F468784

General Info

Members Datasets Scaffolds Average Seq Length
608 282 1216 279

Family's Representative Sequence

Representative Sequence 3300014326|Ga0157380_10007998|Ga0157380_100079984
Length 303
Sequence VTNRLVRFEEMTMAEQQQIVYLNGELIPLGEAKVSVLDRGFIYGDGVYELVPVYARQLFRLEHHLRRLQHSLAGIGLATPMSPTQWESTIRALVARQPFDDQGVYLQVTRGVAKRDHAFPAGVAPTVFMMSNPLALPSREQVERGVAVVTADDNRWRRCDLKTTSLLGNVLMRQFAVENDAVETVMFRDGMLTEASASNVLVVIGGVVIAPPKDNLILPGITMDATFEFARDAGLSCEMRPVTKAEALAADEMWLSSSSKEVLAVTRVDGRAFGGGAPGPVFRRMWAEFQARRPRAAVAAGVA

Samples

Sample ID Description Type Environment
1 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
178 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
182 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
183 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
184 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
185 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
186 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
187 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
188 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
189 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
190 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
191 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
192 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
193 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
194 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
195 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
196 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
197 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
198 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
199 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
200 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
201 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
202 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
203 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
204 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
205 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
206 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
207 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
208 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
209 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
210 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
211 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
212 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
213 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
214 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
215 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
216 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
217 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
218 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
219 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
220 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
221 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
222 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
223 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
224 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
225 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
226 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
227 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
228 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
229 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
230 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
231 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
232 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
233 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
234 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
235 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
236 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
237 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
238 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
239 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
240 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
241 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
242 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
243 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
244 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
245 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
246 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
247 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
248 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
249 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
250 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
251 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
252 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
253 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
254 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
255 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
256 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
257 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
258 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
259 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
260 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
261 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
262 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
263 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
266 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
267 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
268 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
269 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
270 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
271 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
272 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
273 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
274 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
275 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
276 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
277 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
278 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
279 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
280 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
281 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
282 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.16
Nodule 0
Rhizoplane 2.47
Rhizosphere 97.2
Stem 0
Stem Tuber 0
