F468802

General Info

Members Datasets Scaffolds Average Seq Length
608 259 1216 319

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0000226|Ga0395899_0000226_35783_36754
Length 323
Sequence MLAMKLANPFILNRADPFVGRHDGHYHFTASVPEYDRIILRRSATLEGLATAEEFVLWRAPASGAASALIWAPEIHRFEDAWYIYFAAAPSRDIKDGLFQHRMYALRNPAADPTTGEWQFVGQVDSGIDAFCLDATSFRHRGQNYYVWAQKHPDIPGNSNLYIAPLATPTTLAAAPVLLTRPELDWEVQGFAVNEGPAVLIRHGKVFITYSASATDERYAMGLLWADAEADLLDARNWHKSPTPVFVTDVERQVFGPGHNSFTVDGDTDLMIYHARDYREIEGDPLWNADRHARVHLLSWDAQGMPVFGRPQREVEWSAGVTA

Samples

Sample ID Description Type Environment
1 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
8 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
9 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
10 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
11 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
12 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
13 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
14 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
15 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
16 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
17 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
18 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
19 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
20 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
21 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
22 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
23 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
24 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
25 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
26 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
27 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
28 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
29 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
30 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
31 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
32 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
33 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
34 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
35 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
42 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
43 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
53 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
54 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
55 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
56 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
57 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
58 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
59 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
63 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
64 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
66 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
67 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
68 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
71 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
72 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
73 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
77 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
79 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
81 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
83 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
84 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
98 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
99 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
100 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
101 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
102 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
103 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
104 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
105 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
106 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
107 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
108 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
109 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
110 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
111 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
112 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
113 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
114 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
115 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
116 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
117 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
118 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
119 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
120 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
121 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
122 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
123 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
124 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
125 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
126 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
127 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
128 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
129 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
130 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
131 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
132 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
133 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
134 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
135 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
136 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
137 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
138 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
139 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
140 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
141 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
142 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
143 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
144 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
145 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
146 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
147 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
148 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
149 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
150 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
151 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
152 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
153 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
154 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
155 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
156 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
157 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
158 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
159 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
