F468853
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 609 | 305 | 609 | 50 |
Family's Representative Sequence
| Representative Sequence | 3300005467|Ga0070706_100494345|Ga0070706_1004943452 |
| Length | 58 |
| Sequence | LAGKEKIVDLLWTIAVILLILWLLGMVSSYTLGGFVHILLVLAVVVVLIRVIQGRRVV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 2 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 3 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 4 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 5 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 6 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 7 | 3300003162 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 8 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 9 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 10 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 11 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 12 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 13 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 14 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 15 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 16 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 18 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 24 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 28 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 52 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 58 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 61 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 68 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 70 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 71 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 72 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 74 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 75 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 76 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 77 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 78 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 79 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 80 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 81 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 82 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 83 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 84 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 87 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 88 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 90 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 91 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 92 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 93 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 94 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 95 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 97 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 98 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 111 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 127 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 129 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 130 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 131 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 132 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 133 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 201 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 202 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 203 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 204 | 3300030762 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 205 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 206 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 207 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 208 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 209 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 210 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 211 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 212 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 213 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 214 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 215 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 216 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 217 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 218 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 219 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 220 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 221 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 222 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 223 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 224 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 225 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 226 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 227 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 228 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 229 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 230 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 231 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 232 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 233 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 234 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 235 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 236 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 237 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 238 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 239 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 240 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 241 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 242 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 243 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 244 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 245 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 246 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 276 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 277 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 278 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 279 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 280 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 281 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 282 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 283 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 284 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 285 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 286 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 287 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 295 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 296 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 297 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 298 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 299 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 300 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 301 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 302 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 303 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 304 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 305 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.24 |
| Metatranscriptomes | 4.76 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.66 |
| Nodule | 0 |
| Rhizoplane | 3.78 |
| Rhizosphere | 93.76 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.81 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24752J21851_1003164 | 3300001976 | Bacteria | 2173 |
| 2 | JGI24743J22301_10005886 | 3300001991 | Bacteria | 2067 |
| 3 | JGI24745J21846_1016410 | 3300002073 | Unclassified | 859 |
| 4 | JGI24748J21848_1011022 | 3300002074 | Eukaryota | 1064 |
| 5 | JGI24034J26672_10045692 | 3300002239 | Unclassified | 744 |
| 6 | JGI24751J29686_10001680 | 3300002459 | Bacteria | 4552 |
| 7 | Ga0006778J45830_1022949 | 3300003162 | Bacteria | 1806 |
| 8 | rootH1_10193375 | 3300003323 | Bacteria | 1671 |
| 9 | Ga0007416J51690_1087992 | 3300003577 | Bacteria | 748 |
| 10 | Ga0007429J51699_1057182 | 3300003579 | Bacteria | 1363 |