Unclassified 2.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157380_10007998 3300014326 Bacteria 7532
2 Ga0065707_10108281 3300005295 Bacteria 2516
3 Ga0065707_10251239 3300005295 Bacteria 1115
4 Ga0070676_10001948 3300005328 Bacteria 10502
5 Ga0070676_10093948 3300005328 Bacteria 1842
6 Ga0070676_10235796 3300005328 Bacteria 1215
7 Ga0070683_100045484 3300005329 Bacteria 4051
8 Ga0070683_100098767 3300005329 Bacteria 2747
9 Ga0070690_100002869 3300005330 Bacteria 9295
10 Ga0070690_100193293 3300005330 Unclassified 1412
11 Ga0070690_100402209 3300005330 Bacteria 1006
12 Ga0070670_100003760 3300005331 Bacteria 12633
13 Ga0070670_100020212 3300005331 Bacteria 5721
14 Ga0070670_100023997 3300005331 Bacteria 5247
15 Ga0070670_100044539 3300005331 Bacteria 3815
16 Ga0070670_100175821 3300005331 Bacteria 1858
17 Ga0070677_10026492 3300005333 Bacteria 2174
18 Ga0068869_100002327 3300005334 Bacteria 11433
19 Ga0068869_100008953 3300005334 Bacteria 6480
20 Ga0068869_100029310 3300005334 Bacteria 3855
21 Ga0068869_100118177 3300005334 Bacteria 2025
22 Ga0068869_100229020 3300005334 Bacteria 1476
23 Ga0070666_10000816 3300005335 Bacteria 18906
24 Ga0070666_10010730 3300005335 Bacteria 5732
25 Ga0070666_10013432 3300005335 Bacteria 5196
26 Ga0070680_100036078 3300005336 Bacteria 3994
27 Ga0070680_100045898 3300005336 Bacteria 3553
28 Ga0068868_100010780 3300005338 Bacteria 6628
29 Ga0068868_100023100 3300005338 Bacteria 4703
30 Ga0068868_100032040 3300005338 Bacteria 4041
31 Ga0070660_100413139 3300005339 Bacteria 1117
32 Ga0070689_100020757 3300005340 Bacteria 4879
33 Ga0070689_100029842 3300005340 Bacteria 4134
34 Ga0070689_100080660 3300005340 Bacteria 2554
35 Ga0070689_100120950 3300005340 Bacteria 2091
36 Ga0070689_100342332 3300005340 Bacteria 1252
37 Ga0070687_100320358 3300005343 Bacteria 990
38 Ga0070692_10153622 3300005345 Bacteria 1313
39 Ga0070668_100002425 3300005347 Bacteria 13715
40 Ga0070668_100002584 3300005347 Bacteria 13305
41 Ga0070668_100004081 3300005347 Bacteria 10812
42 Ga0070668_100104800 3300005347 Bacteria 2245
43 Ga0070668_100247837 3300005347 Bacteria 1478
44 Ga0070669_100001114 3300005353 Bacteria 19625
45 Ga0070669_100035416 3300005353 Bacteria 3616
46 Ga0070675_100003508 3300005354 Bacteria 11895
47 Ga0070675_100004648 3300005354 Bacteria 10483
48 Ga0070675_100008431 3300005354 Bacteria 7999
49 Ga0070675_100012798 3300005354 Bacteria 6583
50 Ga0070675_100030522 3300005354 Bacteria 4352
51 Ga0070675_100094313 3300005354 Bacteria 2511
52 Ga0070675_100206915 3300005354 Bacteria 1705
53 Ga0070671_100008929 3300005355 Bacteria 8043
54 Ga0070671_100012399 3300005355 Bacteria 6865
55 Ga0070671_100052153 3300005355 Bacteria 3402
56 Ga0070671_100236369 3300005355 Bacteria 1551
57 Ga0070674_100000236 3300005356 Bacteria 27276
58 Ga0070674_100006028 3300005356 Bacteria 7044
59 Ga0070674_100023304 3300005356 Bacteria 4005
60 Ga0070674_100026075 3300005356 Bacteria 3813
61 Ga0070674_100079709 3300005356 Bacteria 2337
62 Ga0070673_100001162 3300005364 Bacteria 15124
63 Ga0070673_100001337 3300005364 Bacteria 14365
64 Ga0070673_100003476 3300005364 Bacteria 9809
65 Ga0070673_100036692 3300005364 Bacteria 3728
66 Ga0070673_100113604 3300005364 Bacteria 2249
67 Ga0070688_100002648 3300005365 Bacteria 9085
68 Ga0070688_100089058 3300005365 Bacteria 2013
69 Ga0070667_100006712 3300005367 Bacteria 9563
70 Ga0070667_100008845 3300005367 Bacteria 8336
71 Ga0070667_100204993 3300005367 Bacteria 1751
72 Ga0070667_100259025 3300005367 Bacteria 1557
73 Ga0070714_100006057 3300005435 Bacteria 9285
74 Ga0070714_100069918 3300005435 Bacteria 3033
75 Ga0070713_100000114 3300005436 Bacteria 52713
76 Ga0070713_100059822 3300005436 Bacteria 3183
77 Ga0070710_10009952 3300005437 Bacteria 4661
78 Ga0070710_10273250 3300005437 Bacteria 1094
79 Ga0070711_100003858 3300005439 Bacteria 8799
80 Ga0070711_100071113 3300005439 Bacteria 2451
81 Ga0070694_100004678 3300005444 Bacteria 8237
82 Ga0070694_100203860 3300005444 Bacteria 1475
83 Ga0070694_100326779 3300005444 Bacteria 1182
84 Ga0070708_100002053 3300005445 Bacteria 15521
85 Ga0070708_100051904 3300005445 Bacteria 3634
86 Ga0070708_100589878 3300005445 Bacteria 1048
87 Ga0070663_100085802 3300005455 Bacteria 2324
88 Ga0070663_100238267 3300005455 Bacteria 1435
89 Ga0070678_100000447 3300005456 Bacteria 19565
90 Ga0070678_100004752 3300005456 Bacteria 7746
91 Ga0070678_100036592 3300005456 Bacteria 3437
92 Ga0070678_100425627 3300005456 Bacteria 1158
93 Ga0070662_100319583 3300005457 Bacteria 1266
94 Ga0070681_10004051 3300005458 Bacteria 13833
95 Ga0070681_10041698 3300005458 Bacteria 4601
96 Ga0068867_100001541 3300005459 Bacteria 16000
97 Ga0068867_100002023 3300005459 Bacteria 14178
98 Ga0068867_100016105 3300005459 Bacteria 5309
99 Ga0070685_10001360 3300005466 Bacteria 12832
100 Ga0070685_10029391 3300005466 Bacteria 3053
101 Ga0070706_100181600 3300005467 Bacteria 1964
102 Ga0070707_100033339 3300005468 Bacteria 4911
103 Ga0070707_100037001 3300005468 Bacteria 4657
104 Ga0070707_100299977 3300005468 Bacteria 1561
105 Ga0070698_100045367 3300005471 Bacteria 4499
106 Ga0070698_100101567 3300005471 Bacteria 2847
107 Ga0070698_100151474 3300005471 Bacteria 2267
108 Ga0070698_100177912 3300005471 Bacteria 2066
109 Ga0070699_100138676 3300005518 Bacteria 2146
110 Ga0070699_100189541 3300005518 Bacteria 1826
111 Ga0070699_100254034 3300005518 Bacteria 1571
112 Ga0070699_100258735 3300005518 Bacteria 1556
113 Ga0070679_100010697 3300005530 Bacteria 8709
114 Ga0070679_100468983 3300005530 Bacteria 1203
115 Ga0070684_100013383 3300005535 Bacteria 6613
116 Ga0070684_100093302 3300005535 Bacteria 2679
117 Ga0070697_100013851 3300005536 Bacteria 6328
118 Ga0070697_100379527 3300005536 Bacteria 1224
119 Ga0068853_100000689 3300005539 Bacteria 23316
120 Ga0068853_100077060 3300005539 Bacteria 2912
121 Ga0070672_100061540 3300005543 Bacteria 2960
122 Ga0070672_100077909 3300005543 Bacteria 2651
123 Ga0070672_100078858 3300005543 Bacteria 2635
124 Ga0070686_100109330 3300005544 Bacteria 1881
125 Ga0070695_100007172 3300005545 Bacteria 6610
126 Ga0070695_100342865 3300005545 Unclassified 1117
127 Ga0070695_100502949 3300005545 Unclassified 938
128 Ga0070696_100071277 3300005546 Bacteria 2445
129 Ga0070696_100081818 3300005546 Bacteria 2288
130 Ga0070696_100388414 3300005546 Bacteria 1089
131 Ga0070693_100006610 3300005547 Bacteria 5628
132 Ga0070693_100010305 3300005547 Bacteria 4679
133 Ga0070693_100107936 3300005547 Bacteria 1707
134 Ga0070665_100002874 3300005548 Bacteria 18606
