F468802
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 608 | 259 | 1216 | 319 |
Family's Representative Sequence
| Representative Sequence | 3300037312|Ga0395899_0000226|Ga0395899_0000226_35783_36754 |
| Length | 323 |
| Sequence | MLAMKLANPFILNRADPFVGRHDGHYHFTASVPEYDRIILRRSATLEGLATAEEFVLWRAPASGAASALIWAPEIHRFEDAWYIYFAAAPSRDIKDGLFQHRMYALRNPAADPTTGEWQFVGQVDSGIDAFCLDATSFRHRGQNYYVWAQKHPDIPGNSNLYIAPLATPTTLAAAPVLLTRPELDWEVQGFAVNEGPAVLIRHGKVFITYSASATDERYAMGLLWADAEADLLDARNWHKSPTPVFVTDVERQVFGPGHNSFTVDGDTDLMIYHARDYREIEGDPLWNADRHARVHLLSWDAQGMPVFGRPQREVEWSAGVTA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 2 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 3 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 4 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 5 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 6 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 7 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 8 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 9 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 10 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 11 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 12 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 13 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 14 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 15 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 16 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 17 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 18 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 19 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 20 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 22 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 23 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 24 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 25 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 26 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 27 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 28 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 29 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 30 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 31 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 32 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 33 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 34 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 39 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 41 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 42 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 43 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 53 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 54 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 55 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 56 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 58 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 59 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 60 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 61 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 66 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 67 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 68 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 71 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 72 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 74 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 76 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 78 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 80 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 83 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 98 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 99 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 100 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 101 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 102 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 103 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 104 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 105 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 106 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 107 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 108 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 109 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 110 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 111 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 112 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 113 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 114 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 115 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 116 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 117 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 118 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 119 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 120 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 121 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 122 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 123 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 124 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 125 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 126 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 127 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 128 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 129 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 130 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 131 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 132 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 133 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 134 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 189 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 190 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 191 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 192 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 193 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 194 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 195 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 196 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 197 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 198 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 199 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 200 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 201 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 202 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 203 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 204 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 207 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 208 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 209 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 210 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 211 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 212 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 213 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 214 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 215 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 216 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 217 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 218 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 219 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 220 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 221 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 222 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 223 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 224 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 225 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 226 | 2600255292 | Janthinobacterium lividum NFR18 | Isolate | Rhizoplane |
| 227 | 2643221554 | Duganella sp. Root1480D1 | Isolate | Unclassified |
| 228 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 229 | 2643221638 | Duganella sp. Root336D2 | Isolate | Unclassified |
| 230 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 231 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 232 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 233 | 2690315857 | Rheinheimera sp. EpRS3 | Isolate | Unclassified |
| 234 | 2738541276 | Cellvibrio sp. YR554 | Isolate | Unclassified |