| 11 | Ga0032354_1015450 | 3300003693 | Bacteria | 1809 |
| 12 | Ga0058863_11746886 | 3300004799 | Bacteria | 652 |
| 13 | Ga0058861_11998395 | 3300004800 | Bacteria | 659 |
| 14 | Ga0058860_12203405 | 3300004801 | Bacteria | 936 |
| 15 | Ga0058862_10124568 | 3300004803 | Bacteria | 1157 |
| 16 | Ga0058862_12853411 | 3300004803 | Bacteria | 1825 |
| 17 | Ga0065704_10200846 | 3300005289 | Bacteria | 1147 |
| 18 | Ga0065712_10370906 | 3300005290 | Unclassified | 740 |
| 19 | Ga0065707_10320550 | 3300005295 | Bacteria | 967 |
| 20 | Ga0065707_10321536 | 3300005295 | Bacteria | 959 |
| 21 | Ga0070658_10000422 | 3300005327 | Bacteria | 36720 |
| 22 | Ga0070683_100007493 | 3300005329 | Bacteria | 9224 |
| 23 | Ga0070683_100735285 | 3300005329 | Bacteria | 945 |
| 24 | Ga0070690_100600720 | 3300005330 | Unclassified | 835 |
| 25 | Ga0070670_101942561 | 3300005331 | Bacteria | 542 |
| 26 | Ga0068869_100155933 | 3300005334 | Bacteria | 1774 |
| 27 | Ga0068869_101549438 | 3300005334 | Bacteria | 589 |
| 28 | Ga0070666_10886131 | 3300005335 | Unclassified | 659 |
| 29 | Ga0070666_11327217 | 3300005335 | Unclassified | 537 |
| 30 | Ga0070680_100027238 | 3300005336 | Bacteria | 4577 |
| 31 | Ga0070680_100288828 | 3300005336 | Bacteria | 1390 |
| 32 | Ga0070680_100949136 | 3300005336 | Unclassified | 742 |
| 33 | Ga0070682_100038123 | 3300005337 | Bacteria | 2946 |
| 34 | Ga0070682_100073854 | 3300005337 | Bacteria | 2189 |
| 35 | Ga0068868_100012529 | 3300005338 | Bacteria | 6200 |
| 36 | Ga0068868_100013166 | 3300005338 | Bacteria | 6059 |
| 37 | Ga0068868_101144972 | 3300005338 | Unclassified | 717 |
| 38 | Ga0070660_100059277 | 3300005339 | Bacteria | 2968 |
| 39 | Ga0070660_100517788 | 3300005339 | Bacteria | 993 |
| 40 | Ga0070689_100000001 | 3300005340 | Bacteria | 1334580 |
| 41 | Ga0070689_100053569 | 3300005340 | Bacteria | 3122 |
| 42 | Ga0070689_100302276 | 3300005340 | Unclassified | 1332 |
| 43 | Ga0070687_101177081 | 3300005343 | Bacteria | 564 |
| 44 | Ga0070661_100003544 | 3300005344 | Bacteria | 10751 |
| 45 | Ga0070661_100601151 | 3300005344 | Bacteria | 889 |
| 46 | Ga0070661_100856807 | 3300005344 | Bacteria | 748 |
| 47 | Ga0070668_102117890 | 3300005347 | Bacteria | 519 |
| 48 | Ga0070669_100644003 | 3300005353 | Unclassified | 891 |
| 49 | Ga0070675_101979192 | 3300005354 | Unclassified | 537 |
| 50 | Ga0070674_100001002 | 3300005356 | Bacteria | 14730 |
| 51 | Ga0070673_100371481 | 3300005364 | Unclassified | 1273 |
| 52 | Ga0070673_101466180 | 3300005364 | Unclassified | 643 |
| 53 | Ga0070688_100106766 | 3300005365 | Bacteria | 1855 |
| 54 | Ga0070688_100405382 | 3300005365 | Unclassified | 1010 |
| 55 | Ga0070659_100012377 | 3300005366 | Bacteria | 6326 |
| 56 | Ga0070659_100048039 | 3300005366 | Bacteria | 3351 |
| 57 | Ga0070659_101343974 | 3300005366 | Bacteria | 634 |
| 58 | Ga0070667_100059176 | 3300005367 | Bacteria | 3241 |
| 59 | Ga0070667_100883897 | 3300005367 | Bacteria | 831 |
| 60 | Ga0070703_10289867 | 3300005406 | Bacteria | 678 |
| 61 | Ga0070709_10001806 | 3300005434 | Bacteria | 11600 |
| 62 | Ga0070709_10050343 | 3300005434 | Bacteria | 2610 |
| 63 | Ga0070709_10401362 | 3300005434 | Bacteria | 1023 |
| 64 | Ga0070709_10409784 | 3300005434 | Unclassified | 1014 |
| 65 | Ga0070709_11239556 | 3300005434 | Unclassified | 600 |
| 66 | Ga0070709_11287388 | 3300005434 | Bacteria | 589 |
| 67 | Ga0070714_100156776 | 3300005435 | Bacteria | 2056 |
| 68 | Ga0070714_100178922 | 3300005435 | Bacteria | 1929 |
| 69 | Ga0070714_100179166 | 3300005435 | Unclassified | 1927 |
| 70 | Ga0070714_100207979 | 3300005435 | Unclassified | 1793 |
| 71 | Ga0070714_100426082 | 3300005435 | Bacteria | 1257 |
| 72 | Ga0070714_100684197 | 3300005435 | Unclassified | 989 |
| 73 | Ga0070714_100896536 | 3300005435 | Unclassified | 861 |
| 74 | Ga0070714_101426698 | 3300005435 | Bacteria | 676 |
| 75 | Ga0070714_102419691 | 3300005435 | Unclassified | 510 |
| 76 | Ga0070713_100031741 | 3300005436 | Unclassified | 4210 |
| 77 | Ga0070713_100058587 | 3300005436 | Bacteria | 3212 |
| 78 | Ga0070713_100089141 | 3300005436 | Unclassified | 2649 |
| 79 | Ga0070713_100130529 | 3300005436 | Bacteria | 2215 |