135 Ga0070665_100007383 3300005548 Bacteria 11183
136 Ga0070665_100010734 3300005548 Bacteria 9267
137 Ga0070704_100001327 3300005549 Bacteria 13101
138 Ga0070704_100019944 3300005549 Bacteria 4314
139 Ga0068855_100028779 3300005563 Bacteria 6647
140 Ga0068857_100149944 3300005577 Bacteria 2112
141 Ga0068854_100102089 3300005578 Unclassified 2151
142 Ga0068854_100132321 3300005578 Bacteria 1906
143 Ga0068854_100330656 3300005578 Bacteria 1241
144 Ga0068856_100004914 3300005614 Bacteria 13229
145 Ga0068856_100076866 3300005614 Bacteria 3307
146 Ga0070702_100031314 3300005615 Bacteria 2908
147 Ga0070702_100075566 3300005615 Bacteria 2003
148 Ga0070702_100101990 3300005615 Bacteria 1762
149 Ga0068852_100007280 3300005616 Bacteria 8069
150 Ga0068852_100026753 3300005616 Bacteria 4694
151 Ga0068852_100240044 3300005616 Bacteria 1731
152 Ga0068859_100001172 3300005617 Bacteria 26797
153 Ga0068859_100007142 3300005617 Bacteria 11338
154 Ga0068859_100037393 3300005617 Bacteria 4871
155 Ga0068859_100077083 3300005617 Bacteria 3374
156 Ga0068859_100268841 3300005617 Bacteria 1797
157 Ga0068859_100409592 3300005617 Bacteria 1452
158 Ga0068864_100002663 3300005618 Bacteria 14746
159 Ga0068864_100006458 3300005618 Bacteria 9605
160 Ga0068864_100011915 3300005618 Bacteria 7182
161 Ga0068864_100017297 3300005618 Bacteria 6009
162 Ga0068864_100048253 3300005618 Bacteria 3660
163 Ga0068864_100053038 3300005618 Bacteria 3497
164 Ga0068864_100082993 3300005618 Bacteria 2813
165 Ga0068864_100188438 3300005618 Bacteria 1890
166 Ga0068866_10001452 3300005718 Bacteria 10132
167 Ga0068866_10055564 3300005718 Bacteria 2034
168 Ga0068866_10129509 3300005718 Bacteria 1433
169 Ga0068861_100073760 3300005719 Bacteria 2652
170 Ga0068851_10001073 3300005834 Bacteria 11839
171 Ga0068851_10008538 3300005834 Bacteria 4740
172 Ga0068851_10222347 3300005834 Bacteria 1061
173 Ga0068870_10001220 3300005840 Bacteria 10345
174 Ga0068870_10196464 3300005840 Unclassified 1220
175 Ga0068863_100002857 3300005841 Bacteria 17111
176 Ga0068863_100009074 3300005841 Bacteria 9712
177 Ga0068863_100044347 3300005841 Bacteria 4221
178 Ga0068863_100056480 3300005841 Bacteria 3716
179 Ga0068863_100084840 3300005841 Bacteria 3001
180 Ga0068863_100086214 3300005841 Bacteria 2975
181 Ga0068863_100194706 3300005841 Bacteria 1949
182 Ga0068863_100337045 3300005841 Bacteria 1467
183 Ga0068858_100003418 3300005842 Bacteria 15791
184 Ga0068858_100032683 3300005842 Bacteria 4831
185 Ga0068858_100081612 3300005842 Bacteria 3005
186 Ga0068858_100105223 3300005842 Bacteria 2633
187 Ga0068858_100122180 3300005842 Bacteria 2436
188 Ga0068858_100149812 3300005842 Bacteria 2193
189 Ga0068860_100016447 3300005843 Bacteria 7212
190 Ga0068860_100025511 3300005843 Bacteria 5702
191 Ga0068860_100028894 3300005843 Bacteria 5335
192 Ga0068860_100029246 3300005843 Bacteria 5299
193 Ga0068860_100134539 3300005843 Bacteria 2374
194 Ga0068862_100015687 3300005844 Bacteria 6296
195 Ga0068862_100031529 3300005844 Bacteria 4475
196 Ga0068862_100041628 3300005844 Bacteria 3909
197 Ga0068862_100085113 3300005844 Bacteria 2748
198 Ga0068862_100185362 3300005844 Bacteria 1870
199 Ga0068862_100569074 3300005844 Bacteria 1084
200 Ga0070715_10003865 3300006163 Bacteria 4839
201 Ga0070716_100018313 3300006173 Bacteria 3646
202 Ga0070712_100051723 3300006175 Bacteria 2862
203 Ga0097621_100005645 3300006237 Bacteria 8826
204 Ga0097621_100009563 3300006237 Bacteria 7046
205 Ga0097621_100094791 3300006237 Bacteria 2503
206 Ga0097621_100100361 3300006237 Bacteria 2435
207 Ga0068871_100000551 3300006358 Bacteria 25532
208 Ga0068871_100003069 3300006358 Bacteria 11453
209 Ga0068871_100050549 3300006358 Bacteria 3363
210 Ga0068871_100086899 3300006358 Bacteria 2599
211 Ga0068871_100163861 3300006358 Bacteria 1902
212 Ga0068871_100259275 3300006358 Bacteria 1516
213 Ga0075428_100080658 3300006844 Bacteria 3551
214 Ga0075428_100108012 3300006844 Bacteria 3033
215 Ga0075430_100000550 3300006846 Bacteria 28484
216 Ga0075430_100007696 3300006846 Bacteria 9098
217 Ga0075431_100005396 3300006847 Bacteria 12626
218 Ga0075431_100242110 3300006847 Bacteria 1835
219 Ga0075433_10030502 3300006852 Bacteria 4601
220 Ga0075433_10068886 3300006852 Bacteria 3107
221 Ga0075434_100021939 3300006871 Bacteria 6214
222 Ga0075429_100000511 3300006880 Bacteria 29379
223 Ga0075429_100039718 3300006880 Bacteria 4095
224 Ga0068865_100003205 3300006881 Bacteria 9800
225 Ga0068865_100055704 3300006881 Bacteria 2752
226 Ga0068865_100074777 3300006881 Bacteria 2414
227 Ga0068865_100261117 3300006881 Bacteria 1371
228 Ga0075436_100035610 3300006914 Bacteria 3433
229 Ga0097620_100001172 3300006931 Bacteria 26797
230 Ga0097620_100007142 3300006931 Bacteria 11338
231 Ga0097620_100037393 3300006931 Bacteria 4871
232 Ga0097620_100077081 3300006931 Bacteria 3374
233 Ga0097620_100268828 3300006931 Bacteria 1797
234 Ga0097620_100409611 3300006931 Bacteria 1452
235 Ga0075435_100008207 3300007076 Bacteria 7481
236 Ga0099794_10015782 3300007265 Bacteria 3340
237 Ga0099794_10154035 3300007265 Bacteria 1167
238 Ga0105240_10007422 3300009093 Bacteria 15928
239 Ga0111539_10013382 3300009094 Bacteria 10256
240 Ga0111539_10070916 3300009094 Bacteria 4112
241 Ga0105245_10055737 3300009098 Bacteria 3551
242 Ga0105245_10129621 3300009098 Bacteria 2365
243 Ga0105247_10010369 3300009101 Bacteria 5637
244 Ga0114129_10068810 3300009147 Bacteria 4935
245 Ga0105241_10227580 3300009174 Bacteria 1571
246 Ga0105242_10001782 3300009176 Bacteria 16996
247 Ga0105242_10041480 3300009176 Bacteria 3713
248 Ga0105242_10222964 3300009176 Bacteria 1686
249 Ga0105248_10002637 3300009177 Bacteria 19937
250 Ga0105248_10198693 3300009177 Bacteria 2259
251 Ga0105248_10414506 3300009177 Bacteria 1517
252 Ga0105248_10688705 3300009177 Bacteria 1153
253 Ga0105237_10147303 3300009545 Bacteria 2349
254 Ga0105249_10049577 3300009553 Bacteria 3829
255 Ga0105249_10057803 3300009553 Bacteria 3554
256 Ga0105239_10301624 3300010375 Bacteria 1804
257 Ga0105239_10604944 3300010375 Unclassified 1250
258 Ga0105246_10304059 3300011119 Unclassified 1289
259 Ga0157370_10007918 3300013104 Bacteria 11509
260 Ga0157370_10025283 3300013104 Bacteria 5878
261 Ga0157369_10045838 3300013105 Bacteria 4753
262 Ga0157374_10000596 3300013296 Bacteria 32001
263 Ga0157374_10003531 3300013296 Bacteria 13155
264 Ga0157374_10582507 3300013296 Bacteria 1128
265 Ga0157378_10043444 3300013297 Bacteria 3990
266 Ga0157378_10117962 3300013297 Bacteria 2442
267 Ga0163162_10000806 3300013306 Bacteria 29097