160 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
161 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
162 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
163 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
164 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
165 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
166 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
167 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
168 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
169 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
170 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
171 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
172 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
173 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
174 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
175 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
176 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
177 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
178 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
179 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
180 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
181 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
182 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
183 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
184 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
185 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
186 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
187 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
188 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
189 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
190 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
191 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
192 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
193 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
194 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
195 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
196 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
197 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
198 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
199 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
200 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
201 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
202 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
203 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
204 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
205 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
206 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
212 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
213 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
214 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
215 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
216 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
217 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
218 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
219 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
220 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
222 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
223 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
224 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
225 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
227 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
228 2643221556 Massilia sp. Root1485 Isolate Unclassified
229 2643221638 Duganella sp. Root336D2 Isolate Unclassified
230 2643221645 Massilia sp. Root351 Isolate Unclassified
231 2643221664 Massilia sp. Root418 Isolate Unclassified
232 2643221684 Massilia sp. Root133 Isolate Unclassified
233 2690315857 Rheinheimera sp. EpRS3 Isolate Unclassified
234 2738541276 Cellvibrio sp. YR554 Isolate Unclassified
235 2738541280 Massilia sp. GV090 Isolate Unclassified
236 2738541297 Duganella sp. GV083 Isolate Unclassified
237 2738541300 Massilia sp. GV016 Isolate Unclassified
238 2738541357 Duganella sp. GV053 Isolate Unclassified
239 2738543003 Duganella sp. GV066 Isolate Unclassified
240 2738543018 Massilia sp. GV045 Isolate Unclassified
241 2738543026 Duganella sp. GV089 Isolate Unclassified
242 2738543029 Duganella sp. GV039 Isolate Unclassified
243 2738543030 Massilia sp. GV097 Isolate Unclassified
244 2842711865 Duganella sp. R-73148 Isolate Unclassified
245 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
246 2857553236 Duganella sp. R-74557 Isolate Unclassified
247 2857564685 Duganella sp. R-74599 Isolate Unclassified
248 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
249 2904424332 Duganella sp. 1411 Isolate Rhizosphere
250 2916178963 Pseudoalteromonas rhizosphaerae RA15 Isolate Rhizosphere
251 2919476304 Duganella sp. 3397 Isolate Unclassified
252 2919497567 Shewanella putrefaciens 3469 Isolate Unclassified
253 2919534386 Rheinheimera pacifica 3879 Isolate Unclassified
254 2919688452 Pararheinheimera soli 4138 Isolate Unclassified
255 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
256 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
257 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
258 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
259 8054357960 Idiomarina rhizosphaerae M1R2S28 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.75
Metatranscriptomes 0.66
Isolates 5.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.05
Nodule 0.66
Rhizoplane 1.81
Rhizosphere 65.13
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395899_0000226 3300037312 Bacteria 76657
2 JGI25156J39149_1003241 3300002705 Bacteria 5417
3 JGI25156J39149_1007056 3300002705 Bacteria 3001
4 JGI25162J39368_1003969 3300002737 Bacteria 3768
5 JGI25154J39366_1000503 3300002738 Bacteria 19923
6 JGI25154J39366_1004732 3300002738 Bacteria 2344
7 JGI25158J39367_1004471 3300002739 Bacteria 2099
8 JGI25157J39369_1000256 3300002741 Bacteria 39240
9 JGI25157J39369_1002177 3300002741 Bacteria 5417
10 JGI25164J39214_1000064 3300002772 Bacteria 107073
11 JGI25152J39213_1000026 3300002773 Bacteria 101759
12 JGI25152J39213_1004392 3300002773 Bacteria 4451
13 JGI25150J39212_1000478 3300002774 Bacteria 16992
14 JGI25150J39212_1004201 3300002774 Bacteria 3241
15 JGI25150J39212_1005449 3300002774 Bacteria 2713
16 JGI25159J45721_1000676 3300002987 Bacteria 15043
17 JGI25159J45721_1002470 3300002987 Bacteria 7008
18 JGI25159J45721_1014739 3300002987 Bacteria 1747
19 JGI25165J46597_1000278 3300003214 Bacteria 65807
20 rootH1_10015702 3300003316 Bacteria 7606
21 rootH2_10011530 3300003320 Bacteria 1147
22 rootL2_10001989 3300003322 Bacteria 3909
23 rootL2_10002151 3300003322 Bacteria 70803
24 rootL2_10070531 3300003322 Bacteria 7438
25 rootL2_10136594 3300003322 Bacteria 10983
26 rootH1_10002339 3300003323 Bacteria 35435
27 rootH1_10042111 3300003323 Bacteria 8238
28 rootH1_10069919 3300003323 Bacteria 7127
29 rootH1_10126298 3300003323 Bacteria 3360
30 JGI25160J50197_1006539 3300003354 Bacteria 4702