| 80 | Ga0070713_100358287 | 3300005436 | Bacteria | 1355 |
| 81 | Ga0070710_10350674 | 3300005437 | Unclassified | 977 |
| 82 | Ga0070710_10388641 | 3300005437 | Unclassified | 932 |
| 83 | Ga0070710_10429847 | 3300005437 | Bacteria | 891 |
| 84 | Ga0070710_11347163 | 3300005437 | Unclassified | 532 |
| 85 | Ga0070711_100025034 | 3300005439 | Bacteria | 3901 |
| 86 | Ga0070711_100130218 | 3300005439 | Bacteria | 1873 |
| 87 | Ga0070711_100725570 | 3300005439 | Bacteria | 838 |
| 88 | Ga0070694_101201610 | 3300005444 | Unclassified | 635 |
| 89 | Ga0070694_101359848 | 3300005444 | Bacteria | 598 |
| 90 | Ga0070708_100139421 | 3300005445 | Bacteria | 2248 |
| 91 | Ga0070708_100310572 | 3300005445 | Unclassified | 1485 |
| 92 | Ga0070663_101594605 | 3300005455 | Unclassified | 582 |
| 93 | Ga0070662_100021878 | 3300005457 | Bacteria | 4370 |
| 94 | Ga0070662_101400633 | 3300005457 | Unclassified | 602 |
| 95 | Ga0070681_10154669 | 3300005458 | Bacteria | 2219 |
| 96 | Ga0068867_101544608 | 3300005459 | Unclassified | 619 |
| 97 | Ga0070685_10004460 | 3300005466 | Bacteria | 7079 |
| 98 | Ga0070706_100251395 | 3300005467 | Bacteria | 1650 |
| 99 | Ga0070706_100494345 | 3300005467 | Unclassified | 1138 |
| 100 | Ga0070707_100634481 | 3300005468 | Unclassified | 1031 |
| 101 | Ga0070698_100000537 | 3300005471 | Bacteria | 40532 |
| 102 | Ga0070698_100047112 | 3300005471 | Bacteria | 4407 |
| 103 | Ga0070698_100052145 | 3300005471 | Bacteria | 4163 |
| 104 | Ga0070698_101914252 | 3300005471 | Unclassified | 546 |
| 105 | Ga0070699_100020703 | 3300005518 | Bacteria | 5673 |
| 106 | Ga0070699_100030623 | 3300005518 | Bacteria | 4646 |
| 107 | Ga0070699_100180594 | 3300005518 | Bacteria | 1872 |
| 108 | Ga0070699_100519064 | 3300005518 | Bacteria | 1083 |
| 109 | Ga0070699_101705039 | 3300005518 | Unclassified | 577 |
| 110 | Ga0070679_100005155 | 3300005530 | Bacteria | 12089 |
| 111 | Ga0070679_100042805 | 3300005530 | Bacteria | 4510 |
| 112 | Ga0070679_101679494 | 3300005530 | Bacteria | 583 |
| 113 | Ga0070684_101107426 | 3300005535 | Bacteria | 744 |
| 114 | Ga0070697_100000703 | 3300005536 | Bacteria | 25005 |
| 115 | Ga0070697_100976644 | 3300005536 | Unclassified | 752 |
| 116 | Ga0068853_100022607 | 3300005539 | Bacteria | 5254 |
| 117 | Ga0070672_100127165 | 3300005543 | Bacteria | 2091 |
| 118 | Ga0070672_101558164 | 3300005543 | Unclassified | 592 |
| 119 | Ga0070686_100210148 | 3300005544 | Unclassified | 1400 |
| 120 | Ga0070686_101784613 | 3300005544 | Unclassified | 523 |
| 121 | Ga0070695_100033595 | 3300005545 | Unclassified | 3210 |
| 122 | Ga0070695_101543060 | 3300005545 | Unclassified | 553 |
| 123 | Ga0070693_100088834 | 3300005547 | Unclassified | 1859 |
| 124 | Ga0070693_100135900 | 3300005547 | Bacteria | 1542 |
| 125 | Ga0070693_100563738 | 3300005547 | Bacteria | 817 |
| 126 | Ga0070665_101399567 | 3300005548 | Bacteria | 708 |
| 127 | Ga0070665_101834399 | 3300005548 | Unclassified | 613 |
| 128 | Ga0070704_100302399 | 3300005549 | Bacteria | 1333 |
| 129 | Ga0070704_100329321 | 3300005549 | Bacteria | 1282 |
| 130 | Ga0070704_101902433 | 3300005549 | Bacteria | 551 |
| 131 | Ga0068855_100091697 | 3300005563 | Bacteria | 3504 |
| 132 | Ga0068855_100190636 | 3300005563 | Bacteria | 2313 |
| 133 | Ga0068855_100399985 | 3300005563 | Bacteria | 1505 |
| 134 | Ga0070664_100047275 | 3300005564 | Bacteria | 3635 |
| 135 | Ga0070664_100064395 | 3300005564 | Bacteria | 3126 |
| 136 | Ga0068857_100004945 | 3300005577 | Bacteria | 11319 |
| 137 | Ga0068857_100110263 | 3300005577 | Unclassified | 2473 |
| 138 | Ga0068854_100189527 | 3300005578 | Bacteria | 1610 |
| 139 | Ga0068856_100006884 | 3300005614 | Bacteria | 11119 |
| 140 | Ga0068856_100200443 | 3300005614 | Bacteria | 2010 |
| 141 | Ga0068856_102212243 | 3300005614 | Unclassified | 559 |
| 142 | Ga0070702_100042825 | 3300005615 | Bacteria | 2548 |
| 143 | Ga0068852_100033192 | 3300005616 | Bacteria | 4283 |
| 144 | Ga0068859_100440382 | 3300005617 | Bacteria | 1399 |
| 145 | Ga0068859_100460732 | 3300005617 | Unclassified | 1367 |
| 146 | Ga0068859_101959880 | 3300005617 | Unclassified | 647 |