268 Ga0163162_10109941 3300013306 Bacteria 2853
269 Ga0163162_10121295 3300013306 Bacteria 2719
270 Ga0157372_10002331 3300013307 Bacteria 20579
271 Ga0157372_10027510 3300013307 Bacteria 6195
272 Ga0157372_10071265 3300013307 Bacteria 3913
273 Ga0157372_10160040 3300013307 Bacteria 2602
274 Ga0157375_10003811 3300013308 Bacteria 13072
275 Ga0157375_10014883 3300013308 Bacteria 6953
276 Ga0157375_10094115 3300013308 Bacteria 3064
277 Ga0157375_10359397 3300013308 Bacteria 1622
278 Ga0163163_10004542 3300014325 Bacteria 11854
279 Ga0163163_10011269 3300014325 Bacteria 8102
280 Ga0163163_10013670 3300014325 Bacteria 7436
281 Ga0157380_10025621 3300014326 Bacteria 4473
282 Ga0157380_10069279 3300014326 Bacteria 2846
283 Ga0157380_10216133 3300014326 Unclassified 1712
284 Ga0157377_10268125 3300014745 Bacteria 1114
285 Ga0157379_10003325 3300014968 Bacteria 13621
286 Ga0157379_10009604 3300014968 Bacteria 8424
287 Ga0157376_10019433 3300014969 Bacteria 5236
288 Ga0157376_10042432 3300014969 Bacteria 3728
289 Ga0157376_10061004 3300014969 Bacteria 3169
290 Ga0207697_10003081 3300025315 Bacteria 8353
291 Ga0207656_10001807 3300025321 Bacteria 7116
292 Ga0207656_10063164 3300025321 Bacteria 1629
293 Ga0207653_10065008 3300025885 Bacteria 1238
294 Ga0207682_10000242 3300025893 Bacteria 24724
295 Ga0207682_10002765 3300025893 Bacteria 7773
296 Ga0207682_10048977 3300025893 Bacteria 1743
297 Ga0207692_10012700 3300025898 Bacteria 3625
298 Ga0207642_10022010 3300025899 Bacteria 2520
299 Ga0207642_10090296 3300025899 Unclassified 1511
300 Ga0207710_10028460 3300025900 Bacteria 2426
301 Ga0207680_10002437 3300025903 Bacteria 8677
302 Ga0207680_10008730 3300025903 Bacteria 4991
303 Ga0207680_10015307 3300025903 Bacteria 4000
304 Ga0207685_10005534 3300025905 Bacteria 3345
305 Ga0207699_10056467 3300025906 Bacteria 2340
306 Ga0207645_10001123 3300025907 Bacteria 22130
307 Ga0207645_10002011 3300025907 Bacteria 16329
308 Ga0207645_10031886 3300025907 Bacteria 3388
309 Ga0207645_10049460 3300025907 Bacteria 2684
310 Ga0207643_10005469 3300025908 Bacteria 6792
311 Ga0207643_10073500 3300025908 Bacteria 1971
312 Ga0207643_10117297 3300025908 Unclassified 1573
313 Ga0207705_10156517 3300025909 Bacteria 1710
314 Ga0207684_10013573 3300025910 Bacteria 7042
315 Ga0207684_10116171 3300025910 Bacteria 2292
316 Ga0207654_10050973 3300025911 Bacteria 2381
317 Ga0207707_10015357 3300025912 Bacteria 6668
318 Ga0207695_10373661 3300025913 Bacteria 1312
319 Ga0207693_10000104 3300025915 Bacteria 76023
320 Ga0207693_10006353 3300025915 Bacteria 9793
321 Ga0207660_10013758 3300025917 Bacteria 5310
322 Ga0207662_10005874 3300025918 Bacteria 6582
323 Ga0207662_10113794 3300025918 Bacteria 1690
324 Ga0207662_10247088 3300025918 Bacteria 1170
325 Ga0207657_10004654 3300025919 Bacteria 14496
326 Ga0207657_10040315 3300025919 Bacteria 4139
327 Ga0207652_10033282 3300025921 Bacteria 4339
328 Ga0207652_10195804 3300025921 Bacteria 1818
329 Ga0207646_10007938 3300025922 Bacteria 10710
330 Ga0207646_10182159 3300025922 Bacteria 1897
331 Ga0207681_10005369 3300025923 Bacteria 7872
332 Ga0207681_10118862 3300025923 Bacteria 1935
333 Ga0207650_10012311 3300025925 Bacteria 5903
334 Ga0207650_10013289 3300025925 Bacteria 5698
335 Ga0207650_10015751 3300025925 Bacteria 5271
336 Ga0207650_10016853 3300025925 Bacteria 5110
337 Ga0207650_10016873 3300025925 Bacteria 5107
338 Ga0207650_10050645 3300025925 Bacteria 3072
339 Ga0207650_10061370 3300025925 Bacteria 2807
340 Ga0207650_10404466 3300025925 Bacteria 1130
341 Ga0207659_10001235 3300025926 Bacteria 15308
342 Ga0207659_10006236 3300025926 Bacteria 7294
343 Ga0207659_10056912 3300025926 Bacteria 2801
344 Ga0207659_10068777 3300025926 Bacteria 2577
345 Ga0207687_10008617 3300025927 Bacteria 6670
346 Ga0207687_10011741 3300025927 Bacteria 5731
347 Ga0207687_10040880 3300025927 Bacteria 3181
348 Ga0207700_10000018 3300025928 Bacteria 191007
349 Ga0207664_10010626 3300025929 Bacteria 6506
350 Ga0207664_10030822 3300025929 Bacteria 4099
351 Ga0207644_10041489 3300025931 Bacteria 3255
352 Ga0207644_10162009 3300025931 Bacteria 1739
353 Ga0207644_10241578 3300025931 Bacteria 1438
354 Ga0207690_10249038 3300025932 Bacteria 1372
355 Ga0207706_10068189 3300025933 Bacteria 3130
356 Ga0207686_10020882 3300025934 Bacteria 3749
357 Ga0207686_10072370 3300025934 Bacteria 2221
358 Ga0207709_10128144 3300025935 Bacteria 1725
359 Ga0207670_10073666 3300025936 Bacteria 2368
360 Ga0207670_10099090 3300025936 Bacteria 2078
361 Ga0207670_10102691 3300025936 Bacteria 2045
362 Ga0207670_10127750 3300025936 Bacteria 1857
363 Ga0207669_10014976 3300025937 Bacteria 3900
364 Ga0207669_10057677 3300025937 Bacteria 2365
365 Ga0207669_10540084 3300025937 Bacteria 939
366 Ga0207704_10006554 3300025938 Bacteria 5440
367 Ga0207704_10006774 3300025938 Bacteria 5368
368 Ga0207704_10097240 3300025938 Bacteria 1952
369 Ga0207665_10033312 3300025939 Bacteria 3414
370 Ga0207665_10082520 3300025939 Bacteria 2215
371 Ga0207691_10000216 3300025940 Bacteria 55947
372 Ga0207691_10000454 3300025940 Bacteria 40505
373 Ga0207691_10001401 3300025940 Bacteria 24112
374 Ga0207691_10023315 3300025940 Bacteria 5826
375 Ga0207691_10023778 3300025940 Bacteria 5767
376 Ga0207691_10078162 3300025940 Bacteria 2979
377 Ga0207691_10190935 3300025940 Bacteria 1786
378 Ga0207711_10000572 3300025941 Bacteria 37502
379 Ga0207711_10003092 3300025941 Bacteria 14511
380 Ga0207689_10000963 3300025942 Bacteria 27633
381 Ga0207689_10006312 3300025942 Bacteria 10501
382 Ga0207689_10055133 3300025942 Bacteria 3272
383 Ga0207689_10259174 3300025942 Bacteria 1438
384 Ga0207661_10125959 3300025944 Bacteria 2188
385 Ga0207661_10634138 3300025944 Unclassified 982
386 Ga0207679_10044939 3300025945 Bacteria 3191
387 Ga0207679_10242841 3300025945 Bacteria 1527
388 Ga0207667_10281976 3300025949 Bacteria 1698
389 Ga0207651_10000642 3300025960 Bacteria 14819
390 Ga0207651_10002919 3300025960 Bacteria 8260
391 Ga0207651_10005325 3300025960 Bacteria 6594
392 Ga0207651_10237981 3300025960 Unclassified 1482
393 Ga0207712_10036789 3300025961 Bacteria 3336
394 Ga0207668_10000894 3300025972 Bacteria 18003
395 Ga0207668_10025686 3300025972 Bacteria 3814
396 Ga0207668_10027692 3300025972 Bacteria 3695
397 Ga0207668_10056834 3300025972 Bacteria 2727
398 Ga0207640_10104584 3300025981 Bacteria 1993
399 Ga0207640_10129810 3300025981 Bacteria 1820
400 Ga0207658_10032283 3300025986 Bacteria 3725
401 Ga0207658_10059694 3300025986 Bacteria 2842
402 Ga0207658_10101393 3300025986 Bacteria 2256