31 JGI25161J50226_1000201 3300003374 Bacteria 39071
32 JGI25161J50226_1004252 3300003374 Bacteria 3040
33 Ga0055539_1007205 3300003752 Bacteria 1411
34 Ga0055533_1006262 3300003756 Bacteria 1779
35 Ga0055533_1008429 3300003756 Bacteria 1306
36 Ga0055525_1000006 3300003759 Bacteria 642912
37 Ga0055525_1000043 3300003759 Bacteria 268656
38 Ga0055527_1000305 3300003760 Bacteria 27630
39 Ga0055527_1000393 3300003760 Bacteria 18682
40 Ga0055527_1001316 3300003760 Bacteria 5369
41 Ga0055535_1000652 3300003761 Bacteria 27630
42 Ga0055535_1000974 3300003761 Bacteria 18682
43 Ga0055542_1000393 3300003762 Bacteria 43699
44 Ga0055542_1000672 3300003762 Bacteria 27630
45 Ga0055542_1000970 3300003762 Bacteria 18685
46 Ga0055529_1000032 3300003763 Bacteria 255895
47 Ga0055529_1000409 3300003763 Bacteria 45120
48 Ga0055529_1000620 3300003763 Bacteria 26580
49 Ga0055529_1000818 3300003763 Bacteria 18682
50 Ga0055526_1000018 3300003771 Bacteria 198838
51 Ga0055526_1000053 3300003771 Bacteria 114820
52 Ga0055526_1003053 3300003771 Bacteria 10879
53 Ga0055526_1018147 3300003771 Bacteria 2642
54 Ga0055537_1000027 3300003773 Bacteria 102244
55 Ga0055537_1006491 3300003773 Bacteria 2956
56 Ga0055524_1002546 3300003775 Bacteria 9318
57 Ga0055524_1002925 3300003775 Bacteria 8521
58 Ga0055524_1003014 3300003775 Bacteria 8346
59 Ga0055524_1003992 3300003775 Bacteria 6961
60 Ga0055534_1000051 3300003784 Bacteria 92183
61 Ga0055528_1000731 3300003790 Bacteria 23155
62 Ga0055528_1019049 3300003790 Bacteria 2296
63 Ga0055530_10002749 3300003791 Bacteria 10883
64 Ga0055531_10000025 3300003794 Bacteria 161475
65 Ga0055531_10002488 3300003794 Bacteria 12289
66 Ga0055531_10048507 3300003794 Bacteria 1144
67 Ga0055543_1000103 3300004625 Bacteria 73828
68 Ga0065165_1001082 3300005262 Bacteria 32470
69 Ga0065165_1001148 3300005262 Bacteria 30990
70 Ga0070658_10043212 3300005327 Bacteria 3641
71 Ga0070658_10095341 3300005327 Bacteria 2456
72 Ga0070660_100006208 3300005339 Bacteria 8271
73 Ga0070660_100013161 3300005339 Bacteria 5929
74 Ga0070660_100063787 3300005339 Bacteria 2864
75 Ga0070659_100024228 3300005366 Bacteria 4651
76 Ga0070659_100063112 3300005366 Bacteria 2930
77 Ga0070662_100126404 3300005457 Bacteria 1966
78 Ga0070662_100353923 3300005457 Bacteria 1204
79 Ga0068855_100065376 3300005563 Bacteria 4240
80 Ga0070664_100106815 3300005564 Bacteria 2439
81 Ga0068865_100430674 3300006881 Bacteria 1087
82 Ga0099823_1000046 3300006944 Bacteria 60074
83 Ga0079104_1024665 3300006946 Bacteria 1580
84 Ga0105244_10001201 3300009036 Bacteria 21301
85 Ga0105244_10040268 3300009036 Bacteria 2428
86 Ga0105243_10011176 3300009148 Bacteria 6791
87 Ga0105241_10016143 3300009174 Bacteria 5474
88 Ga0105242_10011548 3300009176 Bacteria 6793
89 Ga0105242_10584387 3300009176 Bacteria 1076
90 Ga0157371_10000014 3300013102 Bacteria 347490
91 Ga0157369_10319743 3300013105 Bacteria 1613
92 Ga0157374_10346819 3300013296 Bacteria 1475
93 Ga0157378_10204432 3300013297 Bacteria 1870
94 Ga0157372_10318841 3300013307 Bacteria 1810
95 Ga0182008_10001070 3300014497 Bacteria 18895
96 Ga0182006_1000007 3300015261 Bacteria 452190
97 Ga0182006_1000040 3300015261 Bacteria 209209
98 Ga0182007_10000068 3300015262 Bacteria 82301
99 Ga0182005_1000010 3300015265 Bacteria 434103
100 Ga0182005_1000051 3300015265 Bacteria 114808
101 Ga0163161_10191791 3300017792 Bacteria 1571
102 Ga0213872_10000040 3300021361 Bacteria 122419
103 Ga0213872_10052139 3300021361 Bacteria 1856
104 Ga0209436_100301 3300025208 Bacteria 22729
105 Ga0209436_103138 3300025208 Bacteria 4539
106 Ga0209674_100059 3300025226 Bacteria 282517
107 Ga0209674_102211 3300025226 Bacteria 4316
108 Ga0209672_100004 3300025228 Bacteria 1467504
109 Ga0209672_100008 3300025228 Bacteria 946876
110 Ga0209672_100121 3300025228 Bacteria 83609
111 Ga0209563_100022 3300025230 Bacteria 643318
112 Ga0209563_100036 3300025230 Bacteria 448275
113 Ga0207427_100037 3300025231 Bacteria 303108
114 Ga0209437_100213 3300025233 Bacteria 107087
115 Ga0209258_100003 3300025242 Bacteria 1467504
116 Ga0209258_100004 3300025242 Bacteria 1376422
117 Ga0209258_100008 3300025242 Bacteria 1009355
118 Ga0209258_100106 3300025242 Bacteria 206622
119 Ga0207425_1000017 3300025245 Bacteria 423851
120 Ga0207425_1000085 3300025245 Bacteria 95577
121 Ga0207425_1000326 3300025245 Bacteria 33697
122 Ga0207425_1008410 3300025245 Bacteria 2645
123 Ga0209646_1000051 3300025246 Bacteria 296525
124 Ga0209646_1001473 3300025246 Bacteria 6272
125 Ga0209026_1000045 3300025250 Bacteria 263431
126 Ga0209026_1003347 3300025250 Bacteria 5321
127 Ga0209026_1015914 3300025250 Bacteria 1226
128 Ga0209677_101205 3300025253 Bacteria 11774
129 Ga0209677_102629 3300025253 Bacteria 6527
130 Ga0209677_107599 3300025253 Bacteria 2266
131 Ga0209148_1000025 3300025254 Bacteria 663262
132 Ga0209148_1000042 3300025254 Bacteria 464111
133 Ga0209148_1000053 3300025254 Bacteria 373506
134 Ga0209148_1000678 3300025254 Bacteria 28482
135 Ga0209759_1000185 3300025256 Bacteria 100505
136 Ga0209759_1000212 3300025256 Bacteria 89756
137 Ga0209129_1000162 3300025258 Bacteria 101248
138 Ga0209233_1000096 3300025261 Bacteria 303482
139 Ga0209565_1000017 3300025263 Bacteria 462438
140 Ga0209565_1000452 3300025263 Bacteria 31667
141 Ga0209565_1002359 3300025263 Bacteria 6878
142 Ga0209565_1002832 3300025263 Bacteria 5971
143 Ga0209565_1020281 3300025263 Bacteria 1405
144 Ga0209455_1000004 3300025272 Bacteria 1467504
145 Ga0209455_1000007 3300025272 Bacteria 1157983
146 Ga0209455_1000016 3300025272 Bacteria 753097
147 Ga0209455_1000043 3300025272 Bacteria 413928
148 Ga0209673_1000007 3300025273 Bacteria 634477
149 Ga0209673_1015546 3300025273 Bacteria 2884
150 Ga0209130_1000078 3300025284 Bacteria 169374
151 Ga0209130_1000188 3300025284 Bacteria 86963
152 Ga0209130_1008273 3300025284 Bacteria 3088
153 Ga0209675_1000009 3300025291 Bacteria 562872
154 Ga0209675_1002209 3300025291 Bacteria 10181
155 Ga0209675_1010711 3300025291 Bacteria 3106
156 Ga0209025_1024135 3300025294 Bacteria 3152
157 Ga0209564_1000011 3300025295 Bacteria 822327
158 Ga0209564_1000036 3300025295 Bacteria 423455
159 Ga0209564_1000055 3300025295 Bacteria 343782
160 Ga0209564_1000068 3300025295 Bacteria 311171
161 Ga0209564_1000343 3300025295 Bacteria 89036
162 Ga0209564_1002854 3300025295 Bacteria 12705
163 Ga0209564_1011336 3300025295 Bacteria 4006
164 Ga0209758_1000250 3300025297 Bacteria 109992
165 Ga0209758_1001409 3300025297 Bacteria 28501
166 Ga0209050_1000316 3300025298 Bacteria 98257
167 Ga0209050_1000612 3300025298 Bacteria 56207
168 Ga0209050_1001361 3300025298 Bacteria 26758
169 Ga0209050_1001479 3300025298 Bacteria 25051
170 Ga0209050_1001484 3300025298 Bacteria 24939
171 Ga0209050_1015304 3300025298 Bacteria 3230
172 Ga0209256_1000167 3300025299 Bacteria 133419
173 Ga0209256_1000184 3300025299 Bacteria 121336
174 Ga0209256_1000841 3300025299 Bacteria 38507
175 Ga0209256_1003010 3300025299 Bacteria 12470
176 Ga0209256_1006853 3300025299 Bacteria 5857
177 Ga0207426_1007269 3300025302 Bacteria 4662
178 Ga0207426_1025391 3300025302 Bacteria 1995
179 Ga0209051_1000869 3300025303 Bacteria 30576