| 147 | Ga0068864_100019656 | 3300005618 | Bacteria | 5649 |
| 148 | Ga0068864_100218377 | 3300005618 | Unclassified | 1758 |
| 149 | Ga0068864_100335584 | 3300005618 | Bacteria | 1423 |
| 150 | Ga0068864_100658043 | 3300005618 | Bacteria | 1020 |
| 151 | Ga0068866_10008281 | 3300005718 | Bacteria | 4376 |
| 152 | Ga0068866_10172642 | 3300005718 | Bacteria | 1270 |
| 153 | Ga0068866_10499885 | 3300005718 | Unclassified | 804 |
| 154 | Ga0068861_100597042 | 3300005719 | Bacteria | 1013 |
| 155 | Ga0068861_101631807 | 3300005719 | Bacteria | 636 |
| 156 | Ga0068851_10001293 | 3300005834 | Bacteria | 10917 |
| 157 | Ga0068870_10003151 | 3300005840 | Bacteria | 6955 |
| 158 | Ga0068863_100042710 | 3300005841 | Bacteria | 4308 |
| 159 | Ga0068863_100102378 | 3300005841 | Bacteria | 2723 |
| 160 | Ga0068863_100190082 | 3300005841 | Bacteria | 1973 |
| 161 | Ga0068858_100067306 | 3300005842 | Bacteria | 3317 |
| 162 | Ga0068858_100712144 | 3300005842 | Bacteria | 977 |
| 163 | Ga0068858_101303019 | 3300005842 | Bacteria | 715 |
| 164 | Ga0068860_100010295 | 3300005843 | Bacteria | 9251 |
| 165 | Ga0068860_100028673 | 3300005843 | Bacteria | 5358 |
| 166 | Ga0068860_101966690 | 3300005843 | Bacteria | 606 |
| 167 | Ga0068862_100019961 | 3300005844 | Bacteria | 5593 |
| 168 | Ga0068862_102047744 | 3300005844 | Bacteria | 583 |
| 169 | Ga0070717_10209605 | 3300006028 | Unclassified | 1710 |
| 170 | Ga0070717_10561192 | 3300006028 | Bacteria | 1034 |
| 171 | Ga0070717_11103282 | 3300006028 | Bacteria | 723 |
| 172 | Ga0070717_11943290 | 3300006028 | Bacteria | 531 |
| 173 | Ga0070715_10146549 | 3300006163 | Unclassified | 1152 |
| 174 | Ga0070715_10148187 | 3300006163 | Bacteria | 1147 |
| 175 | Ga0070715_10217762 | 3300006163 | Unclassified | 980 |
| 176 | Ga0070715_10279765 | 3300006163 | Bacteria | 884 |
| 177 | Ga0070715_10904658 | 3300006163 | Unclassified | 543 |
| 178 | Ga0070715_11042564 | 3300006163 | Bacteria | 512 |
| 179 | Ga0070715_11044936 | 3300006163 | Unclassified | 511 |
| 180 | Ga0070716_100018670 | 3300006173 | Unclassified | 3616 |
| 181 | Ga0070716_100089826 | 3300006173 | Bacteria | 1857 |
| 182 | Ga0070716_100268738 | 3300006173 | Unclassified | 1170 |
| 183 | Ga0070716_100390950 | 3300006173 | Unclassified | 997 |
| 184 | Ga0070716_100832497 | 3300006173 | Unclassified | 717 |
| 185 | Ga0070716_100896508 | 3300006173 | Unclassified | 694 |
| 186 | Ga0070716_101051491 | 3300006173 | Bacteria | 646 |
| 187 | Ga0070716_101511068 | 3300006173 | Unclassified | 549 |
| 188 | Ga0070712_100020416 | 3300006175 | Bacteria | 4335 |
| 189 | Ga0070712_100212006 | 3300006175 | Bacteria | 1528 |
| 190 | Ga0070712_100399485 | 3300006175 | Unclassified | 1135 |
| 191 | Ga0097621_100206182 | 3300006237 | Bacteria | 1708 |
| 192 | Ga0097621_100403549 | 3300006237 | Bacteria | 1224 |
| 193 | Ga0097621_100684051 | 3300006237 | Unclassified | 943 |
| 194 | Ga0068871_100570910 | 3300006358 | Unclassified | 1026 |
| 195 | Ga0068871_101701341 | 3300006358 | Unclassified | 598 |
| 196 | Ga0075428_100045670 | 3300006844 | Unclassified | 4813 |
| 197 | Ga0075428_100836555 | 3300006844 | Unclassified | 978 |
| 198 | Ga0075431_100008554 | 3300006847 | Bacteria | 10250 |
| 199 | Ga0075431_100076057 | 3300006847 | Bacteria | 3465 |
| 200 | Ga0075433_11479347 | 3300006852 | Bacteria | 587 |
| 201 | Ga0075429_101974225 | 3300006880 | Unclassified | 505 |
| 202 | Ga0068865_100162324 | 3300006881 | Bacteria | 1706 |
| 203 | Ga0068865_100448212 | 3300006881 | Bacteria | 1066 |
| 204 | Ga0068865_100863932 | 3300006881 | Unclassified | 784 |
| 205 | Ga0097620_100440369 | 3300006931 | Bacteria | 1399 |
| 206 | Ga0097620_100460688 | 3300006931 | Unclassified | 1367 |
| 207 | Ga0097620_101960007 | 3300006931 | Unclassified | 647 |
| 208 | Ga0099794_10009736 | 3300007265 | Unclassified | 4055 |
| 209 | Ga0099794_10028192 | 3300007265 | Unclassified | 2610 |
| 210 | Ga0099794_10043797 | 3300007265 | Bacteria | 2137 |
| 211 | Ga0099795_10002146 | 3300007788 | Bacteria | 4550 |
| 212 | Ga0105251_10036448 | 3300009011 | Bacteria | 2420 |
| 213 | Ga0105240_10005890 | 3300009093 | Bacteria | 18155 |