403 Ga0207658_10121416 3300025986 Bacteria 2084
404 Ga0207658_10151167 3300025986 Bacteria 1892
405 Ga0207658_10242326 3300025986 Bacteria 1528
406 Ga0207677_10000469 3300026023 Bacteria 26525
407 Ga0207677_10001861 3300026023 Bacteria 11157
408 Ga0207677_10120424 3300026023 Bacteria 1973
409 Ga0207677_10253544 3300026023 Bacteria 1430
410 Ga0207703_10002876 3300026035 Bacteria 14649
411 Ga0207703_10009883 3300026035 Bacteria 7485
412 Ga0207703_10093198 3300026035 Bacteria 2536
413 Ga0207703_10105239 3300026035 Bacteria 2398
414 Ga0207703_10126170 3300026035 Bacteria 2204
415 Ga0207639_10009864 3300026041 Bacteria 6596
416 Ga0207678_10031271 3300026067 Bacteria 4644
417 Ga0207678_10272642 3300026067 Bacteria 1451
418 Ga0207708_10053128 3300026075 Bacteria 3086
419 Ga0207702_10035970 3300026078 Bacteria 4141
420 Ga0207702_10093771 3300026078 Bacteria 2634
421 Ga0207702_10287987 3300026078 Bacteria 1555
422 Ga0207641_10008544 3300026088 Bacteria 8457
423 Ga0207641_10012275 3300026088 Bacteria 7029
424 Ga0207641_10063674 3300026088 Bacteria 3150
425 Ga0207641_10117374 3300026088 Bacteria 2369
426 Ga0207641_10446741 3300026088 Bacteria 1249
427 Ga0207648_10000763 3300026089 Bacteria 36138
428 Ga0207648_10000829 3300026089 Bacteria 34794
429 Ga0207648_10020296 3300026089 Bacteria 5986
430 Ga0207648_10030919 3300026089 Bacteria 4737
431 Ga0207676_10002530 3300026095 Bacteria 13039
432 Ga0207676_10002692 3300026095 Bacteria 12633
433 Ga0207676_10023341 3300026095 Bacteria 4562
434 Ga0207674_10105497 3300026116 Bacteria 2796
435 Ga0207674_10118474 3300026116 Bacteria 2618
436 Ga0207675_100024243 3300026118 Bacteria 5642
437 Ga0207675_100086145 3300026118 Bacteria 2950
438 Ga0207675_100127694 3300026118 Bacteria 2409
439 Ga0207675_100144068 3300026118 Bacteria 2265
440 Ga0207675_100147753 3300026118 Bacteria 2236
441 Ga0207675_100725849 3300026118 Bacteria 1004
442 Ga0207683_10000401 3300026121 Bacteria 39796
443 Ga0207683_10000705 3300026121 Bacteria 30486
444 Ga0207683_10001133 3300026121 Bacteria 24266
445 Ga0207683_10013560 3300026121 Bacteria 6953
446 Ga0207698_10203015 3300026142 Unclassified 1777
447 Ga0207698_10484738 3300026142 Bacteria 1200
448 Ga0209969_1001086 3300027360 Bacteria 3731
449 Ga0209981_1001444 3300027378 Bacteria 3001
450 Ga0209996_1012158 3300027395 Bacteria 1155
451 Ga0210000_1001892 3300027462 Bacteria 2958
452 Ga0209995_1001597 3300027471 Bacteria 3511
453 Ga0209968_1002375 3300027526 Bacteria 2843
454 Ga0209983_1025328 3300027665 Bacteria 1251
455 Ga0209971_1040499 3300027682 Bacteria 1121
456 Ga0209966_1005660 3300027695 Bacteria 2148
457 Ga0207428_10070921 3300027907 Bacteria 2737
458 Ga0268266_10005748 3300028379 Bacteria 11481
459 Ga0268266_10017606 3300028379 Bacteria 6093
460 Ga0268265_10075945 3300028380 Bacteria 2634
461 Ga0268264_10007810 3300028381 Bacteria 8902
462 Ga0268264_10010411 3300028381 Bacteria 7688
463 Ga0268264_10014615 3300028381 Bacteria 6450
464 Ga0268264_10060412 3300028381 Bacteria 3177
465 Ga0268264_10101663 3300028381 Bacteria 2499
466 Ga0268264_10154146 3300028381 Bacteria 2063
467 Ga0307408_100003640 3300031548 Bacteria 10503
468 Ga0307405_10003582 3300031731 Bacteria 7170
469 Ga0307413_10012513 3300031824 Bacteria 4226
470 Ga0307410_10000615 3300031852 Bacteria 14669
471 Ga0307406_10002939 3300031901 Bacteria 9279
472 Ga0307407_10000267 3300031903 Bacteria 15354
473 Ga0307412_10007003 3300031911 Bacteria 6400
474 Ga0307412_10472663 3300031911 Unclassified 1038
475 Ga0307409_100005162 3300031995 Bacteria 7465
476 Ga0307416_100008868 3300032002 Bacteria 6529
477 Ga0307414_10195151 3300032004 Bacteria 1642
478 Ga0307411_10022388 3300032005 Bacteria 3719
479 Ga0307415_100000721 3300032126 Bacteria 14812
480 Ga0373938_0018515 3300034957 Bacteria 1382
481 Ga0373934_0038382 3300035086 Bacteria 1886
482 Ga0373923_0000205 3300035111 Bacteria 12151
483 Ga0373953_0001394 3300035117 Bacteria 6962
484 Ga0373953_0012794 3300035117 Bacteria 2980
485 Ga0373954_0000002 3300035118 Bacteria 147478
486 Ga0373954_0002022 3300035118 Bacteria 8424
487 Ga0373957_0008010 3300035120 Bacteria 3406
488 Ga0373946_0032003 3300035171 Bacteria 2110
489 Ga0373955_0005365 3300035172 Bacteria 5755
490 Ga0373955_0119781 3300035172 Bacteria 1529
491 Ga0373924_0126983 3300035410 Unclassified 1108
492 Ga0373931_0016875 3300035691 Bacteria 3601
493 Ga0373931_0066765 3300035691 Bacteria 1953
494 Ga0373935_0039146 3300035692 Bacteria 2971
495 Ga0373935_0086357 3300035692 Bacteria 2047
496 Ga0373935_0098112 3300035692 Bacteria 1928
497 Ga0373927_0103290 3300035695 Bacteria 1854
498 Ga0373933_0000657 3300035724 Bacteria 21450
499 Ga0373933_0017492 3300035724 Bacteria 4021
500 Ga0373947_0030883 3300035725 Bacteria 3150
501 Ga0373947_0055504 3300035725 Bacteria 2392
502 Ga0373937_0000358 3300036401 Bacteria 42468
503 Ga0373937_0014725 3300036401 Bacteria 6904
504 Ga0373937_0021545 3300036401 Bacteria 5784
505 Ga0373937_0025596 3300036401 Bacteria 5329
506 Ga0373937_0302335 3300036401 Bacteria 1512
507 Ga0373925_0009867 3300037068 Bacteria 6937
508 Ga0373925_0278958 3300037068 Unclassified 1345
509 Ga0373925_0285317 3300037068 Bacteria 1330
510 Ga0436365_0686227 3300039437 Bacteria 3590
511 Ga0439461_0002213 3300041410 Bacteria 3086
512 Ga0451807_1806802 3300041486 Bacteria 3040
513 Ga0439431_0034581 3300041997 Bacteria 1267
514 Ga0439441_000163 3300042001 Bacteria 5870
515 Ga0439441_003222 3300042001 Bacteria 2384
516 Ga0439446_0000176 3300042156 Bacteria 11244
517 Ga0439434_0001633 3300042435 Bacteria 6483
518 Ga0439435_0000026 3300042436 Bacteria 16073
519 Ga0439435_0013765 3300042436 Bacteria 1986
520 Ga0451577_0452460 3300042876 Bacteria 1166
521 Ga0451576_0034631 3300045051 Bacteria 5362
522 Ga0451576_0406890 3300045051 Bacteria 1427
523 Ga0466967_0057018 3300045976 Bacteria 3447
524 Ga0495592_0003821 3300046454 Bacteria 10887
525 Ga0495592_0309309 3300046454 Bacteria 1025
526 Ga0495603_0077020 3300046455 Bacteria 1957
527 Ga0495653_0222837 3300046463 Bacteria 1267
528 Ga0495580_0055990 3300046472 Bacteria 2777
529 Ga0495580_0150064 3300046472 Bacteria 1615
530 Ga0495580_0187079 3300046472 Bacteria 1429
531 Ga0495582_0003693 3300046473 Bacteria 8618
532 Ga0495662_0008976 3300046476 Bacteria 4910
533 Ga0495662_0025122 3300046476 Bacteria 2876
534 Ga0495662_0027173 3300046476 Bacteria 2765
535 Ga0495594_0050679 3300046499 Bacteria 2284
536 Ga0495608_0002044 3300046511 Bacteria 14501
537 Ga0495618_0022560 3300046514 Bacteria 3888
538 Ga0495628_0016487 3300046516 Bacteria 6161