| 235 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 236 | 2738541297 | Duganella sp. GV083 | Isolate | Unclassified |
| 237 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 238 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 239 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 240 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 241 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 242 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 243 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 244 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 245 | 2857547612 | Janthinobacterium sp. R-74502 | Isolate | Unclassified |
| 246 | 2857553236 | Duganella sp. R-74557 | Isolate | Unclassified |
| 247 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 248 | 2885080285 | Janthinobacterium sp. AD80 | Isolate | Rhizosphere |
| 249 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 250 | 2916178963 | Pseudoalteromonas rhizosphaerae RA15 | Isolate | Rhizosphere |
| 251 | 2919476304 | Duganella sp. 3397 | Isolate | Unclassified |
| 252 | 2919497567 | Shewanella putrefaciens 3469 | Isolate | Unclassified |
| 253 | 2919534386 | Rheinheimera pacifica 3879 | Isolate | Unclassified |
| 254 | 2919688452 | Pararheinheimera soli 4138 | Isolate | Unclassified |
| 255 | 2932410948 | Janthinobacterium lividum 2829 | Isolate | Rhizosphere |
| 256 | 2932416698 | Janthinobacterium lividum 2830 | Isolate | Rhizosphere |
| 257 | 2937610967 | Stenotrophomonas maltophilia EP20 | Isolate | Unclassified |
| 258 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
| 259 | 8054357960 | Idiomarina rhizosphaerae M1R2S28 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.75 |
| Metatranscriptomes | 0.66 |
| Isolates | 5.59 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 21.05 |
| Nodule | 0.66 |
| Rhizoplane | 1.81 |
| Rhizosphere | 65.13 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0395899_0000226 | 3300037312 | Bacteria | 76657 |
| 2 | JGI25156J39149_1003241 | 3300002705 | Bacteria | 5417 |
| 3 | JGI25156J39149_1007056 | 3300002705 | Bacteria | 3001 |
| 4 | JGI25162J39368_1003969 | 3300002737 | Bacteria | 3768 |
| 5 | JGI25154J39366_1000503 | 3300002738 | Bacteria | 19923 |
| 6 | JGI25154J39366_1004732 | 3300002738 | Bacteria | 2344 |
| 7 | JGI25158J39367_1004471 | 3300002739 | Bacteria | 2099 |
| 8 | JGI25157J39369_1000256 | 3300002741 | Bacteria | 39240 |
| 9 | JGI25157J39369_1002177 | 3300002741 | Bacteria | 5417 |
| 10 | JGI25164J39214_1000064 | 3300002772 | Bacteria | 107073 |
| 11 | JGI25152J39213_1000026 | 3300002773 | Bacteria | 101759 |
| 12 | JGI25152J39213_1004392 | 3300002773 | Bacteria | 4451 |
| 13 | JGI25150J39212_1000478 | 3300002774 | Bacteria | 16992 |
| 14 | JGI25150J39212_1004201 | 3300002774 | Bacteria | 3241 |
| 15 | JGI25150J39212_1005449 | 3300002774 | Bacteria | 2713 |
| 16 | JGI25159J45721_1000676 | 3300002987 | Bacteria | 15043 |
| 17 | JGI25159J45721_1002470 | 3300002987 | Bacteria | 7008 |
| 18 | JGI25159J45721_1014739 | 3300002987 | Bacteria | 1747 |
| 19 | JGI25165J46597_1000278 | 3300003214 | Bacteria | 65807 |
| 20 | rootH1_10015702 | 3300003316 | Bacteria | 7606 |
| 21 | rootH2_10011530 | 3300003320 | Bacteria | 1147 |
| 22 | rootL2_10001989 | 3300003322 | Bacteria | 3909 |
| 23 | rootL2_10002151 | 3300003322 | Bacteria | 70803 |
| 24 | rootL2_10070531 | 3300003322 | Bacteria | 7438 |
| 25 | rootL2_10136594 | 3300003322 | Bacteria | 10983 |
| 26 | rootH1_10002339 | 3300003323 | Bacteria | 35435 |
| 27 | rootH1_10042111 | 3300003323 | Bacteria | 8238 |
| 28 | rootH1_10069919 | 3300003323 | Bacteria | 7127 |
| 29 | rootH1_10126298 | 3300003323 | Bacteria | 3360 |
| 30 | JGI25160J50197_1006539 | 3300003354 | Bacteria | 4702 |
| 31 | JGI25161J50226_1000201 | 3300003374 | Bacteria | 39071 |
| 32 | JGI25161J50226_1004252 | 3300003374 | Bacteria | 3040 |
| 33 | Ga0055539_1007205 | 3300003752 | Bacteria | 1411 |
| 34 | Ga0055533_1006262 | 3300003756 | Bacteria | 1779 |
| 35 | Ga0055533_1008429 | 3300003756 | Bacteria | 1306 |
| 36 | Ga0055525_1000006 | 3300003759 | Bacteria | 642912 |
| 37 | Ga0055525_1000043 | 3300003759 | Bacteria | 268656 |
| 38 | Ga0055527_1000305 | 3300003760 | Bacteria | 27630 |
| 39 | Ga0055527_1000393 | 3300003760 | Bacteria | 18682 |
| 40 | Ga0055527_1001316 | 3300003760 | Bacteria | 5369 |
| 41 | Ga0055535_1000652 | 3300003761 | Bacteria | 27630 |
| 42 | Ga0055535_1000974 | 3300003761 | Bacteria | 18682 |
| 43 | Ga0055542_1000393 | 3300003762 | Bacteria | 43699 |
| 44 | Ga0055542_1000672 | 3300003762 | Bacteria | 27630 |
| 45 | Ga0055542_1000970 | 3300003762 | Bacteria | 18685 |
| 46 | Ga0055529_1000032 | 3300003763 | Bacteria | 255895 |
| 47 | Ga0055529_1000409 | 3300003763 | Bacteria | 45120 |
| 48 | Ga0055529_1000620 | 3300003763 | Bacteria | 26580 |
| 49 | Ga0055529_1000818 | 3300003763 | Bacteria | 18682 |
| 50 | Ga0055526_1000018 | 3300003771 | Bacteria | 198838 |
| 51 | Ga0055526_1000053 | 3300003771 | Bacteria | 114820 |
| 52 | Ga0055526_1003053 | 3300003771 | Bacteria | 10879 |
| 53 | Ga0055526_1018147 | 3300003771 | Bacteria | 2642 |
| 54 | Ga0055537_1000027 | 3300003773 | Bacteria | 102244 |
| 55 | Ga0055537_1006491 | 3300003773 | Bacteria | 2956 |
| 56 | Ga0055524_1002546 | 3300003775 | Bacteria | 9318 |
| 57 | Ga0055524_1002925 | 3300003775 | Bacteria | 8521 |
| 58 | Ga0055524_1003014 | 3300003775 | Bacteria | 8346 |
| 59 | Ga0055524_1003992 | 3300003775 | Bacteria | 6961 |
| 60 | Ga0055534_1000051 | 3300003784 | Bacteria | 92183 |
| 61 | Ga0055528_1000731 | 3300003790 | Bacteria | 23155 |
| 62 | Ga0055528_1019049 | 3300003790 | Bacteria | 2296 |
| 63 | Ga0055530_10002749 | 3300003791 | Bacteria | 10883 |
| 64 | Ga0055531_10000025 | 3300003794 | Bacteria | 161475 |
| 65 | Ga0055531_10002488 | 3300003794 | Bacteria | 12289 |
| 66 | Ga0055531_10048507 | 3300003794 | Bacteria | 1144 |
| 67 | Ga0055543_1000103 | 3300004625 | Bacteria | 73828 |
| 68 | Ga0065165_1001082 | 3300005262 | Bacteria | 32470 |
| 69 | Ga0065165_1001148 | 3300005262 | Bacteria | 30990 |
| 70 | Ga0070658_10043212 | 3300005327 | Bacteria | 3641 |
| 71 | Ga0070658_10095341 | 3300005327 | Bacteria | 2456 |
| 72 | Ga0070660_100006208 | 3300005339 | Bacteria | 8271 |
| 73 | Ga0070660_100013161 | 3300005339 | Bacteria | 5929 |
| 74 | Ga0070660_100063787 | 3300005339 | Bacteria | 2864 |
| 75 | Ga0070659_100024228 | 3300005366 | Bacteria | 4651 |
| 76 | Ga0070659_100063112 | 3300005366 | Bacteria | 2930 |
| 77 | Ga0070662_100126404 | 3300005457 | Bacteria | 1966 |
| 78 | Ga0070662_100353923 | 3300005457 | Bacteria | 1204 |
| 79 | Ga0068855_100065376 | 3300005563 | Bacteria | 4240 |
| 80 | Ga0070664_100106815 | 3300005564 | Bacteria | 2439 |
| 81 | Ga0068865_100430674 | 3300006881 | Bacteria | 1087 |
| 82 | Ga0099823_1000046 | 3300006944 | Bacteria | 60074 |
| 83 | Ga0079104_1024665 | 3300006946 | Bacteria | 1580 |
| 84 | Ga0105244_10001201 | 3300009036 | Bacteria | 21301 |
| 85 | Ga0105244_10040268 | 3300009036 | Bacteria | 2428 |
| 86 | Ga0105243_10011176 | 3300009148 | Bacteria | 6791 |
| 87 | Ga0105241_10016143 | 3300009174 | Bacteria | 5474 |
| 88 | Ga0105242_10011548 | 3300009176 | Bacteria | 6793 |
| 89 | Ga0105242_10584387 | 3300009176 | Bacteria | 1076 |
| 90 | Ga0157371_10000014 | 3300013102 | Bacteria | 347490 |
| 91 | Ga0157369_10319743 | 3300013105 | Bacteria | 1613 |
| 92 | Ga0157374_10346819 | 3300013296 | Bacteria | 1475 |
| 93 | Ga0157378_10204432 | 3300013297 | Bacteria | 1870 |
| 94 | Ga0157372_10318841 | 3300013307 | Bacteria | 1810 |
| 95 | Ga0182008_10001070 | 3300014497 | Bacteria | 18895 |
| 96 | Ga0182006_1000007 | 3300015261 | Bacteria | 452190 |
| 97 | Ga0182006_1000040 | 3300015261 | Bacteria | 209209 |
| 98 | Ga0182007_10000068 | 3300015262 | Bacteria | 82301 |
| 99 | Ga0182005_1000010 | 3300015265 | Bacteria | 434103 |
| 100 | Ga0182005_1000051 | 3300015265 | Bacteria | 114808 |
| 101 | Ga0163161_10191791 | 3300017792 | Bacteria | 1571 |
| 102 | Ga0213872_10000040 | 3300021361 | Bacteria | 122419 |
| 103 | Ga0213872_10052139 | 3300021361 | Bacteria | 1856 |
| 104 | Ga0209436_100301 | 3300025208 | Bacteria | 22729 |
| 105 | Ga0209436_103138 | 3300025208 | Bacteria | 4539 |
| 106 | Ga0209674_100059 | 3300025226 | Bacteria | 282517 |
| 107 | Ga0209674_102211 | 3300025226 | Bacteria | 4316 |
| 108 | Ga0209672_100004 | 3300025228 | Bacteria | 1467504 |
| 109 | Ga0209672_100008 | 3300025228 | Bacteria | 946876 |
| 110 | Ga0209672_100121 | 3300025228 | Bacteria | 83609 |