| 214 | Ga0105240_10190974 | 3300009093 | Unclassified | 2408 |
| 215 | Ga0105240_12127758 | 3300009093 | Unclassified | 582 |
| 216 | Ga0111539_10792091 | 3300009094 | Bacteria | 1103 |
| 217 | Ga0105245_10040249 | 3300009098 | Bacteria | 4163 |
| 218 | Ga0105245_10644121 | 3300009098 | Bacteria | 1089 |
| 219 | Ga0105245_12093725 | 3300009098 | Unclassified | 619 |
| 220 | Ga0105247_10002094 | 3300009101 | Bacteria | 13797 |
| 221 | Ga0105247_10429959 | 3300009101 | Bacteria | 947 |
| 222 | Ga0105243_10929491 | 3300009148 | Bacteria | 867 |
| 223 | Ga0105241_10009943 | 3300009174 | Bacteria | 6988 |
| 224 | Ga0105242_10067596 | 3300009176 | Bacteria | 2955 |
| 225 | Ga0105242_10137668 | 3300009176 | Bacteria | 2115 |
| 226 | Ga0105242_13162552 | 3300009176 | Bacteria | 511 |
| 227 | Ga0105248_10088095 | 3300009177 | Bacteria | 3494 |
| 228 | Ga0105237_10000151 | 3300009545 | Bacteria | 96844 |
| 229 | Ga0105237_10804750 | 3300009545 | Bacteria | 947 |
| 230 | Ga0105237_11840103 | 3300009545 | Bacteria | 613 |
| 231 | Ga0105238_10105703 | 3300009551 | Bacteria | 2797 |
| 232 | Ga0105238_13072471 | 3300009551 | Unclassified | 501 |
| 233 | Ga0105249_10140893 | 3300009553 | Bacteria | 2312 |
| 234 | Ga0105249_10953292 | 3300009553 | Unclassified | 926 |
| 235 | Ga0105249_13150424 | 3300009553 | Bacteria | 530 |
| 236 | Ga0105249_13368626 | 3300009553 | Unclassified | 514 |
| 237 | Ga0099796_10091027 | 3300010159 | Unclassified | 1134 |
| 238 | Ga0099796_10142282 | 3300010159 | Unclassified | 938 |
| 239 | Ga0099796_10282840 | 3300010159 | Unclassified | 698 |
| 240 | Ga0105239_10012012 | 3300010375 | Bacteria | 9657 |
| 241 | Ga0105239_10082436 | 3300010375 | Bacteria | 3542 |
| 242 | Ga0105239_10115727 | 3300010375 | Unclassified | 2975 |
| 243 | Ga0105239_10413795 | 3300010375 | Bacteria | 1527 |
| 244 | Ga0105239_11868604 | 3300010375 | Unclassified | 696 |
| 245 | Ga0105239_12424988 | 3300010375 | Bacteria | 611 |
| 246 | Ga0105246_10612286 | 3300011119 | Bacteria | 943 |
| 247 | Ga0105246_11469724 | 3300011119 | Unclassified | 639 |
| 248 | Ga0105246_11980337 | 3300011119 | Unclassified | 561 |
| 249 | Ga0105246_12517096 | 3300011119 | Bacteria | 507 |
| 250 | Ga0157373_10032674 | 3300013100 | Bacteria | 3745 |
| 251 | Ga0157370_10119841 | 3300013104 | Bacteria | 2457 |
| 252 | Ga0157369_10008874 | 3300013105 | Bacteria | 11517 |
| 253 | Ga0157369_11793261 | 3300013105 | Unclassified | 623 |
| 254 | Ga0157374_10108758 | 3300013296 | Bacteria | 2665 |
| 255 | Ga0157378_10000185 | 3300013297 | Bacteria | 59863 |
| 256 | Ga0157378_10468101 | 3300013297 | Bacteria | 1254 |
| 257 | Ga0157378_10962918 | 3300013297 | Bacteria | 886 |
| 258 | Ga0163162_10005281 | 3300013306 | Bacteria | 12464 |
| 259 | Ga0163162_10024158 | 3300013306 | Bacteria | 5998 |
| 260 | Ga0163162_11740584 | 3300013306 | Bacteria | 712 |
| 261 | Ga0163162_11951614 | 3300013306 | Unclassified | 672 |
| 262 | Ga0157372_10009715 | 3300013307 | Bacteria | 10231 |
| 263 | Ga0157372_10128756 | 3300013307 | Unclassified | 2911 |
| 264 | Ga0157372_11693659 | 3300013307 | Unclassified | 727 |
| 265 | Ga0157372_11986590 | 3300013307 | Unclassified | 668 |
| 266 | Ga0157375_10404946 | 3300013308 | Bacteria | 1531 |
| 267 | Ga0157375_12874836 | 3300013308 | Unclassified | 575 |
| 268 | Ga0163163_10018915 | 3300014325 | Bacteria | 6462 |
| 269 | Ga0163163_10481664 | 3300014325 | Unclassified | 1302 |
| 270 | Ga0163163_10565885 | 3300014325 | Bacteria | 1199 |
| 271 | Ga0163163_11079938 | 3300014325 | Bacteria | 866 |
| 272 | Ga0157380_10389989 | 3300014326 | Bacteria | 1317 |
| 273 | Ga0157380_10618256 | 3300014326 | Bacteria | 1075 |
| 274 | Ga0157377_10026235 | 3300014745 | Bacteria | 3116 |
| 275 | Ga0157377_10398796 | 3300014745 | Unclassified | 936 |
| 276 | Ga0157379_10219183 | 3300014968 | Bacteria | 1724 |
| 277 | Ga0157379_10511829 | 3300014968 | Unclassified | 1113 |
| 278 | Ga0157379_10960857 | 3300014968 | Bacteria | 813 |
| 279 | Ga0157376_10123068 | 3300014969 | Bacteria | 2302 |
| 280 | Ga0157376_10879038 | 3300014969 | Unclassified | 913 |
| 281 | Ga0157376_12127974 | 3300014969 | Bacteria | 599 |