539 Ga0495630_0001185 3300046517 Bacteria 17975
540 Ga0495630_0039270 3300046517 Bacteria 3540
541 Ga0495652_0033401 3300046529 Bacteria 4491
542 Ga0495665_0029121 3300046531 Bacteria 2959
543 Ga0495640_0000808 3300046533 Bacteria 23777
544 Ga0495640_0004665 3300046533 Bacteria 10928
545 Ga0495586_0000440 3300046535 Bacteria 24985
546 Ga0495621_0003552 3300046539 Bacteria 4302
547 Ga0495645_0025778 3300046543 Bacteria 4268
548 Ga0495667_0001153 3300046559 Bacteria 17225
549 Ga0495634_0002587 3300046642 Bacteria 14917
550 Ga0495634_0059578 3300046642 Bacteria 2543
551 Ga0495635_0082244 3300046663 Bacteria 2203
552 Ga0495659_0047479 3300046664 Unclassified 1553
553 Ga0495623_0052380 3300046679 Bacteria 2579
554 Ga0495658_0026403 3300046683 Bacteria 3112
555 Ga0495613_0025295 3300046689 Bacteria 4423
556 Ga0495613_0093433 3300046689 Bacteria 2177
557 Ga0495624_0034028 3300046690 Bacteria 3299
558 Ga0495600_0006681 3300046809 Bacteria 7029
559 Ga0495604_0103336 3300047317 Bacteria 2090
560 Ga0495674_0123030 3300047319 Bacteria 2191
561 Ga0495674_0218376 3300047319 Bacteria 1577
562 Ga0495680_0001572 3300047322 Bacteria 24459
563 Ga0495680_0044568 3300047322 Bacteria 3507
564 Ga0495684_0018458 3300047471 Bacteria 5374
565 Ga0495593_0057647 3300047673 Bacteria 2039
566 Ga0495602_0097632 3300048088 Bacteria 2420
567 Ga0495614_0078529 3300048089 Bacteria 1428
568 Ga0496101_0136489 3300048904 Bacteria 1867
569 Ga0496103_0042137 3300048906 Bacteria 2808
570 Ga0496104_0416490 3300048907 Bacteria 1256
571 Ga0496105_0459561 3300048908 Bacteria 1004
572 Ga0496106_0084317 3300048909 Bacteria 2445
573 Ga0496108_0008141 3300048911 Bacteria 8503
574 Ga0496108_0017069 3300048911 Bacteria 5935
575 Ga0496109_0027634 3300048912 Bacteria 5069
576 Ga0496109_0040364 3300048912 Bacteria 4227
577 Ga0496109_0239075 3300048912 Bacteria 1709
578 Ga0496112_0189653 3300048915 Bacteria 2018
579 Ga0496114_0187853 3300048917 Bacteria 1807
580 Ga0496114_0222221 3300048917 Bacteria 1658
581 Ga0496115_0116217 3300048918 Bacteria 2200
582 Ga0501040_0018725 3300049576 Bacteria 4599
583 Ga0501040_0072432 3300049576 Bacteria 2380
584 Ga0501048_0252032 3300049582 Bacteria 1253
585 Ga0501068_0212842 3300049584 Bacteria 1228
586 Ga0501074_0299992 3300049590 Bacteria 1141
587 Ga0501079_0028118 3300049741 Bacteria 4314
588 nmdc:mga05p37_209_c1 3300050507 Bacteria 59030
589 nmdc:mga05p37_99504_c1 3300050507 Bacteria 3581
590 nmdc:mga09592_150_c1 3300050508 Bacteria 47613
591 nmdc:mga0qj67_20035_c1 3300050509 Bacteria 5118
592 nmdc:mga0qj67_623_c1 3300050509 Bacteria 24285
593 nmdc:mga06r32_113730_c1 3300050510 Bacteria 2664
594 nmdc:mga06r32_187461_c1 3300050510 Bacteria 2056
595 nmdc:mga08y16_30907_c1 3300050511 Bacteria 5631
596 nmdc:mga0n895_14216_c1 3300050512 Bacteria 7219
597 nmdc:mga0rr50_6927_c1 3300050513 Bacteria 6949
598 nmdc:mga08x19_223567_c1 3300050514 Bacteria 1294
599 nmdc:mga08x19_50596_c1 3300050514 Bacteria 2666
600 nmdc:mga0a205_43040_c1 3300050515 Bacteria 4354
601 Ga0495601_0005497 3300053077 Bacteria 7389
602 Ga0495601_0083732 3300053077 Bacteria 2049
603 Ga0495595_0045109 3300053084 Bacteria 2027
604 Ga0495595_0073078 3300053084 Bacteria 1624
605 Ga0495619_0009966 3300053085 Bacteria 5984
606 Ga0500566_0122685 3300053094 Bacteria 1399
607 Ga0590077_004080 3300059426 Bacteria 3007
608 Ga0530510_0284777 3300061734 Bacteria 1235
609 Ga0157380_10007998
610 Ga0065707_10108281
611 Ga0065707_10251239
612 Ga0070676_10001948
613 Ga0070676_10093948
614 Ga0070676_10235796
615 Ga0070683_100045484
616 Ga0070683_100098767
617 Ga0070690_100002869
618 Ga0070690_100193293
619 Ga0070690_100402209
620 Ga0070670_100003760
621 Ga0070670_100020212
622 Ga0070670_100023997
623 Ga0070670_100044539
624 Ga0070670_100175821
625 Ga0070677_10026492
626 Ga0068869_100002327
627 Ga0068869_100008953
628 Ga0068869_100029310
629 Ga0068869_100118177
630 Ga0068869_100229020
631 Ga0070666_10000816
632 Ga0070666_10010730
633 Ga0070666_10013432
634 Ga0070680_100036078
635 Ga0070680_100045898
636 Ga0068868_100010780
637 Ga0068868_100023100
638 Ga0068868_100032040
639 Ga0070660_100413139
640 Ga0070689_100020757
641 Ga0070689_100029842
642 Ga0070689_100080660
643 Ga0070689_100120950
644 Ga0070689_100342332
645 Ga0070687_100320358
646 Ga0070692_10153622
647 Ga0070668_100002425
648 Ga0070668_100002584
649 Ga0070668_100004081
650 Ga0070668_100104800
651 Ga0070668_100247837
652 Ga0070669_100001114
653 Ga0070669_100035416
654 Ga0070675_100003508
655 Ga0070675_100004648
656 Ga0070675_100008431
657 Ga0070675_100012798
658 Ga0070675_100030522
659 Ga0070675_100094313
660 Ga0070675_100206915
661 Ga0070671_100008929
662 Ga0070671_100012399
663 Ga0070671_100052153
664 Ga0070671_100236369
665 Ga0070674_100000236
666 Ga0070674_100006028
667 Ga0070674_100023304
668 Ga0070674_100026075
669 Ga0070674_100079709
670 Ga0070673_100001162
671 Ga0070673_100001337
672 Ga0070673_100003476
673 Ga0070673_100036692
674 Ga0070673_100113604
675 Ga0070688_100002648
676 Ga0070688_100089058
677 Ga0070667_100006712
678 Ga0070667_100008845
679 Ga0070667_100204993
680 Ga0070667_100259025
681 Ga0070714_100006057
682 Ga0070714_100069918
683 Ga0070713_100000114
684 Ga0070713_100059822
685 Ga0070710_10009952
686 Ga0070710_10273250
687 Ga0070711_100003858
688 Ga0070711_100071113
689 Ga0070694_100004678
690 Ga0070694_100203860
691 Ga0070694_100326779
692 Ga0070708_100002053
693 Ga0070708_100051904
694 Ga0070708_100589878
695 Ga0070663_100085802
696 Ga0070663_100238267
697 Ga0070678_100000447
698 Ga0070678_100004752
699 Ga0070678_100036592
700 Ga0070678_100425627
701 Ga0070662_100319583
702 Ga0070681_10004051
703 Ga0070681_10041698
704 Ga0068867_100001541
705 Ga0068867_100002023
706 Ga0068867_100016105
707 Ga0070685_10001360
708 Ga0070685_10029391
709 Ga0070706_100181600
710 Ga0070707_100033339
711 Ga0070707_100037001
712 Ga0070707_100299977
713 Ga0070698_100045367
714 Ga0070698_100101567
715 Ga0070698_100151474
716 Ga0070698_100177912
717 Ga0070699_100138676
718 Ga0070699_100189541
719 Ga0070699_100254034
720 Ga0070699_100258735
721 Ga0070679_100010697
722 Ga0070679_100468983
723 Ga0070684_100013383
724 Ga0070684_100093302
725 Ga0070697_100013851
726 Ga0070697_100379527
727 Ga0068853_100000689
728 Ga0068853_100077060
729 Ga0070672_100061540
730 Ga0070672_100077909
731 Ga0070672_100078858
732 Ga0070686_100109330
733 Ga0070695_100007172
734 Ga0070695_100342865
735 Ga0070695_100502949
736 Ga0070696_100071277
737 Ga0070696_100081818
738 Ga0070696_100388414
739 Ga0070693_100006610
740 Ga0070693_100010305