| 111 | Ga0209563_100022 | 3300025230 | Bacteria | 643318 |
| 112 | Ga0209563_100036 | 3300025230 | Bacteria | 448275 |
| 113 | Ga0207427_100037 | 3300025231 | Bacteria | 303108 |
| 114 | Ga0209437_100213 | 3300025233 | Bacteria | 107087 |
| 115 | Ga0209258_100003 | 3300025242 | Bacteria | 1467504 |
| 116 | Ga0209258_100004 | 3300025242 | Bacteria | 1376422 |
| 117 | Ga0209258_100008 | 3300025242 | Bacteria | 1009355 |
| 118 | Ga0209258_100106 | 3300025242 | Bacteria | 206622 |
| 119 | Ga0207425_1000017 | 3300025245 | Bacteria | 423851 |
| 120 | Ga0207425_1000085 | 3300025245 | Bacteria | 95577 |
| 121 | Ga0207425_1000326 | 3300025245 | Bacteria | 33697 |
| 122 | Ga0207425_1008410 | 3300025245 | Bacteria | 2645 |
| 123 | Ga0209646_1000051 | 3300025246 | Bacteria | 296525 |
| 124 | Ga0209646_1001473 | 3300025246 | Bacteria | 6272 |
| 125 | Ga0209026_1000045 | 3300025250 | Bacteria | 263431 |
| 126 | Ga0209026_1003347 | 3300025250 | Bacteria | 5321 |
| 127 | Ga0209026_1015914 | 3300025250 | Bacteria | 1226 |
| 128 | Ga0209677_101205 | 3300025253 | Bacteria | 11774 |
| 129 | Ga0209677_102629 | 3300025253 | Bacteria | 6527 |
| 130 | Ga0209677_107599 | 3300025253 | Bacteria | 2266 |
| 131 | Ga0209148_1000025 | 3300025254 | Bacteria | 663262 |
| 132 | Ga0209148_1000042 | 3300025254 | Bacteria | 464111 |
| 133 | Ga0209148_1000053 | 3300025254 | Bacteria | 373506 |
| 134 | Ga0209148_1000678 | 3300025254 | Bacteria | 28482 |
| 135 | Ga0209759_1000185 | 3300025256 | Bacteria | 100505 |
| 136 | Ga0209759_1000212 | 3300025256 | Bacteria | 89756 |
| 137 | Ga0209129_1000162 | 3300025258 | Bacteria | 101248 |
| 138 | Ga0209233_1000096 | 3300025261 | Bacteria | 303482 |
| 139 | Ga0209565_1000017 | 3300025263 | Bacteria | 462438 |
| 140 | Ga0209565_1000452 | 3300025263 | Bacteria | 31667 |
| 141 | Ga0209565_1002359 | 3300025263 | Bacteria | 6878 |
| 142 | Ga0209565_1002832 | 3300025263 | Bacteria | 5971 |
| 143 | Ga0209565_1020281 | 3300025263 | Bacteria | 1405 |
| 144 | Ga0209455_1000004 | 3300025272 | Bacteria | 1467504 |
| 145 | Ga0209455_1000007 | 3300025272 | Bacteria | 1157983 |
| 146 | Ga0209455_1000016 | 3300025272 | Bacteria | 753097 |
| 147 | Ga0209455_1000043 | 3300025272 | Bacteria | 413928 |
| 148 | Ga0209673_1000007 | 3300025273 | Bacteria | 634477 |
| 149 | Ga0209673_1015546 | 3300025273 | Bacteria | 2884 |
| 150 | Ga0209130_1000078 | 3300025284 | Bacteria | 169374 |
| 151 | Ga0209130_1000188 | 3300025284 | Bacteria | 86963 |
| 152 | Ga0209130_1008273 | 3300025284 | Bacteria | 3088 |
| 153 | Ga0209675_1000009 | 3300025291 | Bacteria | 562872 |
| 154 | Ga0209675_1002209 | 3300025291 | Bacteria | 10181 |
| 155 | Ga0209675_1010711 | 3300025291 | Bacteria | 3106 |
| 156 | Ga0209025_1024135 | 3300025294 | Bacteria | 3152 |
| 157 | Ga0209564_1000011 | 3300025295 | Bacteria | 822327 |
| 158 | Ga0209564_1000036 | 3300025295 | Bacteria | 423455 |
| 159 | Ga0209564_1000055 | 3300025295 | Bacteria | 343782 |
| 160 | Ga0209564_1000068 | 3300025295 | Bacteria | 311171 |
| 161 | Ga0209564_1000343 | 3300025295 | Bacteria | 89036 |
| 162 | Ga0209564_1002854 | 3300025295 | Bacteria | 12705 |
| 163 | Ga0209564_1011336 | 3300025295 | Bacteria | 4006 |
| 164 | Ga0209758_1000250 | 3300025297 | Bacteria | 109992 |
| 165 | Ga0209758_1001409 | 3300025297 | Bacteria | 28501 |
| 166 | Ga0209050_1000316 | 3300025298 | Bacteria | 98257 |
| 167 | Ga0209050_1000612 | 3300025298 | Bacteria | 56207 |
| 168 | Ga0209050_1001361 | 3300025298 | Bacteria | 26758 |
| 169 | Ga0209050_1001479 | 3300025298 | Bacteria | 25051 |
| 170 | Ga0209050_1001484 | 3300025298 | Bacteria | 24939 |
| 171 | Ga0209050_1015304 | 3300025298 | Bacteria | 3230 |
| 172 | Ga0209256_1000167 | 3300025299 | Bacteria | 133419 |
| 173 | Ga0209256_1000184 | 3300025299 | Bacteria | 121336 |
| 174 | Ga0209256_1000841 | 3300025299 | Bacteria | 38507 |
| 175 | Ga0209256_1003010 | 3300025299 | Bacteria | 12470 |
| 176 | Ga0209256_1006853 | 3300025299 | Bacteria | 5857 |
| 177 | Ga0207426_1007269 | 3300025302 | Bacteria | 4662 |
| 178 | Ga0207426_1025391 | 3300025302 | Bacteria | 1995 |
| 179 | Ga0209051_1000869 | 3300025303 | Bacteria | 30576 |
| 180 | Ga0209051_1005230 | 3300025303 | Bacteria | 7663 |
| 181 | Ga0209257_1000032 | 3300025304 | Bacteria | 680354 |
| 182 | Ga0209257_1000123 | 3300025304 | Bacteria | 219092 |
| 183 | Ga0209257_1003015 | 3300025304 | Bacteria | 15235 |
| 184 | Ga0207705_10027711 | 3300025909 | Bacteria | 4041 |
| 185 | Ga0207705_10141331 | 3300025909 | Bacteria | 1798 |
| 186 | Ga0207695_10212725 | 3300025913 | Bacteria | 1843 |
| 187 | Ga0207657_10005165 | 3300025919 | Bacteria | 13694 |
| 188 | Ga0207649_10077810 | 3300025920 | Bacteria | 2138 |
| 189 | Ga0207690_10079757 | 3300025932 | Bacteria | 2282 |
| 190 | Ga0207706_10067011 | 3300025933 | Bacteria | 3158 |
| 191 | Ga0207686_10057360 | 3300025934 | Bacteria | 2451 |
| 192 | Ga0207679_10076590 | 3300025945 | Bacteria | 2542 |
| 193 | Ga0207667_10266283 | 3300025949 | Bacteria | 1752 |
| 194 | Ga0207678_10477564 | 3300026067 | Bacteria | 1085 |
| 195 | Ga0207702_10000654 | 3300026078 | Bacteria | 37703 |
| 196 | Ga0209281_1005021 | 3300027111 | Bacteria | 3776 |
| 197 | Ga0209389_1013868 | 3300027296 | Bacteria | 7326 |
| 198 | Ga0265338_10000331 | 3300028800 | Bacteria | 85997 |
| 199 | Ga0265338_10008840 | 3300028800 | Bacteria | 12153 |
| 200 | Ga0316182_1011444 | 3300030745 | Bacteria | 1939 |
| 201 | Ga0316182_1278328 | 3300030745 | Bacteria | 4284 |
| 202 | Ga0307513_10403823 | 3300031456 | Bacteria | 1100 |
| 203 | Ga0307408_100000092 | 3300031548 | Bacteria | 98953 |
| 204 | Ga0307408_100000286 | 3300031548 | Bacteria | 50236 |
| 205 | Ga0307408_100000419 | 3300031548 | Bacteria | 38162 |
| 206 | Ga0307408_100003582 | 3300031548 | Bacteria | 10582 |
| 207 | Ga0307408_100005970 | 3300031548 | Bacteria | 8110 |
| 208 | Ga0307408_100021916 | 3300031548 | Bacteria | 4332 |
| 209 | Ga0307408_100216164 | 3300031548 | Bacteria | 1561 |
| 210 | Ga0307408_100364314 | 3300031548 | Bacteria | 1231 |
| 211 | Ga0316576_10000921 | 3300031727 | Bacteria | 15034 |
| 212 | Ga0316576_10040422 | 3300031727 | Bacteria | 3353 |
| 213 | Ga0316576_10170457 | 3300031727 | Bacteria | 1643 |
| 214 | Ga0316578_10050384 | 3300031728 | Bacteria | 2436 |
| 215 | Ga0307518_10099607 | 3300031838 | Bacteria | 2082 |
| 216 | Ga0307406_10028255 | 3300031901 | Bacteria | 3387 |
| 217 | Ga0307409_100022485 | 3300031995 | Bacteria | 4349 |
| 218 | Ga0307416_100197720 | 3300032002 | Bacteria | 1904 |
| 219 | Ga0307416_100284591 | 3300032002 | Bacteria | 1632 |
| 220 | Ga0307414_10061003 | 3300032004 | Bacteria | 2670 |
| 221 | Ga0395899_0000293 | 3300037312 | Bacteria | 64438 |
| 222 | Ga0395899_0003754 | 3300037312 | Bacteria | 11998 |
| 223 | Ga0395899_0214669 | 3300037312 | Bacteria | 1335 |
| 224 | Ga0395900_0000011 | 3300037418 | Bacteria | 421926 |
| 225 | Ga0395900_0010023 | 3300037418 | Bacteria | 9696 |
| 226 | Ga0395900_0036179 | 3300037418 | Bacteria | 5088 |
| 227 | Ga0395900_0186020 | 3300037418 | Bacteria | 2108 |
| 228 | Ga0395900_0196590 | 3300037418 | Bacteria | 2042 |
| 229 | Ga0395898_0000029 | 3300037466 | Bacteria | 370667 |
| 230 | Ga0395898_0039140 | 3300037466 | Bacteria | 4694 |
| 231 | Ga0395898_0251856 | 3300037466 | Bacteria | 1684 |
| 232 | Ga0395905_0326109 | 3300037471 | Bacteria | 1425 |
| 233 | Ga0395901_0000019 | 3300038443 | Bacteria | 317063 |
| 234 | Ga0395901_0024509 | 3300038443 | Bacteria | 6193 |
| 235 | Ga0436361_0424561 | 3300039447 | Bacteria | 11268 |
| 236 | Ga0436361_0617438 | 3300039447 | Bacteria | 1668 |
| 237 | Ga0436361_1177289 | 3300039447 | Bacteria | 9479 |
| 238 | Ga0450890_000853 | 3300042127 | Bacteria | 4391 |
| 239 | Ga0450891_002414 | 3300042129 | Bacteria | 1883 |
| 240 | Ga0439446_0010941 | 3300042156 | Bacteria | 2454 |
| 241 | Ga0439458_0028525 | 3300042157 | Bacteria | 1321 |
| 242 | Ga0451577_0000642 | 3300042876 | Bacteria | 55654 |
| 243 | Ga0466969_0047280 | 3300044656 | Bacteria | 2130 |
| 244 | Ga0466972_0009564 | 3300044658 | Bacteria | 4866 |
| 245 | Ga0466982_0066678 | 3300044672 | Bacteria | 2220 |
| 246 | Ga0466965_0007237 | 3300044683 | Bacteria | 5086 |
| 247 | Ga0466965_0015756 | 3300044683 | Bacteria | 3592 |
| 248 | Ga0466965_0045762 | 3300044683 | Bacteria | 2165 |
| 249 | Ga0466966_0006384 | 3300044684 | Bacteria | 7795 |
| 250 | Ga0466966_0011051 | 3300044684 | Bacteria | 5993 |
| 251 | Ga0466966_0126037 | 3300044684 | Bacteria | 1570 |