| 282 | Ga0157376_12591463 | 3300014969 | Unclassified | 547 |
| 283 | Ga0182005_1206618 | 3300015265 | Bacteria | 592 |
| 284 | Ga0163161_10093744 | 3300017792 | Bacteria | 2225 |
| 285 | Ga0197907_10112572 | 3300020069 | Unclassified | 556 |
| 286 | Ga0206356_11546949 | 3300020070 | Unclassified | 878 |
| 287 | Ga0206349_1447815 | 3300020075 | Bacteria | 659 |
| 288 | Ga0206352_10155209 | 3300020078 | Unclassified | 557 |
| 289 | Ga0206352_11013089 | 3300020078 | Unclassified | 1839 |
| 290 | Ga0213876_10520575 | 3300021384 | Unclassified | 633 |
| 291 | Ga0213876_10733762 | 3300021384 | Unclassified | 525 |
| 292 | Ga0207697_10000518 | 3300025315 | Bacteria | 21729 |
| 293 | Ga0207656_10117860 | 3300025321 | Unclassified | 1233 |
| 294 | Ga0207682_10018953 | 3300025893 | Bacteria | 2692 |
| 295 | Ga0207692_10953786 | 3300025898 | Unclassified | 565 |
| 296 | Ga0207642_10004682 | 3300025899 | Bacteria | 4420 |
| 297 | Ga0207642_10163481 | 3300025899 | Bacteria | 1198 |
| 298 | Ga0207642_10763334 | 3300025899 | Unclassified | 613 |
| 299 | Ga0207688_10017554 | 3300025901 | Bacteria | 3890 |
| 300 | Ga0207680_10197707 | 3300025903 | Bacteria | 1368 |
| 301 | Ga0207647_10026399 | 3300025904 | Bacteria | 3801 |
| 302 | Ga0207685_10035766 | 3300025905 | Bacteria | 1815 |
| 303 | Ga0207685_10621967 | 3300025905 | Unclassified | 581 |
| 304 | Ga0207685_10704095 | 3300025905 | Unclassified | 550 |
| 305 | Ga0207685_10813302 | 3300025905 | Bacteria | 515 |
| 306 | Ga0207699_10001019 | 3300025906 | Bacteria | 13262 |
| 307 | Ga0207699_10355094 | 3300025906 | Unclassified | 1035 |
| 308 | Ga0207699_10527595 | 3300025906 | Unclassified | 854 |
| 309 | Ga0207699_11045604 | 3300025906 | Unclassified | 604 |
| 310 | Ga0207699_11351708 | 3300025906 | Bacteria | 527 |
| 311 | Ga0207645_10000351 | 3300025907 | Bacteria | 38347 |
| 312 | Ga0207643_10001192 | 3300025908 | Bacteria | 15359 |
| 313 | Ga0207705_10020482 | 3300025909 | Bacteria | 4724 |
| 314 | Ga0207705_10046957 | 3300025909 | Bacteria | 3104 |
| 315 | Ga0207684_10207295 | 3300025910 | Unclassified | 1691 |
| 316 | Ga0207654_10139362 | 3300025911 | Bacteria | 1545 |
| 317 | Ga0207707_10298100 | 3300025912 | Bacteria | 1394 |
| 318 | Ga0207671_10001259 | 3300025914 | Bacteria | 29868 |
| 319 | Ga0207671_10446370 | 3300025914 | Unclassified | 1030 |
| 320 | Ga0207693_10032697 | 3300025915 | Bacteria | 4105 |
| 321 | Ga0207693_10069928 | 3300025915 | Bacteria | 2747 |
| 322 | Ga0207693_10128538 | 3300025915 | Unclassified | 1992 |
| 323 | Ga0207663_10004898 | 3300025916 | Bacteria | 6701 |
| 324 | Ga0207663_10437974 | 3300025916 | Bacteria | 1006 |
| 325 | Ga0207660_10023409 | 3300025917 | Bacteria | 4171 |
| 326 | Ga0207660_10560942 | 3300025917 | Unclassified | 929 |
| 327 | Ga0207662_10048072 | 3300025918 | Bacteria | 2527 |
| 328 | Ga0207657_10004756 | 3300025919 | Bacteria | 14337 |
| 329 | Ga0207649_10000928 | 3300025920 | Bacteria | 18426 |
| 330 | Ga0207649_10293879 | 3300025920 | Bacteria | 1186 |
| 331 | Ga0207652_10003090 | 3300025921 | Bacteria | 13894 |
| 332 | Ga0207652_10014841 | 3300025921 | Bacteria | 6316 |
| 333 | Ga0207652_11109570 | 3300025921 | Unclassified | 692 |
| 334 | Ga0207646_10000472 | 3300025922 | Bacteria | 53714 |
| 335 | Ga0207646_10012427 | 3300025922 | Bacteria | 8184 |
| 336 | Ga0207646_10062627 | 3300025922 | Bacteria | 3321 |
| 337 | Ga0207646_10515249 | 3300025922 | Bacteria | 1077 |
| 338 | Ga0207646_10583534 | 3300025922 | Unclassified | 1004 |
| 339 | Ga0207681_10053608 | 3300025923 | Bacteria | 2738 |
| 340 | Ga0207694_10067452 | 3300025924 | Bacteria | 2793 |
| 341 | Ga0207694_10872371 | 3300025924 | Unclassified | 761 |
| 342 | Ga0207650_10000059 | 3300025925 | Bacteria | 151427 |
| 343 | Ga0207659_10243074 | 3300025926 | Unclassified | 1457 |
| 344 | Ga0207687_10640601 | 3300025927 | Bacteria | 898 |
| 345 | Ga0207700_10068779 | 3300025928 | Bacteria | 2715 |
| 346 | Ga0207700_10071786 | 3300025928 | Unclassified | 2667 |
| 347 | Ga0207700_10101556 | 3300025928 | Bacteria | 2295 |
| 348 | Ga0207700_10210369 | 3300025928 | Unclassified | 1644 |
| 349 | Ga0207700_10220130 | 3300025928 | Unclassified | 1609 |