741 Ga0070693_100107936
742 Ga0070665_100002874
743 Ga0070665_100007383
744 Ga0070665_100010734
745 Ga0070704_100001327
746 Ga0070704_100019944
747 Ga0068855_100028779
748 Ga0068857_100149944
749 Ga0068854_100102089
750 Ga0068854_100132321
751 Ga0068854_100330656
752 Ga0068856_100004914
753 Ga0068856_100076866
754 Ga0070702_100031314
755 Ga0070702_100075566
756 Ga0070702_100101990
757 Ga0068852_100007280
758 Ga0068852_100026753
759 Ga0068852_100240044
760 Ga0068859_100001172
761 Ga0068859_100007142
762 Ga0068859_100037393
763 Ga0068859_100077083
764 Ga0068859_100268841
765 Ga0068859_100409592
766 Ga0068864_100002663
767 Ga0068864_100006458
768 Ga0068864_100011915
769 Ga0068864_100017297
770 Ga0068864_100048253
771 Ga0068864_100053038
772 Ga0068864_100082993
773 Ga0068864_100188438
774 Ga0068866_10001452
775 Ga0068866_10055564
776 Ga0068866_10129509
777 Ga0068861_100073760
778 Ga0068851_10001073
779 Ga0068851_10008538
780 Ga0068851_10222347
781 Ga0068870_10001220
782 Ga0068870_10196464
783 Ga0068863_100002857
784 Ga0068863_100009074
785 Ga0068863_100044347
786 Ga0068863_100056480
787 Ga0068863_100084840
788 Ga0068863_100086214
789 Ga0068863_100194706
790 Ga0068863_100337045
791 Ga0068858_100003418
792 Ga0068858_100032683
793 Ga0068858_100081612
794 Ga0068858_100105223
795 Ga0068858_100122180
796 Ga0068858_100149812
797 Ga0068860_100016447
798 Ga0068860_100025511
799 Ga0068860_100028894
800 Ga0068860_100029246
801 Ga0068860_100134539
802 Ga0068862_100015687
803 Ga0068862_100031529
804 Ga0068862_100041628
805 Ga0068862_100085113
806 Ga0068862_100185362
807 Ga0068862_100569074
808 Ga0070715_10003865
809 Ga0070716_100018313
810 Ga0070712_100051723
811 Ga0097621_100005645
812 Ga0097621_100009563
813 Ga0097621_100094791
814 Ga0097621_100100361
815 Ga0068871_100000551
816 Ga0068871_100003069
817 Ga0068871_100050549
818 Ga0068871_100086899
819 Ga0068871_100163861
820 Ga0068871_100259275
821 Ga0075428_100080658
822 Ga0075428_100108012
823 Ga0075430_100000550
824 Ga0075430_100007696
825 Ga0075431_100005396
826 Ga0075431_100242110
827 Ga0075433_10030502
828 Ga0075433_10068886
829 Ga0075434_100021939
830 Ga0075429_100000511
831 Ga0075429_100039718
832 Ga0068865_100003205
833 Ga0068865_100055704
834 Ga0068865_100074777
835 Ga0068865_100261117
836 Ga0075436_100035610
837 Ga0097620_100001172
838 Ga0097620_100007142
839 Ga0097620_100037393
840 Ga0097620_100077081
841 Ga0097620_100268828
842 Ga0097620_100409611
843 Ga0075435_100008207
844 Ga0099794_10015782
845 Ga0099794_10154035
846 Ga0105240_10007422
847 Ga0111539_10013382
848 Ga0111539_10070916
849 Ga0105245_10055737
850 Ga0105245_10129621
851 Ga0105247_10010369
852 Ga0114129_10068810
853 Ga0105241_10227580
854 Ga0105242_10001782
855 Ga0105242_10041480
856 Ga0105242_10222964
857 Ga0105248_10002637
858 Ga0105248_10198693
859 Ga0105248_10414506
860 Ga0105248_10688705
861 Ga0105237_10147303
862 Ga0105249_10049577
863 Ga0105249_10057803
864 Ga0105239_10301624
865 Ga0105239_10604944
866 Ga0105246_10304059
867 Ga0157370_10007918
868 Ga0157370_10025283
869 Ga0157369_10045838
870 Ga0157374_10000596
871 Ga0157374_10003531
872 Ga0157374_10582507
873 Ga0157378_10043444
874 Ga0157378_10117962
875 Ga0163162_10000806
876 Ga0163162_10109941
877 Ga0163162_10121295
878 Ga0157372_10002331
879 Ga0157372_10027510
880 Ga0157372_10071265
881 Ga0157372_10160040
882 Ga0157375_10003811
883 Ga0157375_10014883
884 Ga0157375_10094115
885 Ga0157375_10359397
886 Ga0163163_10004542
887 Ga0163163_10011269
888 Ga0163163_10013670
889 Ga0157380_10025621
890 Ga0157380_10069279
891 Ga0157380_10216133
892 Ga0157377_10268125
893 Ga0157379_10003325
894 Ga0157379_10009604
895 Ga0157376_10019433
896 Ga0157376_10042432
897 Ga0157376_10061004
898 Ga0207697_10003081
899 Ga0207656_10001807
900 Ga0207656_10063164
901 Ga0207653_10065008
902 Ga0207682_10000242
903 Ga0207682_10002765
904 Ga0207682_10048977
905 Ga0207692_10012700
906 Ga0207642_10022010
907 Ga0207642_10090296
908 Ga0207710_10028460
909 Ga0207680_10002437
910 Ga0207680_10008730
911 Ga0207680_10015307
912 Ga0207685_10005534
913 Ga0207699_10056467
914 Ga0207645_10001123
915 Ga0207645_10002011
916 Ga0207645_10031886
917 Ga0207645_10049460
918 Ga0207643_10005469
919 Ga0207643_10073500
920 Ga0207643_10117297
921 Ga0207705_10156517
922 Ga0207684_10013573
923 Ga0207684_10116171
924 Ga0207654_10050973
925 Ga0207707_10015357
926 Ga0207695_10373661
927 Ga0207693_10000104
928 Ga0207693_10006353
929 Ga0207660_10013758
930 Ga0207662_10005874
931 Ga0207662_10113794
932 Ga0207662_10247088
933 Ga0207657_10004654
934 Ga0207657_10040315
935 Ga0207652_10033282
936 Ga0207652_10195804
937 Ga0207646_10007938
938 Ga0207646_10182159
939 Ga0207681_10005369
940 Ga0207681_10118862
941 Ga0207650_10012311
942 Ga0207650_10013289
943 Ga0207650_10015751
944 Ga0207650_10016853
945 Ga0207650_10016873
946 Ga0207650_10050645
947 Ga0207650_10061370
948 Ga0207650_10404466
949 Ga0207659_10001235
950 Ga0207659_10006236
951 Ga0207659_10056912
952 Ga0207659_10068777
953 Ga0207687_10008617
954 Ga0207687_10011741
955 Ga0207687_10040880
956 Ga0207700_10000018
957 Ga0207664_10010626
958 Ga0207664_10030822
959 Ga0207644_10041489
960 Ga0207644_10162009
961 Ga0207644_10241578
962 Ga0207690_10249038
963 Ga0207706_10068189
964 Ga0207686_10020882
965 Ga0207686_10072370
966 Ga0207709_10128144
967 Ga0207670_10073666
968 Ga0207670_10099090
969 Ga0207670_10102691
970 Ga0207670_10127750
971 Ga0207669_10014976
972 Ga0207669_10057677
973 Ga0207669_10540084
974 Ga0207704_10006554
975 Ga0207704_10006774
976 Ga0207704_10097240
977 Ga0207665_10033312
978 Ga0207665_10082520
979 Ga0207691_10000216
980 Ga0207691_10000454
981 Ga0207691_10001401
982 Ga0207691_10023315
983 Ga0207691_10023778
984 Ga0207691_10078162
985 Ga0207691_10190935
986 Ga0207711_10000572
987 Ga0207711_10003092
988 Ga0207689_10000963
989 Ga0207689_10006312
990 Ga0207689_10055133
991 Ga0207689_10259174
992 Ga0207661_10125959
993 Ga0207661_10634138
994 Ga0207679_10044939
995 Ga0207679_10242841
996 Ga0207667_10281976
997 Ga0207651_10000642
998 Ga0207651_10002919
999 Ga0207651_10005325
1000 Ga0207651_10237981
1001 Ga0207712_10036789
1002 Ga0207668_10000894
1003 Ga0207668_10025686
1004 Ga0207668_10027692
1005 Ga0207668_10056834
1006 Ga0207640_10104584
1007 Ga0207640_10129810
1008 Ga0207658_10032283
1009 Ga0207658_10059694
1010 Ga0207658_10101393
1011 Ga0207658_10121416
1012 Ga0207658_10151167
1013 Ga0207658_10242326
1014 Ga0207677_10000469
1015 Ga0207677_10001861
1016 Ga0207677_10120424
1017 Ga0207677_10253544
1018 Ga0207703_10002876
1019 Ga0207703_10009883