| 252 | Ga0466961_0000272 | 3300044693 | Bacteria | 34599 |
| 253 | Ga0466961_0000299 | 3300044693 | Bacteria | 32965 |
| 254 | Ga0466961_0004718 | 3300044693 | Bacteria | 8574 |
| 255 | Ga0466961_0013395 | 3300044693 | Bacteria | 5250 |
| 256 | Ga0466961_0135886 | 3300044693 | Bacteria | 1540 |
| 257 | Ga0466961_0175105 | 3300044693 | Bacteria | 1333 |
| 258 | Ga0466964_0025245 | 3300044706 | Bacteria | 2319 |
| 259 | Ga0466968_0004950 | 3300044735 | Bacteria | 4989 |
| 260 | Ga0466970_0000201 | 3300044765 | Bacteria | 28963 |
| 261 | Ga0466970_0012603 | 3300044765 | Bacteria | 4325 |
| 262 | Ga0466957_0000104 | 3300044842 | Bacteria | 34466 |
| 263 | Ga0466957_0067208 | 3300044842 | Bacteria | 2211 |
| 264 | Ga0466957_0079841 | 3300044842 | Bacteria | 2036 |
| 265 | Ga0466959_0000006 | 3300045049 | Bacteria | 192678 |
| 266 | Ga0466959_0003643 | 3300045049 | Bacteria | 10159 |
| 267 | Ga0466959_0077725 | 3300045049 | Bacteria | 2394 |
| 268 | Ga0466959_0208225 | 3300045049 | Bacteria | 1359 |
| 269 | Ga0451576_0000098 | 3300045051 | Bacteria | 220454 |
| 270 | Ga0451576_0016173 | 3300045051 | Bacteria | 8242 |
| 271 | Ga0466958_0032112 | 3300045836 | Bacteria | 3122 |
| 272 | Ga0466958_0032623 | 3300045836 | Bacteria | 3099 |
| 273 | Ga0466967_0150808 | 3300045976 | Bacteria | 2172 |
| 274 | Ga0466967_0531929 | 3300045976 | Bacteria | 1156 |
| 275 | Ga0495617_000003 | 3300046452 | Bacteria | 541914 |
| 276 | Ga0495617_000208 | 3300046452 | Bacteria | 36937 |
| 277 | Ga0495617_004548 | 3300046452 | Bacteria | 5027 |
| 278 | Ga0495603_0012166 | 3300046455 | Bacteria | 5211 |
| 279 | Ga0495590_0000001 | 3300046457 | Bacteria | 762984 |
| 280 | Ga0495590_0001769 | 3300046457 | Bacteria | 9174 |
| 281 | Ga0495590_0010308 | 3300046457 | Bacteria | 3518 |
| 282 | Ga0495590_0025477 | 3300046457 | Bacteria | 2079 |
| 283 | Ga0495590_0032711 | 3300046457 | Bacteria | 1819 |
| 284 | Ga0495638_0006478 | 3300046460 | Bacteria | 8513 |
| 285 | Ga0495653_0000002 | 3300046463 | Bacteria | 507262 |
| 286 | Ga0495653_0013560 | 3300046463 | Bacteria | 6644 |
| 287 | Ga0495650_0000001 | 3300046471 | Bacteria | 1085492 |
| 288 | Ga0495650_0000072 | 3300046471 | Bacteria | 257886 |
| 289 | Ga0495650_0000267 | 3300046471 | Bacteria | 100234 |
| 290 | Ga0495650_0000427 | 3300046471 | Bacteria | 68283 |
| 291 | Ga0495650_0004037 | 3300046471 | Bacteria | 10287 |
| 292 | Ga0495650_0005248 | 3300046471 | Bacteria | 8492 |
| 293 | Ga0495650_0046968 | 3300046471 | Bacteria | 1808 |
| 294 | Ga0495605_0000065 | 3300046474 | Bacteria | 139441 |
| 295 | Ga0495605_0000103 | 3300046474 | Bacteria | 105879 |
| 296 | Ga0495605_0006806 | 3300046474 | Bacteria | 6530 |
| 297 | Ga0495605_0009486 | 3300046474 | Bacteria | 5466 |
| 298 | Ga0495605_0010607 | 3300046474 | Bacteria | 5152 |
| 299 | Ga0495605_0013758 | 3300046474 | Bacteria | 4447 |
| 300 | Ga0495605_0131119 | 3300046474 | Bacteria | 1130 |
| 301 | Ga0495639_0023644 | 3300046475 | Bacteria | 2702 |
| 302 | Ga0495584_0000009 | 3300046491 | Bacteria | 236318 |
| 303 | Ga0495584_0000182 | 3300046491 | Bacteria | 44393 |
| 304 | Ga0495584_0000904 | 3300046491 | Bacteria | 18948 |
| 305 | Ga0495584_0006880 | 3300046491 | Bacteria | 5944 |
| 306 | Ga0495584_0008198 | 3300046491 | Bacteria | 5425 |
| 307 | Ga0495584_0011178 | 3300046491 | Bacteria | 4602 |
| 308 | Ga0495584_0011989 | 3300046491 | Bacteria | 4432 |
| 309 | Ga0495585_0000154 | 3300046492 | Bacteria | 73681 |
| 310 | Ga0495585_0000260 | 3300046492 | Bacteria | 54082 |
| 311 | Ga0495585_0000940 | 3300046492 | Bacteria | 24573 |
| 312 | Ga0495585_0002583 | 3300046492 | Bacteria | 12807 |
| 313 | Ga0495585_0007271 | 3300046492 | Bacteria | 6796 |
| 314 | Ga0495585_0026872 | 3300046492 | Bacteria | 3286 |
| 315 | Ga0495585_0041966 | 3300046492 | Bacteria | 2564 |
| 316 | Ga0495585_0091316 | 3300046492 | Bacteria | 1639 |
| 317 | Ga0495596_0010296 | 3300046500 | Bacteria | 4076 |
| 318 | Ga0495596_0015031 | 3300046500 | Bacteria | 3251 |
| 319 | Ga0495596_0018205 | 3300046500 | Bacteria | 2899 |
| 320 | Ga0495596_0018821 | 3300046500 | Bacteria | 2843 |
| 321 | Ga0495596_0128062 | 3300046500 | Bacteria | 985 |
| 322 | Ga0495607_0000644 | 3300046501 | Bacteria | 33902 |
| 323 | Ga0495607_0009099 | 3300046501 | Bacteria | 6751 |
| 324 | Ga0495607_0034933 | 3300046501 | Bacteria | 3045 |
| 325 | Ga0495607_0040486 | 3300046501 | Bacteria | 2774 |
| 326 | Ga0495607_0060402 | 3300046501 | Bacteria | 2157 |
| 327 | Ga0495583_0000008 | 3300046506 | Bacteria | 411092 |
| 328 | Ga0495583_0000050 | 3300046506 | Bacteria | 213627 |
| 329 | Ga0495583_0000064 | 3300046506 | Bacteria | 192380 |
| 330 | Ga0495583_0000253 | 3300046506 | Bacteria | 88398 |
| 331 | Ga0495583_0016130 | 3300046506 | Bacteria | 4028 |
| 332 | Ga0495583_0018718 | 3300046506 | Bacteria | 3639 |
| 333 | Ga0495583_0034199 | 3300046506 | Bacteria | 2437 |
| 334 | Ga0495606_0000001 | 3300046507 | Bacteria | 592123 |
| 335 | Ga0495606_0000030 | 3300046507 | Bacteria | 249484 |
| 336 | Ga0495606_0000282 | 3300046507 | Bacteria | 88450 |
| 337 | Ga0495606_0003624 | 3300046507 | Bacteria | 16227 |
| 338 | Ga0495606_0005214 | 3300046507 | Bacteria | 12545 |
| 339 | Ga0495606_0010442 | 3300046507 | Bacteria | 7708 |
| 340 | Ga0495606_0024337 | 3300046507 | Bacteria | 4366 |
| 341 | Ga0495610_0000003 | 3300046512 | Bacteria | 1203910 |
| 342 | Ga0495610_0001826 | 3300046512 | Bacteria | 18503 |
| 343 | Ga0495610_0009770 | 3300046512 | Bacteria | 6027 |
| 344 | Ga0495610_0016720 | 3300046512 | Bacteria | 4211 |
| 345 | Ga0495610_0041049 | 3300046512 | Bacteria | 2326 |
| 346 | Ga0495616_0000012 | 3300046513 | Bacteria | 211342 |
| 347 | Ga0495616_0000283 | 3300046513 | Bacteria | 41076 |
| 348 | Ga0495616_0001100 | 3300046513 | Bacteria | 19247 |
| 349 | Ga0495616_0006912 | 3300046513 | Bacteria | 6833 |
| 350 | Ga0495616_0052135 | 3300046513 | Bacteria | 2037 |
| 351 | Ga0495616_0055424 | 3300046513 | Bacteria | 1962 |
| 352 | Ga0495616_0076573 | 3300046513 | Bacteria | 1607 |
| 353 | Ga0495631_0000214 | 3300046518 | Bacteria | 39867 |
| 354 | Ga0495631_0003192 | 3300046518 | Bacteria | 9024 |
| 355 | Ga0495631_0007582 | 3300046518 | Bacteria | 5515 |
| 356 | Ga0495631_0078034 | 3300046518 | Bacteria | 1429 |
| 357 | Ga0495632_0000117 | 3300046519 | Bacteria | 81479 |
| 358 | Ga0495632_0000151 | 3300046519 | Bacteria | 71855 |
| 359 | Ga0495632_0000405 | 3300046519 | Bacteria | 40703 |
| 360 | Ga0495632_0002250 | 3300046519 | Bacteria | 14864 |
| 361 | Ga0495637_0000042 | 3300046520 | Bacteria | 114979 |
| 362 | Ga0495643_0000028 | 3300046522 | Bacteria | 262886 |
| 363 | Ga0495643_0000285 | 3300046522 | Bacteria | 72233 |
| 364 | Ga0495643_0009345 | 3300046522 | Bacteria | 6097 |
| 365 | Ga0495643_0018663 | 3300046522 | Bacteria | 4024 |
| 366 | Ga0495643_0018836 | 3300046522 | Bacteria | 3999 |
| 367 | Ga0495643_0083757 | 3300046522 | Bacteria | 1655 |
| 368 | Ga0495643_0093325 | 3300046522 | Bacteria | 1550 |
| 369 | Ga0495644_0026277 | 3300046523 | Bacteria | 2209 |
| 370 | Ga0495648_0000001 | 3300046524 | Bacteria | 696872 |
| 371 | Ga0495648_0000079 | 3300046524 | Bacteria | 126099 |
| 372 | Ga0495648_0005786 | 3300046524 | Bacteria | 10197 |
| 373 | Ga0495648_0014982 | 3300046524 | Bacteria | 5647 |
| 374 | Ga0495648_0016643 | 3300046524 | Bacteria | 5292 |
| 375 | Ga0495648_0023950 | 3300046524 | Bacteria | 4168 |
| 376 | Ga0495648_0027847 | 3300046524 | Bacteria | 3775 |
| 377 | Ga0495648_0033278 | 3300046524 | Bacteria | 3369 |
| 378 | Ga0495648_0040219 | 3300046524 | Bacteria | 2967 |
| 379 | Ga0495648_0058300 | 3300046524 | Bacteria | 2309 |
| 380 | Ga0495642_0002229 | 3300046528 | Bacteria | 7934 |
| 381 | Ga0495642_0002749 | 3300046528 | Bacteria | 7056 |
| 382 | Ga0495642_0004777 | 3300046528 | Bacteria | 5240 |
| 383 | Ga0495654_0000037 | 3300046530 | Bacteria | 188218 |
| 384 | Ga0495654_0008463 | 3300046530 | Bacteria | 5681 |
| 385 | Ga0495654_0009920 | 3300046530 | Bacteria | 5206 |
| 386 | Ga0495654_0016392 | 3300046530 | Bacteria | 3920 |
| 387 | Ga0495654_0040665 | 3300046530 | Bacteria | 2316 |
| 388 | Ga0495654_0073473 | 3300046530 | Bacteria | 1617 |
| 389 | Ga0495609_0000026 | 3300046538 | Bacteria | 251973 |
| 390 | Ga0495609_0000241 | 3300046538 | Bacteria | 52185 |
| 391 | Ga0495609_0001046 | 3300046538 | Bacteria | 19408 |
| 392 | Ga0495609_0013197 | 3300046538 | Bacteria | 3906 |
| 393 | Ga0495609_0015872 | 3300046538 | Bacteria | 3518 |
| 394 | Ga0495609_0018079 | 3300046538 | Bacteria | 3270 |
