467 3300005331 Ga0070670_100091643 Ga0070670_1000916432 241
468 3300005331 Ga0070670_100359228 Ga0070670_1003592282 241
469 3300005355 Ga0070671_100080376 Ga0070671_1000803762 241
470 3300005457 Ga0070662_100016343 Ga0070662_1000163433 241
471 3300005543 Ga0070672_100044303 Ga0070672_1000443033 241
472 3300009174 Ga0105241_10186850 Ga0105241_101868501 241
473 3300014325 Ga0163163_10034454 Ga0163163_100344542 241
474 3300014968 Ga0157379_10140765 Ga0157379_101407652 241
475 3300014969 Ga0157376_10008878 Ga0157376_100088784 241
476 3300017792 Ga0163161_10036353 Ga0163161_100363532 241
477 3300025931 Ga0207644_10038322 Ga0207644_100383222 241
478 3300025932 Ga0207690_10062818 Ga0207690_100628183 241
479 3300025933 Ga0207706_10007589 Ga0207706_100075893 241
480 3300025940 Ga0207691_10215694 Ga0207691_102156942 241
481 3300026121 Ga0207683_10014890 Ga0207683_100148903 241
482 3300030745 Ga0316182_1064693 Ga0316182_10646932 241
483 3300031852 Ga0307410_10000497 Ga0307410_100004975 241
484 3300031903 Ga0307407_10081135 Ga0307407_100811352 241
485 3300031995 Ga0307409_100005023 Ga0307409_1000050234 241
486 3300032002 Ga0307416_100839658 Ga0307416_1008396582 241
487 3300032005 Ga0307411_10030736 Ga0307411_100307362 241
488 3300037418 Ga0395900_0017042 Ga0395900_0017042_2460_3185 241
489 3300037471 Ga0395905_0001949 Ga0395905_0001949_10833_11558 241
490 3300038443 Ga0395901_0030900 Ga0395901_0030900_720_1445 241
491 3300042134 Ga0450898_020400 Ga0450898_020400_394_1122 241
492 3300044694 Ga0466963_0013712 Ga0466963_0013712_2472_3197 241
493 3300045976 Ga0466967_0100831 Ga0466967_0100831_1136_1861 241
494 3300048910 Ga0496107_0424944 Ga0496107_0424944_66_797 241
495 3300049586 Ga0501070_0012968 Ga0501070_0012968_5786_6511 241
496 3300001979 JGI24740J21852_10003441 JGI24740J21852_100034416 242
497 3300002067 JGI24735J21928_10003670 JGI24735J21928_100036703 242
498 3300005327 Ga0070658_10123150 Ga0070658_101231502 242
499 3300005327 Ga0070658_10207539 Ga0070658_102075392 242
500 3300005336 Ga0070680_100019606 Ga0070680_1000196063 242
501 3300005336 Ga0070680_100102505 Ga0070680_1001025052 242
502 3300005339 Ga0070660_100003475 Ga0070660_1000034755 242
503 3300005339 Ga0070660_100040467 Ga0070660_1000404672 242
504 3300005339 Ga0070660_100067751 Ga0070660_1000677512 242
505 3300005340 Ga0070689_100436739 Ga0070689_1004367392 242
506 3300005341 Ga0070691_10122167 Ga0070691_101221671 242
507 3300005344 Ga0070661_100005153 Ga0070661_1000051533 242
508 3300005345 Ga0070692_10051361 Ga0070692_100513612 242
509 3300005366 Ga0070659_100005925 Ga0070659_1000059255 242
510 3300005366 Ga0070659_100060147 Ga0070659_1000601473 242
511 3300005435 Ga0070714_100038928 Ga0070714_1000389283 242
512 3300005458 Ga0070681_10006712 Ga0070681_100067127 242
513 3300005458 Ga0070681_10027941 Ga0070681_100279414 242
514 3300005530 Ga0070679_100075162 Ga0070679_1000751625 242
515 3300005530 Ga0070679_100150717 Ga0070679_1001507172 242
516 3300005539 Ga0068853_100013398 Ga0068853_1000133983 242
517 3300005539 Ga0068853_100087893 Ga0068853_1000878933 242
518 3300005563 Ga0068855_100006498 Ga0068855_1000064988 242
519 3300005563 Ga0068855_100213355 Ga0068855_1002133552 242
520 3300005564 Ga0070664_100019308 Ga0070664_1000193083 242
521 3300005577 Ga0068857_100010802 Ga0068857_1000108023 242
522 3300005577 Ga0068857_100244236 Ga0068857_1002442362 242
523 3300005614 Ga0068856_100073208 Ga0068856_1000732082 242
524 3300005614 Ga0068856_100281138 Ga0068856_1002811381 242
525 3300005616 Ga0068852_100010498 Ga0068852_1000104985 242
526 3300005616 Ga0068852_100028155 Ga0068852_1000281552 242
527 3300005842 Ga0068858_100460359 Ga0068858_1004603592 242
528 3300009093 Ga0105240_10047593 Ga0105240_100475933 242
529 3300009545 Ga0105237_10024621 Ga0105237_100246213 242
530 3300009551 Ga0105238_10018345 Ga0105238_100183454 242
531 3300009551 Ga0105238_10032686 Ga0105238_100326864 242
532 3300010375 Ga0105239_10039727 Ga0105239_100397273 242
533 3300013100 Ga0157373_10019515 Ga0157373_100195153 242
534 3300013100 Ga0157373_10019667 Ga0157373_100196673 242
535 3300013104 Ga0157370_10020968 Ga0157370_100209683 242
536 3300013104 Ga0157370_10026825 Ga0157370_100268253 242
537 3300013104 Ga0157370_10434068 Ga0157370_104340682 242