180 Ga0209051_1005230 3300025303 Bacteria 7663
181 Ga0209257_1000032 3300025304 Bacteria 680354
182 Ga0209257_1000123 3300025304 Bacteria 219092
183 Ga0209257_1003015 3300025304 Bacteria 15235
184 Ga0207705_10027711 3300025909 Bacteria 4041
185 Ga0207705_10141331 3300025909 Bacteria 1798
186 Ga0207695_10212725 3300025913 Bacteria 1843
187 Ga0207657_10005165 3300025919 Bacteria 13694
188 Ga0207649_10077810 3300025920 Bacteria 2138
189 Ga0207690_10079757 3300025932 Bacteria 2282
190 Ga0207706_10067011 3300025933 Bacteria 3158
191 Ga0207686_10057360 3300025934 Bacteria 2451
192 Ga0207679_10076590 3300025945 Bacteria 2542
193 Ga0207667_10266283 3300025949 Bacteria 1752
194 Ga0207678_10477564 3300026067 Bacteria 1085
195 Ga0207702_10000654 3300026078 Bacteria 37703
196 Ga0209281_1005021 3300027111 Bacteria 3776
197 Ga0209389_1013868 3300027296 Bacteria 7326
198 Ga0265338_10000331 3300028800 Bacteria 85997
199 Ga0265338_10008840 3300028800 Bacteria 12153
200 Ga0316182_1011444 3300030745 Bacteria 1939
201 Ga0316182_1278328 3300030745 Bacteria 4284
202 Ga0307513_10403823 3300031456 Bacteria 1100
203 Ga0307408_100000092 3300031548 Bacteria 98953
204 Ga0307408_100000286 3300031548 Bacteria 50236
205 Ga0307408_100000419 3300031548 Bacteria 38162
206 Ga0307408_100003582 3300031548 Bacteria 10582
207 Ga0307408_100005970 3300031548 Bacteria 8110
208 Ga0307408_100021916 3300031548 Bacteria 4332
209 Ga0307408_100216164 3300031548 Bacteria 1561
210 Ga0307408_100364314 3300031548 Bacteria 1231
211 Ga0316576_10000921 3300031727 Bacteria 15034
212 Ga0316576_10040422 3300031727 Bacteria 3353
213 Ga0316576_10170457 3300031727 Bacteria 1643
214 Ga0316578_10050384 3300031728 Bacteria 2436
215 Ga0307518_10099607 3300031838 Bacteria 2082
216 Ga0307406_10028255 3300031901 Bacteria 3387
217 Ga0307409_100022485 3300031995 Bacteria 4349
218 Ga0307416_100197720 3300032002 Bacteria 1904
219 Ga0307416_100284591 3300032002 Bacteria 1632
220 Ga0307414_10061003 3300032004 Bacteria 2670
221 Ga0395899_0000293 3300037312 Bacteria 64438
222 Ga0395899_0003754 3300037312 Bacteria 11998
223 Ga0395899_0214669 3300037312 Bacteria 1335
224 Ga0395900_0000011 3300037418 Bacteria 421926
225 Ga0395900_0010023 3300037418 Bacteria 9696
226 Ga0395900_0036179 3300037418 Bacteria 5088
227 Ga0395900_0186020 3300037418 Bacteria 2108
228 Ga0395900_0196590 3300037418 Bacteria 2042
229 Ga0395898_0000029 3300037466 Bacteria 370667
230 Ga0395898_0039140 3300037466 Bacteria 4694
231 Ga0395898_0251856 3300037466 Bacteria 1684
232 Ga0395905_0326109 3300037471 Bacteria 1425
233 Ga0395901_0000019 3300038443 Bacteria 317063
234 Ga0395901_0024509 3300038443 Bacteria 6193
235 Ga0436361_0424561 3300039447 Bacteria 11268
236 Ga0436361_0617438 3300039447 Bacteria 1668
237 Ga0436361_1177289 3300039447 Bacteria 9479
238 Ga0450890_000853 3300042127 Bacteria 4391
239 Ga0450891_002414 3300042129 Bacteria 1883
240 Ga0439446_0010941 3300042156 Bacteria 2454
241 Ga0439458_0028525 3300042157 Bacteria 1321
242 Ga0451577_0000642 3300042876 Bacteria 55654
243 Ga0466969_0047280 3300044656 Bacteria 2130
244 Ga0466972_0009564 3300044658 Bacteria 4866
245 Ga0466982_0066678 3300044672 Bacteria 2220
246 Ga0466965_0007237 3300044683 Bacteria 5086
247 Ga0466965_0015756 3300044683 Bacteria 3592
248 Ga0466965_0045762 3300044683 Bacteria 2165
249 Ga0466966_0006384 3300044684 Bacteria 7795
250 Ga0466966_0011051 3300044684 Bacteria 5993
251 Ga0466966_0126037 3300044684 Bacteria 1570
252 Ga0466961_0000272 3300044693 Bacteria 34599
253 Ga0466961_0000299 3300044693 Bacteria 32965
254 Ga0466961_0004718 3300044693 Bacteria 8574
255 Ga0466961_0013395 3300044693 Bacteria 5250
256 Ga0466961_0135886 3300044693 Bacteria 1540
257 Ga0466961_0175105 3300044693 Bacteria 1333
258 Ga0466964_0025245 3300044706 Bacteria 2319
259 Ga0466968_0004950 3300044735 Bacteria 4989
260 Ga0466970_0000201 3300044765 Bacteria 28963
261 Ga0466970_0012603 3300044765 Bacteria 4325
262 Ga0466957_0000104 3300044842 Bacteria 34466
263 Ga0466957_0067208 3300044842 Bacteria 2211
264 Ga0466957_0079841 3300044842 Bacteria 2036
265 Ga0466959_0000006 3300045049 Bacteria 192678
266 Ga0466959_0003643 3300045049 Bacteria 10159
267 Ga0466959_0077725 3300045049 Bacteria 2394
268 Ga0466959_0208225 3300045049 Bacteria 1359
269 Ga0451576_0000098 3300045051 Bacteria 220454
270 Ga0451576_0016173 3300045051 Bacteria 8242
271 Ga0466958_0032112 3300045836 Bacteria 3122
272 Ga0466958_0032623 3300045836 Bacteria 3099
273 Ga0466967_0150808 3300045976 Bacteria 2172
274 Ga0466967_0531929 3300045976 Bacteria 1156
275 Ga0495617_000003 3300046452 Bacteria 541914
276 Ga0495617_000208 3300046452 Bacteria 36937
277 Ga0495617_004548 3300046452 Bacteria 5027
278 Ga0495603_0012166 3300046455 Bacteria 5211
279 Ga0495590_0000001 3300046457 Bacteria 762984
280 Ga0495590_0001769 3300046457 Bacteria 9174
281 Ga0495590_0010308 3300046457 Bacteria 3518
282 Ga0495590_0025477 3300046457 Bacteria 2079
283 Ga0495590_0032711 3300046457 Bacteria 1819
284 Ga0495638_0006478 3300046460 Bacteria 8513
285 Ga0495653_0000002 3300046463 Bacteria 507262
286 Ga0495653_0013560 3300046463 Bacteria 6644
287 Ga0495650_0000001 3300046471 Bacteria 1085492
288 Ga0495650_0000072 3300046471 Bacteria 257886
289 Ga0495650_0000267 3300046471 Bacteria 100234
290 Ga0495650_0000427 3300046471 Bacteria 68283
291 Ga0495650_0004037 3300046471 Bacteria 10287
292 Ga0495650_0005248 3300046471 Bacteria 8492
293 Ga0495650_0046968 3300046471 Bacteria 1808
294 Ga0495605_0000065 3300046474 Bacteria 139441
295 Ga0495605_0000103 3300046474 Bacteria 105879
296 Ga0495605_0006806 3300046474 Bacteria 6530
297 Ga0495605_0009486 3300046474 Bacteria 5466
298 Ga0495605_0010607 3300046474 Bacteria 5152
299 Ga0495605_0013758 3300046474 Bacteria 4447
300 Ga0495605_0131119 3300046474 Bacteria 1130
301 Ga0495639_0023644 3300046475 Bacteria 2702
302 Ga0495584_0000009 3300046491 Bacteria 236318
303 Ga0495584_0000182 3300046491 Bacteria 44393
304 Ga0495584_0000904 3300046491 Bacteria 18948
305 Ga0495584_0006880 3300046491 Bacteria 5944
306 Ga0495584_0008198 3300046491 Bacteria 5425
307 Ga0495584_0011178 3300046491 Bacteria 4602
308 Ga0495584_0011989 3300046491 Bacteria 4432
309 Ga0495585_0000154 3300046492 Bacteria 73681
310 Ga0495585_0000260 3300046492 Bacteria 54082
311 Ga0495585_0000940 3300046492 Bacteria 24573
312 Ga0495585_0002583 3300046492 Bacteria 12807
313 Ga0495585_0007271 3300046492 Bacteria 6796
314 Ga0495585_0026872 3300046492 Bacteria 3286
315 Ga0495585_0041966 3300046492 Bacteria 2564
316 Ga0495585_0091316 3300046492 Bacteria 1639
317 Ga0495596_0010296 3300046500 Bacteria 4076
318 Ga0495596_0015031 3300046500 Bacteria 3251
319 Ga0495596_0018205 3300046500 Bacteria 2899
320 Ga0495596_0018821 3300046500 Bacteria 2843
321 Ga0495596_0128062 3300046500 Bacteria 985
322 Ga0495607_0000644 3300046501 Bacteria 33902
323 Ga0495607_0009099 3300046501 Bacteria 6751
324 Ga0495607_0034933 3300046501 Bacteria 3045
325 Ga0495607_0040486 3300046501 Bacteria 2774
326 Ga0495607_0060402 3300046501 Bacteria 2157
327 Ga0495583_0000008 3300046506 Bacteria 411092