| 395 | Ga0495609_0064905 | 3300046538 | Bacteria | 1610 |
| 396 | Ga0495597_0000073 | 3300046542 | Bacteria | 87767 |
| 397 | Ga0495597_0000705 | 3300046542 | Bacteria | 26750 |
| 398 | Ga0495597_0000864 | 3300046542 | Bacteria | 23742 |
| 399 | Ga0495597_0004402 | 3300046542 | Bacteria | 7755 |
| 400 | Ga0495597_0008100 | 3300046542 | Bacteria | 5287 |
| 401 | Ga0495622_0000131 | 3300046557 | Bacteria | 64280 |
| 402 | Ga0495622_0026719 | 3300046557 | Bacteria | 2694 |
| 403 | Ga0495622_0030689 | 3300046557 | Bacteria | 2512 |
| 404 | Ga0495633_0000055 | 3300046558 | Bacteria | 151013 |
| 405 | Ga0495633_0000106 | 3300046558 | Bacteria | 113381 |
| 406 | Ga0495633_0000675 | 3300046558 | Bacteria | 31481 |
| 407 | Ga0495633_0013433 | 3300046558 | Bacteria | 4316 |
| 408 | Ga0495633_0018016 | 3300046558 | Bacteria | 3593 |
| 409 | Ga0495633_0018951 | 3300046558 | Bacteria | 3484 |
| 410 | Ga0495656_0006356 | 3300046615 | Bacteria | 4142 |
| 411 | Ga0495656_0049412 | 3300046615 | Bacteria | 1791 |
| 412 | Ga0495656_0155497 | 3300046615 | Bacteria | 1108 |
| 413 | Ga0495668_0000190 | 3300046616 | Bacteria | 91473 |
| 414 | Ga0495668_0000565 | 3300046616 | Bacteria | 45559 |
| 415 | Ga0495668_0001065 | 3300046616 | Bacteria | 29015 |
| 416 | Ga0495668_0001873 | 3300046616 | Bacteria | 18839 |
| 417 | Ga0495668_0002146 | 3300046616 | Bacteria | 16984 |
| 418 | Ga0495668_0006874 | 3300046616 | Bacteria | 7376 |
| 419 | Ga0495668_0013236 | 3300046616 | Bacteria | 4875 |
| 420 | Ga0495668_0016126 | 3300046616 | Bacteria | 4346 |
| 421 | Ga0495668_0019446 | 3300046616 | Bacteria | 3914 |
| 422 | Ga0495611_0000151 | 3300046648 | Bacteria | 49625 |
| 423 | Ga0495611_0018928 | 3300046648 | Bacteria | 2955 |
| 424 | Ga0495611_0066432 | 3300046648 | Bacteria | 1644 |
| 425 | Ga0495625_0000035 | 3300046660 | Bacteria | 224323 |
| 426 | Ga0495625_0000391 | 3300046660 | Bacteria | 66888 |
| 427 | Ga0495625_0002897 | 3300046660 | Bacteria | 17926 |
| 428 | Ga0495625_0017011 | 3300046660 | Bacteria | 5702 |
| 429 | Ga0495625_0023692 | 3300046660 | Bacteria | 4685 |
| 430 | Ga0495625_0043513 | 3300046660 | Bacteria | 3256 |
| 431 | Ga0495625_0076343 | 3300046660 | Bacteria | 2343 |
| 432 | Ga0495625_0131621 | 3300046660 | Bacteria | 1694 |
| 433 | Ga0495659_0000158 | 3300046664 | Bacteria | 30194 |
| 434 | Ga0495659_0028445 | 3300046664 | Bacteria | 1934 |
| 435 | Ga0495659_0041143 | 3300046664 | Bacteria | 1649 |
| 436 | Ga0495661_0000152 | 3300046665 | Bacteria | 81192 |
| 437 | Ga0495661_0000715 | 3300046665 | Bacteria | 32660 |
| 438 | Ga0495661_0006925 | 3300046665 | Bacteria | 7925 |
| 439 | Ga0495661_0008169 | 3300046665 | Bacteria | 7257 |
| 440 | Ga0495661_0016799 | 3300046665 | Bacteria | 4840 |
| 441 | Ga0495661_0103006 | 3300046665 | Bacteria | 1603 |
| 442 | Ga0495588_0000139 | 3300046674 | Bacteria | 109955 |
| 443 | Ga0495646_0046872 | 3300046680 | Bacteria | 2633 |
| 444 | Ga0495669_0002681 | 3300046684 | Bacteria | 7287 |
| 445 | Ga0495669_0021045 | 3300046684 | Bacteria | 2827 |
| 446 | Ga0495670_0000114 | 3300046691 | Bacteria | 35822 |
| 447 | Ga0495670_0006155 | 3300046691 | Bacteria | 5893 |
| 448 | Ga0495670_0010977 | 3300046691 | Bacteria | 4452 |
| 449 | Ga0495670_0088515 | 3300046691 | Bacteria | 1583 |
| 450 | Ga0495671_0000010 | 3300046692 | Bacteria | 368641 |
| 451 | Ga0495671_0002314 | 3300046692 | Bacteria | 12109 |
| 452 | Ga0495671_0006896 | 3300046692 | Bacteria | 6517 |
| 453 | Ga0495671_0007326 | 3300046692 | Bacteria | 6299 |
| 454 | Ga0495671_0007720 | 3300046692 | Bacteria | 6103 |
| 455 | Ga0495649_0035077 | 3300046694 | Bacteria | 2759 |
| 456 | Ga0495649_0041820 | 3300046694 | Bacteria | 2505 |
| 457 | Ga0495649_0042748 | 3300046694 | Bacteria | 2475 |
| 458 | Ga0495649_0048270 | 3300046694 | Bacteria | 2313 |
| 459 | Ga0495649_0065306 | 3300046694 | Bacteria | 1953 |
| 460 | Ga0495649_0070323 | 3300046694 | Bacteria | 1876 |
| 461 | Ga0495589_0000100 | 3300046794 | Bacteria | 83307 |
| 462 | Ga0495589_0000101 | 3300046794 | Bacteria | 82583 |
| 463 | Ga0495589_0037719 | 3300046794 | Bacteria | 2420 |
| 464 | Ga0495589_0100712 | 3300046794 | Bacteria | 1398 |
| 465 | Ga0495660_0000027 | 3300046810 | Bacteria | 254331 |
| 466 | Ga0495660_0000335 | 3300046810 | Bacteria | 41632 |
| 467 | Ga0495660_0001827 | 3300046810 | Bacteria | 13973 |
| 468 | Ga0495660_0010965 | 3300046810 | Bacteria | 5266 |
| 469 | Ga0495660_0020088 | 3300046810 | Bacteria | 3831 |
| 470 | Ga0495660_0039111 | 3300046810 | Bacteria | 2635 |
| 471 | Ga0495660_0041760 | 3300046810 | Bacteria | 2537 |
| 472 | Ga0495660_0052366 | 3300046810 | Bacteria | 2217 |
| 473 | Ga0495636_0003252 | 3300047318 | Bacteria | 6299 |
| 474 | Ga0495636_0042115 | 3300047318 | Bacteria | 1896 |
| 475 | Ga0495672_0000220 | 3300047320 | Bacteria | 81547 |
| 476 | Ga0495672_0000221 | 3300047320 | Bacteria | 81255 |
| 477 | Ga0495672_0002445 | 3300047320 | Bacteria | 17096 |
| 478 | Ga0495672_0002802 | 3300047320 | Bacteria | 15553 |
| 479 | Ga0495672_0007979 | 3300047320 | Bacteria | 7889 |
| 480 | Ga0495680_0025635 | 3300047322 | Bacteria | 4876 |
| 481 | Ga0495683_0000064 | 3300047323 | Bacteria | 112558 |
| 482 | Ga0495683_0001336 | 3300047323 | Bacteria | 16464 |
| 483 | Ga0495683_0032651 | 3300047323 | Bacteria | 2651 |
| 484 | Ga0495687_000012 | 3300047443 | Bacteria | 391586 |
| 485 | Ga0495687_000037 | 3300047443 | Bacteria | 252363 |
| 486 | Ga0495687_000062 | 3300047443 | Bacteria | 176135 |
| 487 | Ga0495687_000122 | 3300047443 | Bacteria | 119372 |
| 488 | Ga0495687_003478 | 3300047443 | Bacteria | 11377 |
| 489 | Ga0495677_0000014 | 3300047445 | Bacteria | 136236 |
| 490 | Ga0495677_0003124 | 3300047445 | Bacteria | 6455 |
| 491 | Ga0495677_0004220 | 3300047445 | Bacteria | 5539 |
| 492 | Ga0495677_0032844 | 3300047445 | Bacteria | 1890 |
| 493 | Ga0495679_001792 | 3300047446 | Bacteria | 11717 |
| 494 | Ga0495679_004418 | 3300047446 | Bacteria | 6499 |
| 495 | Ga0495685_000262 | 3300047447 | Bacteria | 18174 |
| 496 | Ga0495685_001925 | 3300047447 | Bacteria | 6417 |
| 497 | Ga0495673_0000003 | 3300047469 | Bacteria | 1491337 |
| 498 | Ga0495673_0000016 | 3300047469 | Bacteria | 580643 |
| 499 | Ga0495673_0000035 | 3300047469 | Bacteria | 316861 |
| 500 | Ga0495673_0003607 | 3300047469 | Bacteria | 10132 |
| 501 | Ga0495681_0000021 | 3300047470 | Bacteria | 166534 |
| 502 | Ga0495681_0000246 | 3300047470 | Bacteria | 44798 |
| 503 | Ga0495681_0006028 | 3300047470 | Bacteria | 8020 |
| 504 | Ga0495681_0015183 | 3300047470 | Bacteria | 4367 |
| 505 | Ga0495681_0024947 | 3300047470 | Bacteria | 3135 |
| 506 | Ga0495686_0000047 | 3300047472 | Bacteria | 280086 |
| 507 | Ga0495686_0007983 | 3300047472 | Bacteria | 7848 |
| 508 | Ga0495686_0008813 | 3300047472 | Bacteria | 7348 |
| 509 | Ga0495686_0096437 | 3300047472 | Bacteria | 1790 |
| 510 | Ga0495686_0149193 | 3300047472 | Bacteria | 1374 |
| 511 | Ga0495626_0000222 | 3300048091 | Bacteria | 67304 |
| 512 | Ga0495626_0001784 | 3300048091 | Bacteria | 16276 |
| 513 | Ga0495626_0008414 | 3300048091 | Bacteria | 5658 |
| 514 | Ga0495626_0015604 | 3300048091 | Bacteria | 3883 |
| 515 | Ga0495626_0089155 | 3300048091 | Bacteria | 1358 |
| 516 | Ga0495626_0095110 | 3300048091 | Bacteria | 1305 |
| 517 | Ga0495626_0137873 | 3300048091 | Bacteria | 1036 |
| 518 | Ga0496102_0049277 | 3300048905 | Bacteria | 3831 |
| 519 | Ga0496102_0147844 | 3300048905 | Bacteria | 2206 |
| 520 | Ga0496103_0178087 | 3300048906 | Bacteria | 1366 |
| 521 | Ga0496106_0030710 | 3300048909 | Bacteria | 4005 |
| 522 | Ga0496108_0329777 | 3300048911 | Bacteria | 1331 |
| 523 | Ga0496109_0199668 | 3300048912 | Bacteria | 1880 |
| 524 | Ga0496110_0000026 | 3300048913 | Bacteria | 71385 |
| 525 | Ga0496111_0041791 | 3300048914 | Bacteria | 3291 |
| 526 | Ga0496111_0050164 | 3300048914 | Bacteria | 3009 |
| 527 | Ga0496113_0001992 | 3300048916 | Bacteria | 11697 |
| 528 | Ga0496117_0000005 | 3300048920 | Bacteria | 777468 |
| 529 | Ga0496118_0000022 | 3300048921 | Bacteria | 438602 |
| 530 | Ga0496120_0039174 | 3300048923 | Bacteria | 2799 |
| 531 | Ga0496121_0004143 | 3300048924 | Bacteria | 19841 |
| 532 | Ga0496121_0041960 | 3300048924 | Bacteria | 3988 |
| 533 | Ga0496122_0001132 | 3300048925 | Bacteria | 45868 |
| 534 | Ga0496122_0020696 | 3300048925 | Bacteria | 5926 |
| 535 | Ga0496122_0025368 | 3300048925 | Bacteria | 5149 |
| 536 | Ga0496122_0050365 | 3300048925 | Bacteria | 3177 |