538 3300013104 Ga0157370_10594021 Ga0157370_105940212 242
539 3300013105 Ga0157369_10026269 Ga0157369_100262693 242
540 3300013105 Ga0157369_10032758 Ga0157369_100327583 242
541 3300013105 Ga0157369_10064372 Ga0157369_100643724 242
542 3300013307 Ga0157372_10007219 Ga0157372_100072196 242
543 3300013307 Ga0157372_10279675 Ga0157372_102796752 242
544 3300025904 Ga0207647_10007658 Ga0207647_100076583 242
545 3300025909 Ga0207705_10020215 Ga0207705_100202153 242
546 3300025909 Ga0207705_10020627 Ga0207705_100206273 242
547 3300025912 Ga0207707_10008385 Ga0207707_100083853 242
548 3300025913 Ga0207695_10017532 Ga0207695_100175326 242
549 3300025914 Ga0207671_10054465 Ga0207671_100544653 242
550 3300025917 Ga0207660_10210578 Ga0207660_102105782 242
551 3300025919 Ga0207657_10002236 Ga0207657_100022368 242
552 3300025919 Ga0207657_10018639 Ga0207657_100186394 242
553 3300025919 Ga0207657_10028856 Ga0207657_100288562 242
554 3300025920 Ga0207649_10007796 Ga0207649_100077963 242
555 3300025920 Ga0207649_10008776 Ga0207649_100087762 242
556 3300025921 Ga0207652_10088360 Ga0207652_100883603 242
557 3300025924 Ga0207694_10002362 Ga0207694_100023624 242
558 3300025929 Ga0207664_10100330 Ga0207664_101003302 242
559 3300025932 Ga0207690_10005086 Ga0207690_100050865 242
560 3300025932 Ga0207690_10041290 Ga0207690_100412902 242
561 3300025932 Ga0207690_10070101 Ga0207690_100701012 242
562 3300025932 Ga0207690_10489928 Ga0207690_104899282 242
563 3300025945 Ga0207679_10050055 Ga0207679_100500553 242
564 3300025949 Ga0207667_10017086 Ga0207667_100170865 242
565 3300025981 Ga0207640_10024044 Ga0207640_100240442 242
566 3300026041 Ga0207639_10000810 Ga0207639_1000081020 242
567 3300026078 Ga0207702_10071331 Ga0207702_100713313 242
568 3300026116 Ga0207674_10015606 Ga0207674_100156066 242
569 3300026142 Ga0207698_10010517 Ga0207698_100105175 242
570 3300026142 Ga0207698_10030678 Ga0207698_100306782 242
571 3300026142 Ga0207698_10032434 Ga0207698_100324343 242
572 3300031903 Ga0307407_10060161 Ga0307407_100601612 242
573 3300031995 Ga0307409_100023796 Ga0307409_1000237963 242
574 3300035692 Ga0373935_0411513 Ga0373935_0411513_231_959 242
575 3300035695 Ga0373927_0044621 Ga0373927_0044621_1065_1793 242
576 3300035725 Ga0373947_0020526 Ga0373947_0020526_300_1028 242
577 3300037312 Ga0395899_0012036 Ga0395899_0012036_1292_2020 242
578 3300037312 Ga0395899_0188507 Ga0395899_0188507_185_916 242
579 3300037418 Ga0395900_0003388 Ga0395900_0003388_8913_9644 242
580 3300037418 Ga0395900_0006010 Ga0395900_0006010_814_1545 242
581 3300037418 Ga0395900_0008568 Ga0395900_0008568_7966_8697 242
582 3300037418 Ga0395900_0045115 Ga0395900_0045115_2146_2874 242
583 3300037466 Ga0395898_0016194 Ga0395898_0016194_2288_3016 242
584 3300037466 Ga0395898_0016372 Ga0395898_0016372_6782_7513 242
585 3300037466 Ga0395898_0472188 Ga0395898_0472188_445_1176 242
586 3300037471 Ga0395905_0010016 Ga0395905_0010016_3535_4263 242
587 3300037471 Ga0395905_0038240 Ga0395905_0038240_1393_2124 242
588 3300038443 Ga0395901_0000440 Ga0395901_0000440_19582_20313 242
589 3300038443 Ga0395901_0019723 Ga0395901_0019723_4371_5099 242
590 3300038443 Ga0395901_0021910 Ga0395901_0021910_3556_4287 242
591 3300038443 Ga0395901_0043715 Ga0395901_0043715_1095_1826 242
592 3300044694 Ga0466963_0011384 Ga0466963_0011384_18_746 242
593 3300044694 Ga0466963_0041559 Ga0466963_0041559_2236_2964 242
594 3300044694 Ga0466963_0049002 Ga0466963_0049002_747_1475 242
595 3300044706 Ga0466964_0053997 Ga0466964_0053997_906_1634 242
596 3300044719 Ga0466971_0030755 Ga0466971_0030755_72_800 242
597 3300044842 Ga0466957_0008553 Ga0466957_0008553_29_757 242
598 3300044842 Ga0466957_0013148 Ga0466957_0013148_3280_4008 242
599 3300044842 Ga0466957_0021041 Ga0466957_0021041_2623_3351 242
600 3300044842 Ga0466957_0025502 Ga0466957_0025502_1889_2617 242
601 3300045836 Ga0466958_0010624 Ga0466958_0010624_1997_2725 242
602 3300045976 Ga0466967_0014248 Ga0466967_0014248_2279_3007 242
603 3300045976 Ga0466967_0043397 Ga0466967_0043397_3031_3759 242
604 3300045976 Ga0466967_0044392 Ga0466967_0044392_2083_2811 242
605 3300045976 Ga0466967_0116142 Ga0466967_0116142_1243_1971 242
606 3300045976 Ga0466967_0576987 Ga0466967_0576987_366_1094 242
607 3300061719 Ga0466962_0008845 Ga0466962_0008845_1721_2449 242