328 Ga0495583_0000050 3300046506 Bacteria 213627
329 Ga0495583_0000064 3300046506 Bacteria 192380
330 Ga0495583_0000253 3300046506 Bacteria 88398
331 Ga0495583_0016130 3300046506 Bacteria 4028
332 Ga0495583_0018718 3300046506 Bacteria 3639
333 Ga0495583_0034199 3300046506 Bacteria 2437
334 Ga0495606_0000001 3300046507 Bacteria 592123
335 Ga0495606_0000030 3300046507 Bacteria 249484
336 Ga0495606_0000282 3300046507 Bacteria 88450
337 Ga0495606_0003624 3300046507 Bacteria 16227
338 Ga0495606_0005214 3300046507 Bacteria 12545
339 Ga0495606_0010442 3300046507 Bacteria 7708
340 Ga0495606_0024337 3300046507 Bacteria 4366
341 Ga0495610_0000003 3300046512 Bacteria 1203910
342 Ga0495610_0001826 3300046512 Bacteria 18503
343 Ga0495610_0009770 3300046512 Bacteria 6027
344 Ga0495610_0016720 3300046512 Bacteria 4211
345 Ga0495610_0041049 3300046512 Bacteria 2326
346 Ga0495616_0000012 3300046513 Bacteria 211342
347 Ga0495616_0000283 3300046513 Bacteria 41076
348 Ga0495616_0001100 3300046513 Bacteria 19247
349 Ga0495616_0006912 3300046513 Bacteria 6833
350 Ga0495616_0052135 3300046513 Bacteria 2037
351 Ga0495616_0055424 3300046513 Bacteria 1962
352 Ga0495616_0076573 3300046513 Bacteria 1607
353 Ga0495631_0000214 3300046518 Bacteria 39867
354 Ga0495631_0003192 3300046518 Bacteria 9024
355 Ga0495631_0007582 3300046518 Bacteria 5515
356 Ga0495631_0078034 3300046518 Bacteria 1429
357 Ga0495632_0000117 3300046519 Bacteria 81479
358 Ga0495632_0000151 3300046519 Bacteria 71855
359 Ga0495632_0000405 3300046519 Bacteria 40703
360 Ga0495632_0002250 3300046519 Bacteria 14864
361 Ga0495637_0000042 3300046520 Bacteria 114979
362 Ga0495643_0000028 3300046522 Bacteria 262886
363 Ga0495643_0000285 3300046522 Bacteria 72233
364 Ga0495643_0009345 3300046522 Bacteria 6097
365 Ga0495643_0018663 3300046522 Bacteria 4024
366 Ga0495643_0018836 3300046522 Bacteria 3999
367 Ga0495643_0083757 3300046522 Bacteria 1655
368 Ga0495643_0093325 3300046522 Bacteria 1550
369 Ga0495644_0026277 3300046523 Bacteria 2209
370 Ga0495648_0000001 3300046524 Bacteria 696872
371 Ga0495648_0000079 3300046524 Bacteria 126099
372 Ga0495648_0005786 3300046524 Bacteria 10197
373 Ga0495648_0014982 3300046524 Bacteria 5647
374 Ga0495648_0016643 3300046524 Bacteria 5292
375 Ga0495648_0023950 3300046524 Bacteria 4168
376 Ga0495648_0027847 3300046524 Bacteria 3775
377 Ga0495648_0033278 3300046524 Bacteria 3369
378 Ga0495648_0040219 3300046524 Bacteria 2967
379 Ga0495648_0058300 3300046524 Bacteria 2309
380 Ga0495642_0002229 3300046528 Bacteria 7934
381 Ga0495642_0002749 3300046528 Bacteria 7056
382 Ga0495642_0004777 3300046528 Bacteria 5240
383 Ga0495654_0000037 3300046530 Bacteria 188218
384 Ga0495654_0008463 3300046530 Bacteria 5681
385 Ga0495654_0009920 3300046530 Bacteria 5206
386 Ga0495654_0016392 3300046530 Bacteria 3920
387 Ga0495654_0040665 3300046530 Bacteria 2316
388 Ga0495654_0073473 3300046530 Bacteria 1617
389 Ga0495609_0000026 3300046538 Bacteria 251973
390 Ga0495609_0000241 3300046538 Bacteria 52185
391 Ga0495609_0001046 3300046538 Bacteria 19408
392 Ga0495609_0013197 3300046538 Bacteria 3906
393 Ga0495609_0015872 3300046538 Bacteria 3518
394 Ga0495609_0018079 3300046538 Bacteria 3270
395 Ga0495609_0064905 3300046538 Bacteria 1610
396 Ga0495597_0000073 3300046542 Bacteria 87767
397 Ga0495597_0000705 3300046542 Bacteria 26750
398 Ga0495597_0000864 3300046542 Bacteria 23742
399 Ga0495597_0004402 3300046542 Bacteria 7755
400 Ga0495597_0008100 3300046542 Bacteria 5287
401 Ga0495622_0000131 3300046557 Bacteria 64280
402 Ga0495622_0026719 3300046557 Bacteria 2694
403 Ga0495622_0030689 3300046557 Bacteria 2512
404 Ga0495633_0000055 3300046558 Bacteria 151013
405 Ga0495633_0000106 3300046558 Bacteria 113381
406 Ga0495633_0000675 3300046558 Bacteria 31481
407 Ga0495633_0013433 3300046558 Bacteria 4316
408 Ga0495633_0018016 3300046558 Bacteria 3593
409 Ga0495633_0018951 3300046558 Bacteria 3484
410 Ga0495656_0006356 3300046615 Bacteria 4142
411 Ga0495656_0049412 3300046615 Bacteria 1791
412 Ga0495656_0155497 3300046615 Bacteria 1108
413 Ga0495668_0000190 3300046616 Bacteria 91473
414 Ga0495668_0000565 3300046616 Bacteria 45559
415 Ga0495668_0001065 3300046616 Bacteria 29015
416 Ga0495668_0001873 3300046616 Bacteria 18839
417 Ga0495668_0002146 3300046616 Bacteria 16984
418 Ga0495668_0006874 3300046616 Bacteria 7376
419 Ga0495668_0013236 3300046616 Bacteria 4875
420 Ga0495668_0016126 3300046616 Bacteria 4346
421 Ga0495668_0019446 3300046616 Bacteria 3914
422 Ga0495611_0000151 3300046648 Bacteria 49625
423 Ga0495611_0018928 3300046648 Bacteria 2955
424 Ga0495611_0066432 3300046648 Bacteria 1644
425 Ga0495625_0000035 3300046660 Bacteria 224323
426 Ga0495625_0000391 3300046660 Bacteria 66888
427 Ga0495625_0002897 3300046660 Bacteria 17926
428 Ga0495625_0017011 3300046660 Bacteria 5702
429 Ga0495625_0023692 3300046660 Bacteria 4685
430 Ga0495625_0043513 3300046660 Bacteria 3256
431 Ga0495625_0076343 3300046660 Bacteria 2343
432 Ga0495625_0131621 3300046660 Bacteria 1694
433 Ga0495659_0000158 3300046664 Bacteria 30194
434 Ga0495659_0028445 3300046664 Bacteria 1934
435 Ga0495659_0041143 3300046664 Bacteria 1649
436 Ga0495661_0000152 3300046665 Bacteria 81192
437 Ga0495661_0000715 3300046665 Bacteria 32660
438 Ga0495661_0006925 3300046665 Bacteria 7925
439 Ga0495661_0008169 3300046665 Bacteria 7257
440 Ga0495661_0016799 3300046665 Bacteria 4840
441 Ga0495661_0103006 3300046665 Bacteria 1603
442 Ga0495588_0000139 3300046674 Bacteria 109955
443 Ga0495646_0046872 3300046680 Bacteria 2633
444 Ga0495669_0002681 3300046684 Bacteria 7287
445 Ga0495669_0021045 3300046684 Bacteria 2827
446 Ga0495670_0000114 3300046691 Bacteria 35822
447 Ga0495670_0006155 3300046691 Bacteria 5893
448 Ga0495670_0010977 3300046691 Bacteria 4452
449 Ga0495670_0088515 3300046691 Bacteria 1583
450 Ga0495671_0000010 3300046692 Bacteria 368641
451 Ga0495671_0002314 3300046692 Bacteria 12109
452 Ga0495671_0006896 3300046692 Bacteria 6517
453 Ga0495671_0007326 3300046692 Bacteria 6299
454 Ga0495671_0007720 3300046692 Bacteria 6103
455 Ga0495649_0035077 3300046694 Bacteria 2759
456 Ga0495649_0041820 3300046694 Bacteria 2505
457 Ga0495649_0042748 3300046694 Bacteria 2475
458 Ga0495649_0048270 3300046694 Bacteria 2313
459 Ga0495649_0065306 3300046694 Bacteria 1953
460 Ga0495649_0070323 3300046694 Bacteria 1876
461 Ga0495589_0000100 3300046794 Bacteria 83307
462 Ga0495589_0000101 3300046794 Bacteria 82583
463 Ga0495589_0037719 3300046794 Bacteria 2420
464 Ga0495589_0100712 3300046794 Bacteria 1398
465 Ga0495660_0000027 3300046810 Bacteria 254331
466 Ga0495660_0000335 3300046810 Bacteria 41632
467 Ga0495660_0001827 3300046810 Bacteria 13973
468 Ga0495660_0010965 3300046810 Bacteria 5266
469 Ga0495660_0020088 3300046810 Bacteria 3831
470 Ga0495660_0039111 3300046810 Bacteria 2635
471 Ga0495660_0041760 3300046810 Bacteria 2537
472 Ga0495660_0052366 3300046810 Bacteria 2217
473 Ga0495636_0003252 3300047318 Bacteria 6299
474 Ga0495636_0042115 3300047318 Bacteria 1896
475 Ga0495672_0000220 3300047320 Bacteria 81547
476 Ga0495672_0000221 3300047320 Bacteria 81255
477 Ga0495672_0002445 3300047320 Bacteria 17096