| 537 | Ga0496123_0003516 | 3300048926 | Bacteria | 17450 |
| 538 | Ga0496123_0005149 | 3300048926 | Bacteria | 13318 |
| 539 | Ga0496123_0006339 | 3300048926 | Bacteria | 11489 |
| 540 | Ga0496124_0024602 | 3300048927 | Bacteria | 5470 |
| 541 | Ga0496124_0084520 | 3300048927 | Bacteria | 2602 |
| 542 | Ga0496124_0142299 | 3300048927 | Bacteria | 1891 |
| 543 | Ga0496124_0162170 | 3300048927 | Bacteria | 1741 |
| 544 | Ga0496126_0004427 | 3300048929 | Bacteria | 16812 |
| 545 | Ga0495678_000002 | 3300049459 | Bacteria | 999613 |
| 546 | Ga0495678_000029 | 3300049459 | Bacteria | 219803 |
| 547 | Ga0495678_000045 | 3300049459 | Bacteria | 171880 |
| 548 | Ga0495678_000663 | 3300049459 | Bacteria | 31565 |
| 549 | Ga0495678_004929 | 3300049459 | Bacteria | 7540 |
| 550 | Ga0495678_024725 | 3300049459 | Bacteria | 2589 |
| 551 | Ga0495682_0000208 | 3300049460 | Bacteria | 47163 |
| 552 | Ga0495682_0000628 | 3300049460 | Bacteria | 23643 |
| 553 | Ga0495682_0071136 | 3300049460 | Bacteria | 1252 |
| 554 | Ga0501311_001840 | 3300049527 | Bacteria | 1934 |
| 555 | Ga0501316_003450 | 3300049532 | Bacteria | 1537 |
| 556 | Ga0501335_000226 | 3300049551 | Bacteria | 3168 |
| 557 | Ga0501034_0103678 | 3300049571 | Bacteria | 2838 |
| 558 | Ga0501036_0156079 | 3300049572 | Bacteria | 1925 |
| 559 | Ga0501198_009956 | 3300049649 | Bacteria | 1400 |
| 560 | Ga0501207_007153 | 3300049654 | Bacteria | 1586 |
| 561 | Ga0501217_015353 | 3300049661 | Bacteria | 1742 |
| 562 | Ga0501222_003666 | 3300049662 | Bacteria | 2091 |
| 563 | Ga0501227_002485 | 3300049665 | Bacteria | 4068 |
| 564 | Ga0501227_003667 | 3300049665 | Bacteria | 3328 |
| 565 | Ga0501240_007331 | 3300049673 | Bacteria | 1384 |
| 566 | Ga0501249_002660 | 3300049679 | Bacteria | 3598 |
| 567 | Ga0501269_000700 | 3300049766 | Bacteria | 5582 |
| 568 | Ga0501279_004021 | 3300049775 | Bacteria | 1926 |
| 569 | Ga0501035_0011980 | 3300049822 | Bacteria | 8021 |
| 570 | Ga0501044_0588127 | 3300049823 | Bacteria | 1007 |
| 571 | Ga0500594_0002831 | 3300053118 | Bacteria | 3784 |
| 572 | Ga0500618_000068 | 3300053125 | Bacteria | 88668 |
| 573 | Ga0500586_001379 | 3300053145 | Bacteria | 5117 |
| 574 | Ga0587083_0004084 | 3300059505 | Bacteria | 1996 |
| 575 | 2601671312 | 2600255292 | Bacteria | 6300551 |
| 576 | 2643789486 | 2643221554 | Bacteria | 6603920 |
| 577 | 2643801500 | 2643221556 | Bacteria | 7251154 |
| 578 | 2644216057 | 2643221638 | Bacteria | 6579467 |
| 579 | 2644251262 | 2643221645 | Bacteria | 7207331 |
| 580 | 2644357529 | 2643221664 | Bacteria | 7272945 |
| 581 | 2644471438 | 2643221684 | Bacteria | 7145183 |
| 582 | 2691331105 | 2690315857 | Bacteria | 4396207 |
| 583 | 2738713391 | 2738541276 | Bacteria | 4690596 |
| 584 | 2738740120 | 2738541280 | Bacteria | 6630198 |
| 585 | 2738829884 | 2738541297 | Bacteria | 6549566 |
| 586 | 2738844115 | 2738541300 | Bacteria | 6675882 |
| 587 | 2739153680 | 2738541357 | Bacteria | 6549408 |
| 588 | 2739195600 | 2738543003 | Bacteria | 6549560 |
| 589 | 2739274322 | 2738543018 | Bacteria | 6718814 |
| 590 | 2739322076 | 2738543026 | Bacteria | 6549408 |
| 591 | 2739340317 | 2738543029 | Bacteria | 6549249 |
| 592 | 2739343366 | 2738543030 | Bacteria | 6719714 |
| 593 | 2842715518 | 2842711865 | Bacteria | 7155354 |
| 594 | 2857548848 | 2857547612 | Bacteria | 6179999 |
| 595 | 2857555921 | 2857553236 | Bacteria | 6166726 |
| 596 | 2857566937 | 2857564685 | Bacteria | 6290584 |
| 597 | 2885080357 | 2885080285 | Bacteria | 6355622 |
| 598 | 2904425720 | 2904424332 | Bacteria | 7633521 |
| 599 | 2916179111 | 2916178963 | Bacteria | 5265078 |
| 600 | 2919478254 | 2919476304 | Bacteria | 5888696 |
| 601 | 2919500168 | 2919497567 | Bacteria | 4408621 |
| 602 | 2919534667 | 2919534386 | Bacteria | 4577686 |
| 603 | 2919691630 | 2919688452 | Bacteria | 4595932 |
| 604 | 2932415456 | 2932410948 | Bacteria | 6312192 |
| 605 | 2932421383 | 2932416698 | Bacteria | 6315112 |
| 606 | 2937613548 | 2937610967 | Bacteria | 4618818 |
| 607 | 8047677196 | 8047673197 | Bacteria | 7395230 |
| 608 | 8054358010 | 8054357960 | Bacteria | 2867777 |
| 609 | Ga0395899_0000226 | |||
| 610 | JGI25156J39149_1003241 | |||
| 611 | JGI25156J39149_1007056 | |||
| 612 | JGI25162J39368_1003969 | |||
| 613 | JGI25154J39366_1000503 | |||
| 614 | JGI25154J39366_1004732 | |||
| 615 | JGI25158J39367_1004471 | |||
| 616 | JGI25157J39369_1000256 | |||
| 617 | JGI25157J39369_1002177 | |||
| 618 | JGI25164J39214_1000064 | |||
| 619 | JGI25152J39213_1000026 | |||
| 620 | JGI25152J39213_1004392 | |||
| 621 | JGI25150J39212_1000478 | |||
| 622 | JGI25150J39212_1004201 | |||
| 623 | JGI25150J39212_1005449 | |||
| 624 | JGI25159J45721_1000676 | |||
| 625 | JGI25159J45721_1002470 | |||
| 626 | JGI25159J45721_1014739 | |||
| 627 | JGI25165J46597_1000278 | |||
| 628 | rootH1_10015702 | |||
| 629 | rootH2_10011530 | |||
| 630 | rootL2_10001989 | |||
| 631 | rootL2_10002151 | |||
| 632 | rootL2_10070531 | |||
| 633 | rootL2_10136594 | |||
| 634 | rootH1_10002339 | |||
| 635 | rootH1_10042111 | |||
| 636 | rootH1_10069919 | |||
| 637 | rootH1_10126298 | |||
| 638 | JGI25160J50197_1006539 | |||
| 639 | JGI25161J50226_1000201 | |||
| 640 | JGI25161J50226_1004252 | |||
| 641 | Ga0055539_1007205 | |||
| 642 | Ga0055533_1006262 | |||
| 643 | Ga0055533_1008429 | |||
| 644 | Ga0055525_1000006 | |||
| 645 | Ga0055525_1000043 | |||
| 646 | Ga0055527_1000305 | |||
| 647 | Ga0055527_1000393 | |||
| 648 | Ga0055527_1001316 | |||
| 649 | Ga0055535_1000652 | |||
| 650 | Ga0055535_1000974 | |||
| 651 | Ga0055542_1000393 | |||
| 652 | Ga0055542_1000672 | |||
| 653 | Ga0055542_1000970 | |||
| 654 | Ga0055529_1000032 | |||
| 655 | Ga0055529_1000409 | |||
| 656 | Ga0055529_1000620 | |||
| 657 | Ga0055529_1000818 | |||
| 658 | Ga0055526_1000018 | |||
| 659 | Ga0055526_1000053 | |||
| 660 | Ga0055526_1003053 | |||
| 661 | Ga0055526_1018147 | |||
| 662 | Ga0055537_1000027 | |||
| 663 | Ga0055537_1006491 | |||
| 664 | Ga0055524_1002546 | |||
| 665 | Ga0055524_1002925 | |||
| 666 | Ga0055524_1003014 | |||
| 667 | Ga0055524_1003992 | |||
| 668 | Ga0055534_1000051 | |||
| 669 | Ga0055528_1000731 | |||
| 670 | Ga0055528_1019049 | |||
| 671 | Ga0055530_10002749 | |||
| 672 | Ga0055531_10000025 | |||
| 673 | Ga0055531_10002488 | |||
| 674 | Ga0055531_10048507 | |||
| 675 | Ga0055543_1000103 | |||
| 676 | Ga0065165_1001082 | |||
| 677 | Ga0065165_1001148 | |||
| 678 | Ga0070658_10043212 | |||
| 679 | Ga0070658_10095341 | |||
| 680 | Ga0070660_100006208 | |||
| 681 | Ga0070660_100013161 | |||
| 682 | Ga0070660_100063787 | |||
| 683 | Ga0070659_100024228 | |||
| 684 | Ga0070659_100063112 | |||
| 685 | Ga0070662_100126404 | |||
| 686 | Ga0070662_100353923 | |||
| 687 | Ga0068855_100065376 | |||
| 688 | Ga0070664_100106815 | |||
| 689 | Ga0068865_100430674 | |||
| 690 | Ga0099823_1000046 | |||
| 691 | Ga0079104_1024665 | |||
| 692 | Ga0105244_10001201 | |||
| 693 | Ga0105244_10040268 | |||
| 694 | Ga0105243_10011176 | |||
| 695 | Ga0105241_10016143 | |||
| 696 | Ga0105242_10011548 | |||
| 697 | Ga0105242_10584387 | |||
| 698 | Ga0157371_10000014 | |||
| 699 | Ga0157369_10319743 | |||
| 700 | Ga0157374_10346819 | |||
| 701 | Ga0157378_10204432 | |||
| 702 | Ga0157372_10318841 | |||
| 703 | Ga0182008_10001070 | |||
| 704 | Ga0182006_1000007 | |||
| 705 | Ga0182006_1000040 | |||
| 706 | Ga0182007_10000068 | |||
| 707 | Ga0182005_1000010 | |||
| 708 | Ga0182005_1000051 | |||
| 709 | Ga0163161_10191791 | |||
| 710 | Ga0213872_10000040 | |||
| 711 | Ga0213872_10052139 | |||
| 712 | Ga0209436_100301 | |||
| 713 | Ga0209436_103138 | |||
| 714 | Ga0209674_100059 | |||
| 715 | Ga0209674_102211 | |||
| 716 | Ga0209672_100004 | |||
| 717 | Ga0209672_100008 | |||
| 718 | Ga0209672_100121 | |||
| 719 | Ga0209563_100022 | |||
| 720 | Ga0209563_100036 | |||
| 721 | Ga0207427_100037 | |||
| 722 | Ga0209437_100213 | |||
| 723 | Ga0209258_100003 | |||
| 724 | Ga0209258_100004 | |||
| 725 | Ga0209258_100008 | |||
| 726 | Ga0209258_100106 | |||
| 727 | Ga0207425_1000017 | |||
| 728 | Ga0207425_1000085 | |||
| 729 | Ga0207425_1000326 | |||
| 730 | Ga0207425_1008410 | |||
| 731 | Ga0209646_1000051 | |||
| 732 | Ga0209646_1001473 | |||
| 733 | Ga0209026_1000045 | |||
| 734 | Ga0209026_1003347 | |||
| 735 | Ga0209026_1015914 | |||
| 736 | Ga0209677_101205 | |||
| 737 | Ga0209677_102629 | |||
| 738 | Ga0209677_107599 | |||
| 739 | Ga0209148_1000025 | |||
| 740 | Ga0209148_1000042 | |||
| 741 | Ga0209148_1000053 | |||
| 742 | Ga0209148_1000678 | |||