1020 Ga0207703_10093198
1021 Ga0207703_10105239
1022 Ga0207703_10126170
1023 Ga0207639_10009864
1024 Ga0207678_10031271
1025 Ga0207678_10272642
1026 Ga0207708_10053128
1027 Ga0207702_10035970
1028 Ga0207702_10093771
1029 Ga0207702_10287987
1030 Ga0207641_10008544
1031 Ga0207641_10012275
1032 Ga0207641_10063674
1033 Ga0207641_10117374
1034 Ga0207641_10446741
1035 Ga0207648_10000763
1036 Ga0207648_10000829
1037 Ga0207648_10020296
1038 Ga0207648_10030919
1039 Ga0207676_10002530
1040 Ga0207676_10002692
1041 Ga0207676_10023341
1042 Ga0207674_10105497
1043 Ga0207674_10118474
1044 Ga0207675_100024243
1045 Ga0207675_100086145
1046 Ga0207675_100127694
1047 Ga0207675_100144068
1048 Ga0207675_100147753
1049 Ga0207675_100725849
1050 Ga0207683_10000401
1051 Ga0207683_10000705
1052 Ga0207683_10001133
1053 Ga0207683_10013560
1054 Ga0207698_10203015
1055 Ga0207698_10484738
1056 Ga0209969_1001086
1057 Ga0209981_1001444
1058 Ga0209996_1012158
1059 Ga0210000_1001892
1060 Ga0209995_1001597
1061 Ga0209968_1002375
1062 Ga0209983_1025328
1063 Ga0209971_1040499
1064 Ga0209966_1005660
1065 Ga0207428_10070921
1066 Ga0268266_10005748
1067 Ga0268266_10017606
1068 Ga0268265_10075945
1069 Ga0268264_10007810
1070 Ga0268264_10010411
1071 Ga0268264_10014615
1072 Ga0268264_10060412
1073 Ga0268264_10101663
1074 Ga0268264_10154146
1075 Ga0307408_100003640
1076 Ga0307405_10003582
1077 Ga0307413_10012513
1078 Ga0307410_10000615
1079 Ga0307406_10002939
1080 Ga0307407_10000267
1081 Ga0307412_10007003
1082 Ga0307412_10472663
1083 Ga0307409_100005162
1084 Ga0307416_100008868
1085 Ga0307414_10195151
1086 Ga0307411_10022388
1087 Ga0307415_100000721
1088 Ga0373938_0018515
1089 Ga0373934_0038382
1090 Ga0373923_0000205
1091 Ga0373953_0001394
1092 Ga0373953_0012794
1093 Ga0373954_0000002
1094 Ga0373954_0002022
1095 Ga0373957_0008010
1096 Ga0373946_0032003
1097 Ga0373955_0005365
1098 Ga0373955_0119781
1099 Ga0373924_0126983
1100 Ga0373931_0016875
1101 Ga0373931_0066765
1102 Ga0373935_0039146
1103 Ga0373935_0086357
1104 Ga0373935_0098112
1105 Ga0373927_0103290
1106 Ga0373933_0000657
1107 Ga0373933_0017492
1108 Ga0373947_0030883
1109 Ga0373947_0055504
1110 Ga0373937_0000358
1111 Ga0373937_0014725
1112 Ga0373937_0021545
1113 Ga0373937_0025596
1114 Ga0373937_0302335
1115 Ga0373925_0009867
1116 Ga0373925_0278958
1117 Ga0373925_0285317
1118 Ga0436365_0686227
1119 Ga0439461_0002213
1120 Ga0451807_1806802
1121 Ga0439431_0034581
1122 Ga0439441_000163
1123 Ga0439441_003222
1124 Ga0439446_0000176
1125 Ga0439434_0001633
1126 Ga0439435_0000026
1127 Ga0439435_0013765
1128 Ga0451577_0452460
1129 Ga0451576_0034631
1130 Ga0451576_0406890
1131 Ga0466967_0057018
1132 Ga0495592_0003821
1133 Ga0495592_0309309
1134 Ga0495603_0077020
1135 Ga0495653_0222837
1136 Ga0495580_0055990
1137 Ga0495580_0150064
1138 Ga0495580_0187079
1139 Ga0495582_0003693
1140 Ga0495662_0008976
1141 Ga0495662_0025122
1142 Ga0495662_0027173
1143 Ga0495594_0050679
1144 Ga0495608_0002044
1145 Ga0495618_0022560
1146 Ga0495628_0016487
1147 Ga0495630_0001185
1148 Ga0495630_0039270
1149 Ga0495652_0033401
1150 Ga0495665_0029121
1151 Ga0495640_0000808
1152 Ga0495640_0004665
1153 Ga0495586_0000440
1154 Ga0495621_0003552
1155 Ga0495645_0025778
1156 Ga0495667_0001153
1157 Ga0495634_0002587
1158 Ga0495634_0059578
1159 Ga0495635_0082244
1160 Ga0495659_0047479
1161 Ga0495623_0052380
1162 Ga0495658_0026403
1163 Ga0495613_0025295
1164 Ga0495613_0093433
1165 Ga0495624_0034028
1166 Ga0495600_0006681
1167 Ga0495604_0103336
1168 Ga0495674_0123030
1169 Ga0495674_0218376
1170 Ga0495680_0001572
1171 Ga0495680_0044568
1172 Ga0495684_0018458
1173 Ga0495593_0057647
1174 Ga0495602_0097632
1175 Ga0495614_0078529
1176 Ga0496101_0136489
1177 Ga0496103_0042137
1178 Ga0496104_0416490
1179 Ga0496105_0459561
1180 Ga0496106_0084317
1181 Ga0496108_0008141
1182 Ga0496108_0017069
1183 Ga0496109_0027634
1184 Ga0496109_0040364
1185 Ga0496109_0239075
1186 Ga0496112_0189653
1187 Ga0496114_0187853
1188 Ga0496114_0222221
1189 Ga0496115_0116217
1190 Ga0501040_0018725
1191 Ga0501040_0072432
1192 Ga0501048_0252032
1193 Ga0501068_0212842
1194 Ga0501074_0299992
1195 Ga0501079_0028118
1196 nmdc:mga05p37_209_c1
1197 nmdc:mga05p37_99504_c1
1198 nmdc:mga09592_150_c1
1199 nmdc:mga0qj67_20035_c1
1200 nmdc:mga0qj67_623_c1
1201 nmdc:mga06r32_113730_c1
1202 nmdc:mga06r32_187461_c1
1203 nmdc:mga08y16_30907_c1
1204 nmdc:mga0n895_14216_c1
1205 nmdc:mga0rr50_6927_c1
1206 nmdc:mga08x19_223567_c1
1207 nmdc:mga08x19_50596_c1
1208 nmdc:mga0a205_43040_c1
1209 Ga0495601_0005497
1210 Ga0495601_0083732
1211 Ga0495595_0045109
1212 Ga0495595_0073078
1213 Ga0495619_0009966
1214 Ga0500566_0122685
1215 Ga0590077_004080
1216 Ga0530510_0284777

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01063

Aminotran_4

Amino-transferase class IV

46

268

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1g2w-assembly1.cif.gz_B e177s mutant of the pyridoxal-5'-phosphate enzyme d-amino acid aminotransferase 0.9647 2 273
4daa-assembly1.cif.gz_A crystallographic structure of d-amino acid aminotransferase in pyridoxal-5'-phosphate (plp) form 0.9637 2 273
2dab-assembly1.cif.gz_A l201a mutant of d-amino acid aminotransferase complexed with pyridoxal-5'-phosphate 0.9637 2 273
5daa-assembly1.cif.gz_B e177k mutant of d-amino acid aminotransferase complexed with pyridoxamine-5'-phosphate 0.9626 2 273
4tm5-assembly1.cif.gz_A-2 x-ray crystal structure of a d-amino acid aminotransferase from burkholderia thailandensis e264 bound to the co-factor pyridoxal phosphate 0.9572 2 277
ID Description Score Start End Superfamily
3lqsA02 Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 0.974 120 273 3.20.10.10
4pbcB02 Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 0.9701 147 281 3.20.10.10
4m0jB02 Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 0.9614 117 277 3.20.10.10
4m0jB02 Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 0.9426 117 277 3.20.10.10
1a0gA01 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;Aminotransferase class 4, branched-chain amino acid transferase, N-terminal domain 0.9409 2 115 3.30.470.10
ID Description Score Start End GO Terms
AF-C6XB07-F1-model_v4 Aminotransferase class IV 0.9834 2 281 GO:0005829
GO:0008483
GO:0046394
AF-A0A6L5JYQ8-F1-model_v4 D-amino acid aminotransferase 0.9816 2 281 GO:0005829
GO:0008483
GO:0046394
AF-A0A839A0U5-F1-model_v4 deleted 0.9811 2 283
AF-A0A4Y1Z9P1-F1-model_v4 D-alanine aminotransferase (EC 2.6.1.21) 0.9799 132 279 GO:0005829
GO:0046394
GO:0047810
AF-A0A1E4PQV2-F1-model_v4 deleted 0.9788 40 280

Map