478 Ga0495672_0002802 3300047320 Bacteria 15553
479 Ga0495672_0007979 3300047320 Bacteria 7889
480 Ga0495680_0025635 3300047322 Bacteria 4876
481 Ga0495683_0000064 3300047323 Bacteria 112558
482 Ga0495683_0001336 3300047323 Bacteria 16464
483 Ga0495683_0032651 3300047323 Bacteria 2651
484 Ga0495687_000012 3300047443 Bacteria 391586
485 Ga0495687_000037 3300047443 Bacteria 252363
486 Ga0495687_000062 3300047443 Bacteria 176135
487 Ga0495687_000122 3300047443 Bacteria 119372
488 Ga0495687_003478 3300047443 Bacteria 11377
489 Ga0495677_0000014 3300047445 Bacteria 136236
490 Ga0495677_0003124 3300047445 Bacteria 6455
491 Ga0495677_0004220 3300047445 Bacteria 5539
492 Ga0495677_0032844 3300047445 Bacteria 1890
493 Ga0495679_001792 3300047446 Bacteria 11717
494 Ga0495679_004418 3300047446 Bacteria 6499
495 Ga0495685_000262 3300047447 Bacteria 18174
496 Ga0495685_001925 3300047447 Bacteria 6417
497 Ga0495673_0000003 3300047469 Bacteria 1491337
498 Ga0495673_0000016 3300047469 Bacteria 580643
499 Ga0495673_0000035 3300047469 Bacteria 316861
500 Ga0495673_0003607 3300047469 Bacteria 10132
501 Ga0495681_0000021 3300047470 Bacteria 166534
502 Ga0495681_0000246 3300047470 Bacteria 44798
503 Ga0495681_0006028 3300047470 Bacteria 8020
504 Ga0495681_0015183 3300047470 Bacteria 4367
505 Ga0495681_0024947 3300047470 Bacteria 3135
506 Ga0495686_0000047 3300047472 Bacteria 280086
507 Ga0495686_0007983 3300047472 Bacteria 7848
508 Ga0495686_0008813 3300047472 Bacteria 7348
509 Ga0495686_0096437 3300047472 Bacteria 1790
510 Ga0495686_0149193 3300047472 Bacteria 1374
511 Ga0495626_0000222 3300048091 Bacteria 67304
512 Ga0495626_0001784 3300048091 Bacteria 16276
513 Ga0495626_0008414 3300048091 Bacteria 5658
514 Ga0495626_0015604 3300048091 Bacteria 3883
515 Ga0495626_0089155 3300048091 Bacteria 1358
516 Ga0495626_0095110 3300048091 Bacteria 1305
517 Ga0495626_0137873 3300048091 Bacteria 1036
518 Ga0496102_0049277 3300048905 Bacteria 3831
519 Ga0496102_0147844 3300048905 Bacteria 2206
520 Ga0496103_0178087 3300048906 Bacteria 1366
521 Ga0496106_0030710 3300048909 Bacteria 4005
522 Ga0496108_0329777 3300048911 Bacteria 1331
523 Ga0496109_0199668 3300048912 Bacteria 1880
524 Ga0496110_0000026 3300048913 Bacteria 71385
525 Ga0496111_0041791 3300048914 Bacteria 3291
526 Ga0496111_0050164 3300048914 Bacteria 3009
527 Ga0496113_0001992 3300048916 Bacteria 11697
528 Ga0496117_0000005 3300048920 Bacteria 777468
529 Ga0496118_0000022 3300048921 Bacteria 438602
530 Ga0496120_0039174 3300048923 Bacteria 2799
531 Ga0496121_0004143 3300048924 Bacteria 19841
532 Ga0496121_0041960 3300048924 Bacteria 3988
533 Ga0496122_0001132 3300048925 Bacteria 45868
534 Ga0496122_0020696 3300048925 Bacteria 5926
535 Ga0496122_0025368 3300048925 Bacteria 5149
536 Ga0496122_0050365 3300048925 Bacteria 3177
537 Ga0496123_0003516 3300048926 Bacteria 17450
538 Ga0496123_0005149 3300048926 Bacteria 13318
539 Ga0496123_0006339 3300048926 Bacteria 11489
540 Ga0496124_0024602 3300048927 Bacteria 5470
541 Ga0496124_0084520 3300048927 Bacteria 2602
542 Ga0496124_0142299 3300048927 Bacteria 1891
543 Ga0496124_0162170 3300048927 Bacteria 1741
544 Ga0496126_0004427 3300048929 Bacteria 16812
545 Ga0495678_000002 3300049459 Bacteria 999613
546 Ga0495678_000029 3300049459 Bacteria 219803
547 Ga0495678_000045 3300049459 Bacteria 171880
548 Ga0495678_000663 3300049459 Bacteria 31565
549 Ga0495678_004929 3300049459 Bacteria 7540
550 Ga0495678_024725 3300049459 Bacteria 2589
551 Ga0495682_0000208 3300049460 Bacteria 47163
552 Ga0495682_0000628 3300049460 Bacteria 23643
553 Ga0495682_0071136 3300049460 Bacteria 1252
554 Ga0501311_001840 3300049527 Bacteria 1934
555 Ga0501316_003450 3300049532 Bacteria 1537
556 Ga0501335_000226 3300049551 Bacteria 3168
557 Ga0501034_0103678 3300049571 Bacteria 2838
558 Ga0501036_0156079 3300049572 Bacteria 1925
559 Ga0501198_009956 3300049649 Bacteria 1400
560 Ga0501207_007153 3300049654 Bacteria 1586
561 Ga0501217_015353 3300049661 Bacteria 1742
562 Ga0501222_003666 3300049662 Bacteria 2091
563 Ga0501227_002485 3300049665 Bacteria 4068
564 Ga0501227_003667 3300049665 Bacteria 3328
565 Ga0501240_007331 3300049673 Bacteria 1384
566 Ga0501249_002660 3300049679 Bacteria 3598
567 Ga0501269_000700 3300049766 Bacteria 5582
568 Ga0501279_004021 3300049775 Bacteria 1926
569 Ga0501035_0011980 3300049822 Bacteria 8021
570 Ga0501044_0588127 3300049823 Bacteria 1007
571 Ga0500594_0002831 3300053118 Bacteria 3784
572 Ga0500618_000068 3300053125 Bacteria 88668
573 Ga0500586_001379 3300053145 Bacteria 5117
574 Ga0587083_0004084 3300059505 Bacteria 1996
575 2601671312 2600255292 Bacteria 6300551
576 2643789486 2643221554 Bacteria 6603920
577 2643801500 2643221556 Bacteria 7251154
578 2644216057 2643221638 Bacteria 6579467
579 2644251262 2643221645 Bacteria 7207331
580 2644357529 2643221664 Bacteria 7272945
581 2644471438 2643221684 Bacteria 7145183
582 2691331105 2690315857 Bacteria 4396207
583 2738713391 2738541276 Bacteria 4690596
584 2738740120 2738541280 Bacteria 6630198
585 2738829884 2738541297 Bacteria 6549566
586 2738844115 2738541300 Bacteria 6675882
587 2739153680 2738541357 Bacteria 6549408
588 2739195600 2738543003 Bacteria 6549560
589 2739274322 2738543018 Bacteria 6718814
590 2739322076 2738543026 Bacteria 6549408
591 2739340317 2738543029 Bacteria 6549249
592 2739343366 2738543030 Bacteria 6719714
593 2842715518 2842711865 Bacteria 7155354
594 2857548848 2857547612 Bacteria 6179999
595 2857555921 2857553236 Bacteria 6166726
596 2857566937 2857564685 Bacteria 6290584
597 2885080357 2885080285 Bacteria 6355622
598 2904425720 2904424332 Bacteria 7633521
599 2916179111 2916178963 Bacteria 5265078
600 2919478254 2919476304 Bacteria 5888696
601 2919500168 2919497567 Bacteria 4408621
602 2919534667 2919534386 Bacteria 4577686
603 2919691630 2919688452 Bacteria 4595932
604 2932415456 2932410948 Bacteria 6312192
605 2932421383 2932416698 Bacteria 6315112
606 2937613548 2937610967 Bacteria 4618818
607 8047677196 8047673197 Bacteria 7395230
608 8054358010 8054357960 Bacteria 2867777
609 Ga0395899_0000226
610 JGI25156J39149_1003241
611 JGI25156J39149_1007056
612 JGI25162J39368_1003969
613 JGI25154J39366_1000503
614 JGI25154J39366_1004732
615 JGI25158J39367_1004471
616 JGI25157J39369_1000256
617 JGI25157J39369_1002177
618 JGI25164J39214_1000064
619 JGI25152J39213_1000026
620 JGI25152J39213_1004392
621 JGI25150J39212_1000478
622 JGI25150J39212_1004201
623 JGI25150J39212_1005449
624 JGI25159J45721_1000676
625 JGI25159J45721_1002470
626 JGI25159J45721_1014739
627 JGI25165J46597_1000278
628 rootH1_10015702
629 rootH2_10011530
630 rootL2_10001989
631 rootL2_10002151
632 rootL2_10070531
633 rootL2_10136594
634 rootH1_10002339
635 rootH1_10042111
636 rootH1_10069919
637 rootH1_10126298
638 JGI25160J50197_1006539
639 JGI25161J50226_1000201
640 JGI25161J50226_1004252
641 Ga0055539_1007205
642 Ga0055533_1006262
643 Ga0055533_1008429
644 Ga0055525_1000006
645 Ga0055525_1000043
646 Ga0055527_1000305
647 Ga0055527_1000393
648 Ga0055527_1001316
649 Ga0055535_1000652
650 Ga0055535_1000974