| 743 | Ga0209759_1000185 | |||
| 744 | Ga0209759_1000212 | |||
| 745 | Ga0209129_1000162 | |||
| 746 | Ga0209233_1000096 | |||
| 747 | Ga0209565_1000017 | |||
| 748 | Ga0209565_1000452 | |||
| 749 | Ga0209565_1002359 | |||
| 750 | Ga0209565_1002832 | |||
| 751 | Ga0209565_1020281 | |||
| 752 | Ga0209455_1000004 | |||
| 753 | Ga0209455_1000007 | |||
| 754 | Ga0209455_1000016 | |||
| 755 | Ga0209455_1000043 | |||
| 756 | Ga0209673_1000007 | |||
| 757 | Ga0209673_1015546 | |||
| 758 | Ga0209130_1000078 | |||
| 759 | Ga0209130_1000188 | |||
| 760 | Ga0209130_1008273 | |||
| 761 | Ga0209675_1000009 | |||
| 762 | Ga0209675_1002209 | |||
| 763 | Ga0209675_1010711 | |||
| 764 | Ga0209025_1024135 | |||
| 765 | Ga0209564_1000011 | |||
| 766 | Ga0209564_1000036 | |||
| 767 | Ga0209564_1000055 | |||
| 768 | Ga0209564_1000068 | |||
| 769 | Ga0209564_1000343 | |||
| 770 | Ga0209564_1002854 | |||
| 771 | Ga0209564_1011336 | |||
| 772 | Ga0209758_1000250 | |||
| 773 | Ga0209758_1001409 | |||
| 774 | Ga0209050_1000316 | |||
| 775 | Ga0209050_1000612 | |||
| 776 | Ga0209050_1001361 | |||
| 777 | Ga0209050_1001479 | |||
| 778 | Ga0209050_1001484 | |||
| 779 | Ga0209050_1015304 | |||
| 780 | Ga0209256_1000167 | |||
| 781 | Ga0209256_1000184 | |||
| 782 | Ga0209256_1000841 | |||
| 783 | Ga0209256_1003010 | |||
| 784 | Ga0209256_1006853 | |||
| 785 | Ga0207426_1007269 | |||
| 786 | Ga0207426_1025391 | |||
| 787 | Ga0209051_1000869 | |||
| 788 | Ga0209051_1005230 | |||
| 789 | Ga0209257_1000032 | |||
| 790 | Ga0209257_1000123 | |||
| 791 | Ga0209257_1003015 | |||
| 792 | Ga0207705_10027711 | |||
| 793 | Ga0207705_10141331 | |||
| 794 | Ga0207695_10212725 | |||
| 795 | Ga0207657_10005165 | |||
| 796 | Ga0207649_10077810 | |||
| 797 | Ga0207690_10079757 | |||
| 798 | Ga0207706_10067011 | |||
| 799 | Ga0207686_10057360 | |||
| 800 | Ga0207679_10076590 | |||
| 801 | Ga0207667_10266283 | |||
| 802 | Ga0207678_10477564 | |||
| 803 | Ga0207702_10000654 | |||
| 804 | Ga0209281_1005021 | |||
| 805 | Ga0209389_1013868 | |||
| 806 | Ga0265338_10000331 | |||
| 807 | Ga0265338_10008840 | |||
| 808 | Ga0316182_1011444 | |||
| 809 | Ga0316182_1278328 | |||
| 810 | Ga0307513_10403823 | |||
| 811 | Ga0307408_100000092 | |||
| 812 | Ga0307408_100000286 | |||
| 813 | Ga0307408_100000419 | |||
| 814 | Ga0307408_100003582 | |||
| 815 | Ga0307408_100005970 | |||
| 816 | Ga0307408_100021916 | |||
| 817 | Ga0307408_100216164 | |||
| 818 | Ga0307408_100364314 | |||
| 819 | Ga0316576_10000921 | |||
| 820 | Ga0316576_10040422 | |||
| 821 | Ga0316576_10170457 | |||
| 822 | Ga0316578_10050384 | |||
| 823 | Ga0307518_10099607 | |||
| 824 | Ga0307406_10028255 | |||
| 825 | Ga0307409_100022485 | |||
| 826 | Ga0307416_100197720 | |||
| 827 | Ga0307416_100284591 | |||
| 828 | Ga0307414_10061003 | |||
| 829 | Ga0395899_0000293 | |||
| 830 | Ga0395899_0003754 | |||
| 831 | Ga0395899_0214669 | |||
| 832 | Ga0395900_0000011 | |||
| 833 | Ga0395900_0010023 | |||
| 834 | Ga0395900_0036179 | |||
| 835 | Ga0395900_0186020 | |||
| 836 | Ga0395900_0196590 | |||
| 837 | Ga0395898_0000029 | |||
| 838 | Ga0395898_0039140 | |||
| 839 | Ga0395898_0251856 | |||
| 840 | Ga0395905_0326109 | |||
| 841 | Ga0395901_0000019 | |||
| 842 | Ga0395901_0024509 | |||
| 843 | Ga0436361_0424561 | |||
| 844 | Ga0436361_0617438 | |||
| 845 | Ga0436361_1177289 | |||
| 846 | Ga0450890_000853 | |||
| 847 | Ga0450891_002414 | |||
| 848 | Ga0439446_0010941 | |||
| 849 | Ga0439458_0028525 | |||
| 850 | Ga0451577_0000642 | |||
| 851 | Ga0466969_0047280 | |||
| 852 | Ga0466972_0009564 | |||
| 853 | Ga0466982_0066678 | |||
| 854 | Ga0466965_0007237 | |||
| 855 | Ga0466965_0015756 | |||
| 856 | Ga0466965_0045762 | |||
| 857 | Ga0466966_0006384 | |||
| 858 | Ga0466966_0011051 | |||
| 859 | Ga0466966_0126037 | |||
| 860 | Ga0466961_0000272 | |||
| 861 | Ga0466961_0000299 | |||
| 862 | Ga0466961_0004718 | |||
| 863 | Ga0466961_0013395 | |||
| 864 | Ga0466961_0135886 | |||
| 865 | Ga0466961_0175105 | |||
| 866 | Ga0466964_0025245 | |||
| 867 | Ga0466968_0004950 | |||
| 868 | Ga0466970_0000201 | |||
| 869 | Ga0466970_0012603 | |||
| 870 | Ga0466957_0000104 | |||
| 871 | Ga0466957_0067208 | |||
| 872 | Ga0466957_0079841 | |||
| 873 | Ga0466959_0000006 | |||
| 874 | Ga0466959_0003643 | |||
| 875 | Ga0466959_0077725 | |||
| 876 | Ga0466959_0208225 | |||
| 877 | Ga0451576_0000098 | |||
| 878 | Ga0451576_0016173 | |||
| 879 | Ga0466958_0032112 | |||
| 880 | Ga0466958_0032623 | |||
| 881 | Ga0466967_0150808 | |||
| 882 | Ga0466967_0531929 | |||
| 883 | Ga0495617_000003 | |||
| 884 | Ga0495617_000208 | |||
| 885 | Ga0495617_004548 | |||
| 886 | Ga0495603_0012166 | |||
| 887 | Ga0495590_0000001 | |||
| 888 | Ga0495590_0001769 | |||
| 889 | Ga0495590_0010308 | |||
| 890 | Ga0495590_0025477 | |||
| 891 | Ga0495590_0032711 | |||
| 892 | Ga0495638_0006478 | |||
| 893 | Ga0495653_0000002 | |||
| 894 | Ga0495653_0013560 | |||
| 895 | Ga0495650_0000001 | |||
| 896 | Ga0495650_0000072 | |||
| 897 | Ga0495650_0000267 | |||
| 898 | Ga0495650_0000427 | |||
| 899 | Ga0495650_0004037 | |||
| 900 | Ga0495650_0005248 | |||
| 901 | Ga0495650_0046968 | |||
| 902 | Ga0495605_0000065 | |||
| 903 | Ga0495605_0000103 | |||
| 904 | Ga0495605_0006806 | |||
| 905 | Ga0495605_0009486 | |||
| 906 | Ga0495605_0010607 | |||
| 907 | Ga0495605_0013758 | |||
| 908 | Ga0495605_0131119 | |||
| 909 | Ga0495639_0023644 | |||
| 910 | Ga0495584_0000009 | |||
| 911 | Ga0495584_0000182 | |||
| 912 | Ga0495584_0000904 | |||
| 913 | Ga0495584_0006880 | |||
| 914 | Ga0495584_0008198 | |||
| 915 | Ga0495584_0011178 | |||
| 916 | Ga0495584_0011989 | |||
| 917 | Ga0495585_0000154 | |||
| 918 | Ga0495585_0000260 | |||
| 919 | Ga0495585_0000940 | |||
| 920 | Ga0495585_0002583 | |||
| 921 | Ga0495585_0007271 | |||
| 922 | Ga0495585_0026872 | |||
| 923 | Ga0495585_0041966 | |||
| 924 | Ga0495585_0091316 | |||
| 925 | Ga0495596_0010296 | |||
| 926 | Ga0495596_0015031 | |||
| 927 | Ga0495596_0018205 | |||
| 928 | Ga0495596_0018821 | |||
| 929 | Ga0495596_0128062 | |||
| 930 | Ga0495607_0000644 | |||
| 931 | Ga0495607_0009099 | |||
| 932 | Ga0495607_0034933 | |||
| 933 | Ga0495607_0040486 | |||
| 934 | Ga0495607_0060402 | |||
| 935 | Ga0495583_0000008 | |||
| 936 | Ga0495583_0000050 | |||
| 937 | Ga0495583_0000064 | |||
| 938 | Ga0495583_0000253 | |||
| 939 | Ga0495583_0016130 | |||
| 940 | Ga0495583_0018718 | |||
| 941 | Ga0495583_0034199 | |||
| 942 | Ga0495606_0000001 | |||
| 943 | Ga0495606_0000030 | |||
| 944 | Ga0495606_0000282 | |||
| 945 | Ga0495606_0003624 | |||
| 946 | Ga0495606_0005214 | |||
| 947 | Ga0495606_0010442 | |||
| 948 | Ga0495606_0024337 | |||
| 949 | Ga0495610_0000003 | |||
| 950 | Ga0495610_0001826 | |||
| 951 | Ga0495610_0009770 | |||
| 952 | Ga0495610_0016720 | |||
| 953 | Ga0495610_0041049 | |||
| 954 | Ga0495616_0000012 | |||
| 955 | Ga0495616_0000283 | |||
| 956 | Ga0495616_0001100 | |||
| 957 | Ga0495616_0006912 | |||
| 958 | Ga0495616_0052135 | |||
| 959 | Ga0495616_0055424 | |||
| 960 | Ga0495616_0076573 | |||
| 961 | Ga0495631_0000214 | |||
| 962 | Ga0495631_0003192 | |||
| 963 | Ga0495631_0007582 | |||
| 964 | Ga0495631_0078034 | |||
| 965 | Ga0495632_0000117 | |||
| 966 | Ga0495632_0000151 | |||
| 967 | Ga0495632_0000405 | |||
| 968 | Ga0495632_0002250 | |||
| 969 | Ga0495637_0000042 | |||
| 970 | Ga0495643_0000028 | |||
| 971 | Ga0495643_0000285 | |||
| 972 | Ga0495643_0009345 | |||
| 973 | Ga0495643_0018663 | |||
| 974 | Ga0495643_0018836 | |||
| 975 | Ga0495643_0083757 | |||
| 976 | Ga0495643_0093325 | |||
| 977 | Ga0495644_0026277 | |||
| 978 | Ga0495648_0000001 | |||
| 979 | Ga0495648_0000079 | |||
| 980 | Ga0495648_0005786 | |||
| 981 | Ga0495648_0014982 | |||
| 982 | Ga0495648_0016643 | |||
| 983 | Ga0495648_0023950 | |||
| 984 | Ga0495648_0027847 | |||
| 985 | Ga0495648_0033278 | |||
| 986 | Ga0495648_0040219 | |||
| 987 | Ga0495648_0058300 | |||
| 988 | Ga0495642_0002229 | |||
| 989 | Ga0495642_0002749 | |||
| 990 | Ga0495642_0004777 | |||
| 991 | Ga0495654_0000037 | |||
| 992 | Ga0495654_0008463 | |||
| 993 | Ga0495654_0009920 | |||
| 994 | Ga0495654_0016392 | |||
| 995 | Ga0495654_0040665 | |||
| 996 | Ga0495654_0073473 | |||
| 997 | Ga0495609_0000026 | |||
| 998 | Ga0495609_0000241 | |||
| 999 | Ga0495609_0001046 | |||
| 1000 | Ga0495609_0013197 | |||
| 1001 | Ga0495609_0015872 | |||
| 1002 | Ga0495609_0018079 | |||
| 1003 | Ga0495609_0064905 | |||
| 1004 | Ga0495597_0000073 | |||
| 1005 | Ga0495597_0000705 | |||