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01323

DSBA

DSBA-like thioredoxin domain

97

238

0.96

PF13462

Thioredoxin_4

Thioredoxin

82

239

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3gyk-assembly4.cif.gz_D the crystal structure of a thioredoxin-like oxidoreductase from silicibacter pomeroyi dss-3 0.9158 75 238
6nen-assembly1.cif.gz_A catalytic domain of proteus mirabilis scsc 0.9009 68 238
4gxz-assembly3.cif.gz_C crystal structure of a periplasmic thioredoxin-like protein from salmonella enterica serovar typhimurium 0.894 76 238
6nen-assembly1.cif.gz_A catalytic domain of proteus mirabilis scsc 0.8723 68 238
6eez-assembly1.cif.gz_A crystal structure of the thiol-disulfide exchange protein alpha-dsba2 from wolbachia pipientis 0.8673 63 235
ID Description Score Start End Superfamily
3gykA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8937 74 239 3.40.30.10
3gykA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8736 74 239 3.40.30.10
4xvwC01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8688 68 240 3.40.30.10
4xvwC01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.846 68 240 3.40.30.10
3eu4A00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8104 84 238 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A2A2K558-F1-model_v4 Thioredoxin domain-containing protein 0.9746 62 238 GO:0016491
AF-A0A418Q2E3-F1-model_v4 DsbA family protein 0.9708 37 238 GO:0016491
AF-A0A2A2K558-F1-model_v4 Thioredoxin domain-containing protein 0.9482 62 238 GO:0016491
AF-A0A258X6G2-F1-model_v4 Disulfide bond formation protein DsbA 0.9405 94 238 GO:0016491
AF-A0A418Q2E3-F1-model_v4 DsbA family protein 0.9387 37 238 GO:0016491

Feature Viewer

pLDDT pTM Quality
84.23 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map