651 Ga0055542_1000393
652 Ga0055542_1000672
653 Ga0055542_1000970
654 Ga0055529_1000032
655 Ga0055529_1000409
656 Ga0055529_1000620
657 Ga0055529_1000818
658 Ga0055526_1000018
659 Ga0055526_1000053
660 Ga0055526_1003053
661 Ga0055526_1018147
662 Ga0055537_1000027
663 Ga0055537_1006491
664 Ga0055524_1002546
665 Ga0055524_1002925
666 Ga0055524_1003014
667 Ga0055524_1003992
668 Ga0055534_1000051
669 Ga0055528_1000731
670 Ga0055528_1019049
671 Ga0055530_10002749
672 Ga0055531_10000025
673 Ga0055531_10002488
674 Ga0055531_10048507
675 Ga0055543_1000103
676 Ga0065165_1001082
677 Ga0065165_1001148
678 Ga0070658_10043212
679 Ga0070658_10095341
680 Ga0070660_100006208
681 Ga0070660_100013161
682 Ga0070660_100063787
683 Ga0070659_100024228
684 Ga0070659_100063112
685 Ga0070662_100126404
686 Ga0070662_100353923
687 Ga0068855_100065376
688 Ga0070664_100106815
689 Ga0068865_100430674
690 Ga0099823_1000046
691 Ga0079104_1024665
692 Ga0105244_10001201
693 Ga0105244_10040268
694 Ga0105243_10011176
695 Ga0105241_10016143
696 Ga0105242_10011548
697 Ga0105242_10584387
698 Ga0157371_10000014
699 Ga0157369_10319743
700 Ga0157374_10346819
701 Ga0157378_10204432
702 Ga0157372_10318841
703 Ga0182008_10001070
704 Ga0182006_1000007
705 Ga0182006_1000040
706 Ga0182007_10000068
707 Ga0182005_1000010
708 Ga0182005_1000051
709 Ga0163161_10191791
710 Ga0213872_10000040
711 Ga0213872_10052139
712 Ga0209436_100301
713 Ga0209436_103138
714 Ga0209674_100059
715 Ga0209674_102211
716 Ga0209672_100004
717 Ga0209672_100008
718 Ga0209672_100121
719 Ga0209563_100022
720 Ga0209563_100036
721 Ga0207427_100037
722 Ga0209437_100213
723 Ga0209258_100003
724 Ga0209258_100004
725 Ga0209258_100008
726 Ga0209258_100106
727 Ga0207425_1000017
728 Ga0207425_1000085
729 Ga0207425_1000326
730 Ga0207425_1008410
731 Ga0209646_1000051
732 Ga0209646_1001473
733 Ga0209026_1000045
734 Ga0209026_1003347
735 Ga0209026_1015914
736 Ga0209677_101205
737 Ga0209677_102629
738 Ga0209677_107599
739 Ga0209148_1000025
740 Ga0209148_1000042
741 Ga0209148_1000053
742 Ga0209148_1000678
743 Ga0209759_1000185
744 Ga0209759_1000212
745 Ga0209129_1000162
746 Ga0209233_1000096
747 Ga0209565_1000017
748 Ga0209565_1000452
749 Ga0209565_1002359
750 Ga0209565_1002832
751 Ga0209565_1020281
752 Ga0209455_1000004
753 Ga0209455_1000007
754 Ga0209455_1000016
755 Ga0209455_1000043
756 Ga0209673_1000007
757 Ga0209673_1015546
758 Ga0209130_1000078
759 Ga0209130_1000188
760 Ga0209130_1008273
761 Ga0209675_1000009
762 Ga0209675_1002209
763 Ga0209675_1010711
764 Ga0209025_1024135
765 Ga0209564_1000011
766 Ga0209564_1000036
767 Ga0209564_1000055
768 Ga0209564_1000068
769 Ga0209564_1000343
770 Ga0209564_1002854
771 Ga0209564_1011336
772 Ga0209758_1000250
773 Ga0209758_1001409
774 Ga0209050_1000316
775 Ga0209050_1000612
776 Ga0209050_1001361
777 Ga0209050_1001479
778 Ga0209050_1001484
779 Ga0209050_1015304
780 Ga0209256_1000167
781 Ga0209256_1000184
782 Ga0209256_1000841
783 Ga0209256_1003010
784 Ga0209256_1006853
785 Ga0207426_1007269
786 Ga0207426_1025391
787 Ga0209051_1000869
788 Ga0209051_1005230
789 Ga0209257_1000032
790 Ga0209257_1000123
791 Ga0209257_1003015
792 Ga0207705_10027711
793 Ga0207705_10141331
794 Ga0207695_10212725
795 Ga0207657_10005165
796 Ga0207649_10077810
797 Ga0207690_10079757
798 Ga0207706_10067011
799 Ga0207686_10057360
800 Ga0207679_10076590
801 Ga0207667_10266283
802 Ga0207678_10477564
803 Ga0207702_10000654
804 Ga0209281_1005021
805 Ga0209389_1013868
806 Ga0265338_10000331
807 Ga0265338_10008840
808 Ga0316182_1011444
809 Ga0316182_1278328
810 Ga0307513_10403823
811 Ga0307408_100000092
812 Ga0307408_100000286
813 Ga0307408_100000419
814 Ga0307408_100003582
815 Ga0307408_100005970
816 Ga0307408_100021916
817 Ga0307408_100216164
818 Ga0307408_100364314
819 Ga0316576_10000921
820 Ga0316576_10040422
821 Ga0316576_10170457
822 Ga0316578_10050384
823 Ga0307518_10099607
824 Ga0307406_10028255
825 Ga0307409_100022485
826 Ga0307416_100197720
827 Ga0307416_100284591
828 Ga0307414_10061003
829 Ga0395899_0000293
830 Ga0395899_0003754
831 Ga0395899_0214669
832 Ga0395900_0000011
833 Ga0395900_0010023
834 Ga0395900_0036179
835 Ga0395900_0186020
836 Ga0395900_0196590
837 Ga0395898_0000029
838 Ga0395898_0039140
839 Ga0395898_0251856
840 Ga0395905_0326109
841 Ga0395901_0000019
842 Ga0395901_0024509
843 Ga0436361_0424561
844 Ga0436361_0617438
845 Ga0436361_1177289
846 Ga0450890_000853
847 Ga0450891_002414
848 Ga0439446_0010941
849 Ga0439458_0028525
850 Ga0451577_0000642
851 Ga0466969_0047280
852 Ga0466972_0009564
853 Ga0466982_0066678
854 Ga0466965_0007237
855 Ga0466965_0015756
856 Ga0466965_0045762
857 Ga0466966_0006384
858 Ga0466966_0011051
859 Ga0466966_0126037
860 Ga0466961_0000272
861 Ga0466961_0000299
862 Ga0466961_0004718
863 Ga0466961_0013395
864 Ga0466961_0135886
865 Ga0466961_0175105
866 Ga0466964_0025245
867 Ga0466968_0004950
868 Ga0466970_0000201
869 Ga0466970_0012603
870 Ga0466957_0000104
871 Ga0466957_0067208
872 Ga0466957_0079841
873 Ga0466959_0000006
874 Ga0466959_0003643
875 Ga0466959_0077725
876 Ga0466959_0208225
877 Ga0451576_0000098
878 Ga0451576_0016173
879 Ga0466958_0032112
880 Ga0466958_0032623
881 Ga0466967_0150808
882 Ga0466967_0531929
883 Ga0495617_000003
884 Ga0495617_000208
885 Ga0495617_004548
886 Ga0495603_0012166
887 Ga0495590_0000001
888 Ga0495590_0001769
889 Ga0495590_0010308
890 Ga0495590_0025477
891 Ga0495590_0032711
892 Ga0495638_0006478
893 Ga0495653_0000002
894 Ga0495653_0013560
895 Ga0495650_0000001
896 Ga0495650_0000072
897 Ga0495650_0000267
898 Ga0495650_0000427
899 Ga0495650_0004037
900 Ga0495650_0005248
901 Ga0495650_0046968
902 Ga0495605_0000065
903 Ga0495605_0000103
904 Ga0495605_0006806
905 Ga0495605_0009486
906 Ga0495605_0010607
907 Ga0495605_0013758
908 Ga0495605_0131119
909 Ga0495639_0023644
910 Ga0495584_0000009
911 Ga0495584_0000182
912 Ga0495584_0000904
913 Ga0495584_0006880
914 Ga0495584_0008198
915 Ga0495584_0011178
916 Ga0495584_0011989
917 Ga0495585_0000154
918 Ga0495585_0000260
919 Ga0495585_0000940
920 Ga0495585_0002583
921 Ga0495585_0007271
922 Ga0495585_0026872
923 Ga0495585_0041966
924 Ga0495585_0091316
925 Ga0495596_0010296
926 Ga0495596_0015031
927 Ga0495596_0018205
928 Ga0495596_0018821
929 Ga0495596_0128062
930 Ga0495607_0000644
931 Ga0495607_0009099
932 Ga0495607_0034933
933 Ga0495607_0040486
934 Ga0495607_0060402
935 Ga0495583_0000008
936 Ga0495583_0000050
937 Ga0495583_0000064
938 Ga0495583_0000253
939 Ga0495583_0016130
940 Ga0495583_0018718
941 Ga0495583_0034199
942 Ga0495606_0000001
943 Ga0495606_0000030
944 Ga0495606_0000282
945 Ga0495606_0003624
946 Ga0495606_0005214
947 Ga0495606_0010442
948 Ga0495606_0024337
949 Ga0495610_0000003
950 Ga0495610_0001826
951 Ga0495610_0009770
952 Ga0495610_0016720
953 Ga0495610_0041049
954 Ga0495616_0000012
955 Ga0495616_0000283
956 Ga0495616_0001100
957 Ga0495616_0006912
958 Ga0495616_0052135
959 Ga0495616_0055424
960 Ga0495616_0076573
961 Ga0495631_0000214
962 Ga0495631_0003192
963 Ga0495631_0007582
964 Ga0495631_0078034
965 Ga0495632_0000117
966 Ga0495632_0000151
967 Ga0495632_0000405
968 Ga0495632_0002250
969 Ga0495637_0000042
970 Ga0495643_0000028