| 1006 | Ga0495597_0000864 | |||
| 1007 | Ga0495597_0004402 | |||
| 1008 | Ga0495597_0008100 | |||
| 1009 | Ga0495622_0000131 | |||
| 1010 | Ga0495622_0026719 | |||
| 1011 | Ga0495622_0030689 | |||
| 1012 | Ga0495633_0000055 | |||
| 1013 | Ga0495633_0000106 | |||
| 1014 | Ga0495633_0000675 | |||
| 1015 | Ga0495633_0013433 | |||
| 1016 | Ga0495633_0018016 | |||
| 1017 | Ga0495633_0018951 | |||
| 1018 | Ga0495656_0006356 | |||
| 1019 | Ga0495656_0049412 | |||
| 1020 | Ga0495656_0155497 | |||
| 1021 | Ga0495668_0000190 | |||
| 1022 | Ga0495668_0000565 | |||
| 1023 | Ga0495668_0001065 | |||
| 1024 | Ga0495668_0001873 | |||
| 1025 | Ga0495668_0002146 | |||
| 1026 | Ga0495668_0006874 | |||
| 1027 | Ga0495668_0013236 | |||
| 1028 | Ga0495668_0016126 | |||
| 1029 | Ga0495668_0019446 | |||
| 1030 | Ga0495611_0000151 | |||
| 1031 | Ga0495611_0018928 | |||
| 1032 | Ga0495611_0066432 | |||
| 1033 | Ga0495625_0000035 | |||
| 1034 | Ga0495625_0000391 | |||
| 1035 | Ga0495625_0002897 | |||
| 1036 | Ga0495625_0017011 | |||
| 1037 | Ga0495625_0023692 | |||
| 1038 | Ga0495625_0043513 | |||
| 1039 | Ga0495625_0076343 | |||
| 1040 | Ga0495625_0131621 | |||
| 1041 | Ga0495659_0000158 | |||
| 1042 | Ga0495659_0028445 | |||
| 1043 | Ga0495659_0041143 | |||
| 1044 | Ga0495661_0000152 | |||
| 1045 | Ga0495661_0000715 | |||
| 1046 | Ga0495661_0006925 | |||
| 1047 | Ga0495661_0008169 | |||
| 1048 | Ga0495661_0016799 | |||
| 1049 | Ga0495661_0103006 | |||
| 1050 | Ga0495588_0000139 | |||
| 1051 | Ga0495646_0046872 | |||
| 1052 | Ga0495669_0002681 | |||
| 1053 | Ga0495669_0021045 | |||
| 1054 | Ga0495670_0000114 | |||
| 1055 | Ga0495670_0006155 | |||
| 1056 | Ga0495670_0010977 | |||
| 1057 | Ga0495670_0088515 | |||
| 1058 | Ga0495671_0000010 | |||
| 1059 | Ga0495671_0002314 | |||
| 1060 | Ga0495671_0006896 | |||
| 1061 | Ga0495671_0007326 | |||
| 1062 | Ga0495671_0007720 | |||
| 1063 | Ga0495649_0035077 | |||
| 1064 | Ga0495649_0041820 | |||
| 1065 | Ga0495649_0042748 | |||
| 1066 | Ga0495649_0048270 | |||
| 1067 | Ga0495649_0065306 | |||
| 1068 | Ga0495649_0070323 | |||
| 1069 | Ga0495589_0000100 | |||
| 1070 | Ga0495589_0000101 | |||
| 1071 | Ga0495589_0037719 | |||
| 1072 | Ga0495589_0100712 | |||
| 1073 | Ga0495660_0000027 | |||
| 1074 | Ga0495660_0000335 | |||
| 1075 | Ga0495660_0001827 | |||
| 1076 | Ga0495660_0010965 | |||
| 1077 | Ga0495660_0020088 | |||
| 1078 | Ga0495660_0039111 | |||
| 1079 | Ga0495660_0041760 | |||
| 1080 | Ga0495660_0052366 | |||
| 1081 | Ga0495636_0003252 | |||
| 1082 | Ga0495636_0042115 | |||
| 1083 | Ga0495672_0000220 | |||
| 1084 | Ga0495672_0000221 | |||
| 1085 | Ga0495672_0002445 | |||
| 1086 | Ga0495672_0002802 | |||
| 1087 | Ga0495672_0007979 | |||
| 1088 | Ga0495680_0025635 | |||
| 1089 | Ga0495683_0000064 | |||
| 1090 | Ga0495683_0001336 | |||
| 1091 | Ga0495683_0032651 | |||
| 1092 | Ga0495687_000012 | |||
| 1093 | Ga0495687_000037 | |||
| 1094 | Ga0495687_000062 | |||
| 1095 | Ga0495687_000122 | |||
| 1096 | Ga0495687_003478 | |||
| 1097 | Ga0495677_0000014 | |||
| 1098 | Ga0495677_0003124 | |||
| 1099 | Ga0495677_0004220 | |||
| 1100 | Ga0495677_0032844 | |||
| 1101 | Ga0495679_001792 | |||
| 1102 | Ga0495679_004418 | |||
| 1103 | Ga0495685_000262 | |||
| 1104 | Ga0495685_001925 | |||
| 1105 | Ga0495673_0000003 | |||
| 1106 | Ga0495673_0000016 | |||
| 1107 | Ga0495673_0000035 | |||
| 1108 | Ga0495673_0003607 | |||
| 1109 | Ga0495681_0000021 | |||
| 1110 | Ga0495681_0000246 | |||
| 1111 | Ga0495681_0006028 | |||
| 1112 | Ga0495681_0015183 | |||
| 1113 | Ga0495681_0024947 | |||
| 1114 | Ga0495686_0000047 | |||
| 1115 | Ga0495686_0007983 | |||
| 1116 | Ga0495686_0008813 | |||
| 1117 | Ga0495686_0096437 | |||
| 1118 | Ga0495686_0149193 | |||
| 1119 | Ga0495626_0000222 | |||
| 1120 | Ga0495626_0001784 | |||
| 1121 | Ga0495626_0008414 | |||
| 1122 | Ga0495626_0015604 | |||
| 1123 | Ga0495626_0089155 | |||
| 1124 | Ga0495626_0095110 | |||
| 1125 | Ga0495626_0137873 | |||
| 1126 | Ga0496102_0049277 | |||
| 1127 | Ga0496102_0147844 | |||
| 1128 | Ga0496103_0178087 | |||
| 1129 | Ga0496106_0030710 | |||
| 1130 | Ga0496108_0329777 | |||
| 1131 | Ga0496109_0199668 | |||
| 1132 | Ga0496110_0000026 | |||
| 1133 | Ga0496111_0041791 | |||
| 1134 | Ga0496111_0050164 | |||
| 1135 | Ga0496113_0001992 | |||
| 1136 | Ga0496117_0000005 | |||
| 1137 | Ga0496118_0000022 | |||
| 1138 | Ga0496120_0039174 | |||
| 1139 | Ga0496121_0004143 | |||
| 1140 | Ga0496121_0041960 | |||
| 1141 | Ga0496122_0001132 | |||
| 1142 | Ga0496122_0020696 | |||
| 1143 | Ga0496122_0025368 | |||
| 1144 | Ga0496122_0050365 | |||
| 1145 | Ga0496123_0003516 | |||
| 1146 | Ga0496123_0005149 | |||
| 1147 | Ga0496123_0006339 | |||
| 1148 | Ga0496124_0024602 | |||
| 1149 | Ga0496124_0084520 | |||
| 1150 | Ga0496124_0142299 | |||
| 1151 | Ga0496124_0162170 | |||
| 1152 | Ga0496126_0004427 | |||
| 1153 | Ga0495678_000002 | |||
| 1154 | Ga0495678_000029 | |||
| 1155 | Ga0495678_000045 | |||
| 1156 | Ga0495678_000663 | |||
| 1157 | Ga0495678_004929 | |||
| 1158 | Ga0495678_024725 | |||
| 1159 | Ga0495682_0000208 | |||
| 1160 | Ga0495682_0000628 | |||
| 1161 | Ga0495682_0071136 | |||
| 1162 | Ga0501311_001840 | |||
| 1163 | Ga0501316_003450 | |||
| 1164 | Ga0501335_000226 | |||
| 1165 | Ga0501034_0103678 | |||
| 1166 | Ga0501036_0156079 | |||
| 1167 | Ga0501198_009956 | |||
| 1168 | Ga0501207_007153 | |||
| 1169 | Ga0501217_015353 | |||
| 1170 | Ga0501222_003666 | |||
| 1171 | Ga0501227_002485 | |||
| 1172 | Ga0501227_003667 | |||
| 1173 | Ga0501240_007331 | |||
| 1174 | Ga0501249_002660 | |||
| 1175 | Ga0501269_000700 | |||
| 1176 | Ga0501279_004021 | |||
| 1177 | Ga0501035_0011980 | |||
| 1178 | Ga0501044_0588127 | |||
| 1179 | Ga0500594_0002831 | |||
| 1180 | Ga0500618_000068 | |||
| 1181 | Ga0500586_001379 | |||
| 1182 | Ga0587083_0004084 | |||
| 1183 | 2601671312 | |||
| 1184 | 2643789486 | |||
| 1185 | 2643801500 | |||
| 1186 | 2644216057 | |||
| 1187 | 2644251262 | |||
| 1188 | 2644357529 | |||
| 1189 | 2644471438 | |||
| 1190 | 2691331105 | |||
| 1191 | 2738713391 | |||
| 1192 | 2738740120 | |||
| 1193 | 2738829884 | |||
| 1194 | 2738844115 | |||
| 1195 | 2739153680 | |||
| 1196 | 2739195600 | |||
| 1197 | 2739274322 | |||
| 1198 | 2739322076 | |||
| 1199 | 2739340317 | |||
| 1200 | 2739343366 | |||
| 1201 | 2842715518 | |||
| 1202 | 2857548848 | |||
| 1203 | 2857555921 | |||
| 1204 | 2857566937 | |||
| 1205 | 2885080357 | |||
| 1206 | 2904425720 | |||
| 1207 | 2916179111 | |||
| 1208 | 2919478254 | |||
| 1209 | 2919500168 | |||
| 1210 | 2919534667 | |||
| 1211 | 2919691630 | |||
| 1212 | 2932415456 | |||
| 1213 | 2932421383 | |||
| 1214 | 2937613548 | |||
| 1215 | 8047677196 | |||
| 1216 | 8054358010 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3k1u-assembly1.cif.gz_A | beta-xylosidase, family 43 glycosyl hydrolase from clostridium acetobutylicum | 0.9767 | 3 | 310 |
| 5m8b-assembly1.cif.gz_B | crystal structure of alpha-l-arabinofuranosidase from lactobacillus brevis | 0.9717 | 3 | 310 |
| 5m8e-assembly1.cif.gz_B | crystal structure of a gh43 arabonofuranosidase from weissella sp. strain 142 | 0.9682 | 1 | 310 |
| 3akh-assembly1.cif.gz_A | crystal structure of exo-1,5-alpha-l-arabinofuranosidase complexed with alpha-1,5-l-arabinofuranotriose | 0.9682 | 3 | 309 |
| 3k1u-assembly1.cif.gz_A | beta-xylosidase, family 43 glycosyl hydrolase from clostridium acetobutylicum | 0.9554 | 3 | 310 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3akhA01 | Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 | 0.9682 | 3 | 309 | 2.115.10.20 |
| 3akhA01 | Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 | 0.9498 | 3 | 309 | 2.115.10.20 |
| 4qqsA00 | Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 | 0.8123 | 3 | 316 | 2.115.10.20 |
| 3kstA00 | Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 | 0.8088 | 4 | 307 | 2.115.10.20 |
| 5z5fA01 | Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 | 0.8015 | 1 | 314 | 2.115.10.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A377WCH1-F1-model_v4 | Alpha-L-arabinofuranosidase II (EC 3.2.1.55) | 0.9909 | 5 | 68 |
GO:0005975
GO:0046556 |
| AF-A0A379WGH8-F1-model_v4 | Glycosyl hydrolase (EC 3.2.1.55) | 0.9867 | 5 | 183 |
GO:0005975
GO:0046556 |
| AF-A0A2N5AG52-F1-model_v4 | Alpha-N-arabinofuranosidase | 0.9848 | 5 | 197 |
GO:0004553
GO:0005975 |
| AF-A0A656YHE7-F1-model_v4 | deleted | 0.9844 | 5 | 162 |
|
| AF-A0A379TQ40-F1-model_v4 | Glycosyl hydrolase (EC 3.2.1.55) | 0.9819 | 1 | 116 |
GO:0005975
GO:0046556 |