971 Ga0495643_0000285
972 Ga0495643_0009345
973 Ga0495643_0018663
974 Ga0495643_0018836
975 Ga0495643_0083757
976 Ga0495643_0093325
977 Ga0495644_0026277
978 Ga0495648_0000001
979 Ga0495648_0000079
980 Ga0495648_0005786
981 Ga0495648_0014982
982 Ga0495648_0016643
983 Ga0495648_0023950
984 Ga0495648_0027847
985 Ga0495648_0033278
986 Ga0495648_0040219
987 Ga0495648_0058300
988 Ga0495642_0002229
989 Ga0495642_0002749
990 Ga0495642_0004777
991 Ga0495654_0000037
992 Ga0495654_0008463
993 Ga0495654_0009920
994 Ga0495654_0016392
995 Ga0495654_0040665
996 Ga0495654_0073473
997 Ga0495609_0000026
998 Ga0495609_0000241
999 Ga0495609_0001046
1000 Ga0495609_0013197
1001 Ga0495609_0015872
1002 Ga0495609_0018079
1003 Ga0495609_0064905
1004 Ga0495597_0000073
1005 Ga0495597_0000705
1006 Ga0495597_0000864
1007 Ga0495597_0004402
1008 Ga0495597_0008100
1009 Ga0495622_0000131
1010 Ga0495622_0026719
1011 Ga0495622_0030689
1012 Ga0495633_0000055
1013 Ga0495633_0000106
1014 Ga0495633_0000675
1015 Ga0495633_0013433
1016 Ga0495633_0018016
1017 Ga0495633_0018951
1018 Ga0495656_0006356
1019 Ga0495656_0049412
1020 Ga0495656_0155497
1021 Ga0495668_0000190
1022 Ga0495668_0000565
1023 Ga0495668_0001065
1024 Ga0495668_0001873
1025 Ga0495668_0002146
1026 Ga0495668_0006874
1027 Ga0495668_0013236
1028 Ga0495668_0016126
1029 Ga0495668_0019446
1030 Ga0495611_0000151
1031 Ga0495611_0018928
1032 Ga0495611_0066432
1033 Ga0495625_0000035
1034 Ga0495625_0000391
1035 Ga0495625_0002897
1036 Ga0495625_0017011
1037 Ga0495625_0023692
1038 Ga0495625_0043513
1039 Ga0495625_0076343
1040 Ga0495625_0131621
1041 Ga0495659_0000158
1042 Ga0495659_0028445
1043 Ga0495659_0041143
1044 Ga0495661_0000152
1045 Ga0495661_0000715
1046 Ga0495661_0006925
1047 Ga0495661_0008169
1048 Ga0495661_0016799
1049 Ga0495661_0103006
1050 Ga0495588_0000139
1051 Ga0495646_0046872
1052 Ga0495669_0002681
1053 Ga0495669_0021045
1054 Ga0495670_0000114
1055 Ga0495670_0006155
1056 Ga0495670_0010977
1057 Ga0495670_0088515
1058 Ga0495671_0000010
1059 Ga0495671_0002314
1060 Ga0495671_0006896
1061 Ga0495671_0007326
1062 Ga0495671_0007720
1063 Ga0495649_0035077
1064 Ga0495649_0041820
1065 Ga0495649_0042748
1066 Ga0495649_0048270
1067 Ga0495649_0065306
1068 Ga0495649_0070323
1069 Ga0495589_0000100
1070 Ga0495589_0000101
1071 Ga0495589_0037719
1072 Ga0495589_0100712
1073 Ga0495660_0000027
1074 Ga0495660_0000335
1075 Ga0495660_0001827
1076 Ga0495660_0010965
1077 Ga0495660_0020088
1078 Ga0495660_0039111
1079 Ga0495660_0041760
1080 Ga0495660_0052366
1081 Ga0495636_0003252
1082 Ga0495636_0042115
1083 Ga0495672_0000220
1084 Ga0495672_0000221
1085 Ga0495672_0002445
1086 Ga0495672_0002802
1087 Ga0495672_0007979
1088 Ga0495680_0025635
1089 Ga0495683_0000064
1090 Ga0495683_0001336
1091 Ga0495683_0032651
1092 Ga0495687_000012
1093 Ga0495687_000037
1094 Ga0495687_000062
1095 Ga0495687_000122
1096 Ga0495687_003478
1097 Ga0495677_0000014
1098 Ga0495677_0003124
1099 Ga0495677_0004220
1100 Ga0495677_0032844
1101 Ga0495679_001792
1102 Ga0495679_004418
1103 Ga0495685_000262
1104 Ga0495685_001925
1105 Ga0495673_0000003
1106 Ga0495673_0000016
1107 Ga0495673_0000035
1108 Ga0495673_0003607
1109 Ga0495681_0000021
1110 Ga0495681_0000246
1111 Ga0495681_0006028
1112 Ga0495681_0015183
1113 Ga0495681_0024947
1114 Ga0495686_0000047
1115 Ga0495686_0007983
1116 Ga0495686_0008813
1117 Ga0495686_0096437
1118 Ga0495686_0149193
1119 Ga0495626_0000222
1120 Ga0495626_0001784
1121 Ga0495626_0008414
1122 Ga0495626_0015604
1123 Ga0495626_0089155
1124 Ga0495626_0095110
1125 Ga0495626_0137873
1126 Ga0496102_0049277
1127 Ga0496102_0147844
1128 Ga0496103_0178087
1129 Ga0496106_0030710
1130 Ga0496108_0329777
1131 Ga0496109_0199668
1132 Ga0496110_0000026
1133 Ga0496111_0041791
1134 Ga0496111_0050164
1135 Ga0496113_0001992
1136 Ga0496117_0000005
1137 Ga0496118_0000022
1138 Ga0496120_0039174
1139 Ga0496121_0004143
1140 Ga0496121_0041960
1141 Ga0496122_0001132
1142 Ga0496122_0020696
1143 Ga0496122_0025368
1144 Ga0496122_0050365
1145 Ga0496123_0003516
1146 Ga0496123_0005149
1147 Ga0496123_0006339
1148 Ga0496124_0024602
1149 Ga0496124_0084520
1150 Ga0496124_0142299
1151 Ga0496124_0162170
1152 Ga0496126_0004427
1153 Ga0495678_000002
1154 Ga0495678_000029
1155 Ga0495678_000045
1156 Ga0495678_000663
1157 Ga0495678_004929
1158 Ga0495678_024725
1159 Ga0495682_0000208
1160 Ga0495682_0000628
1161 Ga0495682_0071136
1162 Ga0501311_001840
1163 Ga0501316_003450
1164 Ga0501335_000226
1165 Ga0501034_0103678
1166 Ga0501036_0156079
1167 Ga0501198_009956
1168 Ga0501207_007153
1169 Ga0501217_015353
1170 Ga0501222_003666
1171 Ga0501227_002485
1172 Ga0501227_003667
1173 Ga0501240_007331
1174 Ga0501249_002660
1175 Ga0501269_000700
1176 Ga0501279_004021
1177 Ga0501035_0011980
1178 Ga0501044_0588127
1179 Ga0500594_0002831
1180 Ga0500618_000068
1181 Ga0500586_001379
1182 Ga0587083_0004084
1183 2601671312
1184 2643789486
1185 2643801500
1186 2644216057
1187 2644251262
1188 2644357529
1189 2644471438
1190 2691331105
1191 2738713391
1192 2738740120
1193 2738829884
1194 2738844115
1195 2739153680
1196 2739195600
1197 2739274322
1198 2739322076
1199 2739340317
1200 2739343366
1201 2842715518
1202 2857548848
1203 2857555921
1204 2857566937
1205 2885080357
1206 2904425720
1207 2916179111
1208 2919478254
1209 2919500168
1210 2919534667
1211 2919691630
1212 2932415456
1213 2932421383
1214 2937613548
1215 8047677196
1216 8054358010

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04616

Glyco_hydro_43

Glycosyl hydrolases family 43

6

306

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3k1u-assembly1.cif.gz_A beta-xylosidase, family 43 glycosyl hydrolase from clostridium acetobutylicum 0.9767 3 310
5m8b-assembly1.cif.gz_B crystal structure of alpha-l-arabinofuranosidase from lactobacillus brevis 0.9717 3 310
5m8e-assembly1.cif.gz_B crystal structure of a gh43 arabonofuranosidase from weissella sp. strain 142 0.9682 1 310
3akh-assembly1.cif.gz_A crystal structure of exo-1,5-alpha-l-arabinofuranosidase complexed with alpha-1,5-l-arabinofuranotriose 0.9682 3 309
3k1u-assembly1.cif.gz_A beta-xylosidase, family 43 glycosyl hydrolase from clostridium acetobutylicum 0.9554 3 310
ID Description Score Start End Superfamily
3akhA01 Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 0.9682 3 309 2.115.10.20
3akhA01 Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 0.9498 3 309 2.115.10.20
4qqsA00 Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 0.8123 3 316 2.115.10.20
3kstA00 Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 0.8088 4 307 2.115.10.20
5z5fA01 Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 0.8015 1 314 2.115.10.20
ID Description Score Start End GO Terms
AF-A0A377WCH1-F1-model_v4 Alpha-L-arabinofuranosidase II (EC 3.2.1.55) 0.9909 5 68 GO:0005975
GO:0046556
AF-A0A379WGH8-F1-model_v4 Glycosyl hydrolase (EC 3.2.1.55) 0.9867 5 183 GO:0005975
GO:0046556
AF-A0A2N5AG52-F1-model_v4 Alpha-N-arabinofuranosidase 0.9848 5 197 GO:0004553
GO:0005975
AF-A0A656YHE7-F1-model_v4 deleted 0.9844 5 162
AF-A0A379TQ40-F1-model_v4 Glycosyl hydrolase (EC 3.2.1.55) 0.9819 1 116 GO:0005975
GO:0046556

Map