| 350 | Ga0207700_10320247 | 3300025928 | Bacteria | 1344 |
| 351 | Ga0207700_10401344 | 3300025928 | Bacteria | 1201 |
| 352 | Ga0207700_11797651 | 3300025928 | Bacteria | 539 |
| 353 | Ga0207700_11928959 | 3300025928 | Bacteria | 517 |
| 354 | Ga0207664_10133959 | 3300025929 | Bacteria | 2089 |
| 355 | Ga0207664_10140748 | 3300025929 | Unclassified | 2041 |
| 356 | Ga0207664_10178774 | 3300025929 | Bacteria | 1820 |
| 357 | Ga0207664_10274962 | 3300025929 | Unclassified | 1476 |
| 358 | Ga0207664_10772203 | 3300025929 | Unclassified | 864 |
| 359 | Ga0207664_11917702 | 3300025929 | Unclassified | 515 |
| 360 | Ga0207644_10001085 | 3300025931 | Bacteria | 17449 |
| 361 | Ga0207644_10007479 | 3300025931 | Bacteria | 7125 |
| 362 | Ga0207690_10038534 | 3300025932 | Bacteria | 3111 |
| 363 | Ga0207690_11054981 | 3300025932 | Bacteria | 677 |
| 364 | Ga0207706_10006275 | 3300025933 | Bacteria | 11049 |
| 365 | Ga0207706_10926317 | 3300025933 | Unclassified | 735 |
| 366 | Ga0207686_10158528 | 3300025934 | Bacteria | 1584 |
| 367 | Ga0207686_10177888 | 3300025934 | Bacteria | 1506 |
| 368 | Ga0207686_10486985 | 3300025934 | Unclassified | 955 |
| 369 | Ga0207709_10694792 | 3300025935 | Bacteria | 813 |
| 370 | Ga0207670_10000002 | 3300025936 | Bacteria | 783058 |
| 371 | Ga0207670_10133977 | 3300025936 | Bacteria | 1819 |
| 372 | Ga0207670_10150983 | 3300025936 | Bacteria | 1724 |
| 373 | Ga0207670_11236123 | 3300025936 | Unclassified | 633 |
| 374 | Ga0207669_10154690 | 3300025937 | Bacteria | 1611 |
| 375 | Ga0207665_10001016 | 3300025939 | Bacteria | 18939 |
| 376 | Ga0207665_10016213 | 3300025939 | Unclassified | 4892 |
| 377 | Ga0207665_10070674 | 3300025939 | Bacteria | 2382 |
| 378 | Ga0207665_10432421 | 3300025939 | Unclassified | 1007 |
| 379 | Ga0207691_11215116 | 3300025940 | Unclassified | 625 |
| 380 | Ga0207711_10185744 | 3300025941 | Bacteria | 1892 |
| 381 | Ga0207711_11130779 | 3300025941 | Bacteria | 724 |
| 382 | Ga0207711_11650589 | 3300025941 | Unclassified | 584 |
| 383 | Ga0207689_10174160 | 3300025942 | Bacteria | 1774 |
| 384 | Ga0207689_11196538 | 3300025942 | Bacteria | 640 |
| 385 | Ga0207661_10000352 | 3300025944 | Bacteria | 29636 |
| 386 | Ga0207661_10601931 | 3300025944 | Bacteria | 1009 |
| 387 | Ga0207679_10000039 | 3300025945 | Bacteria | 127661 |
| 388 | Ga0207679_10017715 | 3300025945 | Bacteria | 4757 |
| 389 | Ga0207679_10037556 | 3300025945 | Bacteria | 3443 |
| 390 | Ga0207667_10128298 | 3300025949 | Bacteria | 2612 |
| 391 | Ga0207667_10222582 | 3300025949 | Bacteria | 1933 |
| 392 | Ga0207667_10491161 | 3300025949 | Bacteria | 1246 |
| 393 | Ga0207651_10003379 | 3300025960 | Bacteria | 7836 |
| 394 | Ga0207651_10712060 | 3300025960 | Bacteria | 885 |
| 395 | Ga0207712_10127027 | 3300025961 | Bacteria | 1937 |
| 396 | Ga0207712_10798208 | 3300025961 | Unclassified | 830 |
| 397 | Ga0207712_11189374 | 3300025961 | Bacteria | 680 |
| 398 | Ga0207668_10115880 | 3300025972 | Bacteria | 2019 |
| 399 | Ga0207668_11473891 | 3300025972 | Bacteria | 614 |
| 400 | Ga0207640_10171684 | 3300025981 | Bacteria | 1616 |
| 401 | Ga0207640_10913750 | 3300025981 | Bacteria | 767 |
| 402 | Ga0207658_10003811 | 3300025986 | Bacteria | 10616 |
| 403 | Ga0207677_10015370 | 3300026023 | Bacteria | 4501 |
| 404 | Ga0207677_10088616 | 3300026023 | Bacteria | 2244 |
| 405 | Ga0207703_10073189 | 3300026035 | Bacteria | 2834 |
| 406 | Ga0207703_10228835 | 3300026035 | Bacteria | 1666 |
| 407 | Ga0207703_10450601 | 3300026035 | Bacteria | 1202 |
| 408 | Ga0207703_11207706 | 3300026035 | Unclassified | 727 |
| 409 | Ga0207639_10033545 | 3300026041 | Bacteria | 3788 |
| 410 | Ga0207702_10303853 | 3300026078 | Unclassified | 1515 |
| 411 | Ga0207702_10323491 | 3300026078 | Unclassified | 1469 |
| 412 | Ga0207702_10894410 | 3300026078 | Unclassified | 880 |
| 413 | Ga0207641_10000025 | 3300026088 | Bacteria | 247727 |
| 414 | Ga0207641_10222687 | 3300026088 | Bacteria | 1750 |
| 415 | Ga0207641_10242871 | 3300026088 | Bacteria | 1679 |
| 416 | Ga0207641_10277866 | 3300026088 | Bacteria | 1574 |
| 417 | Ga0207648_10000420 | 3300026089 | Bacteria | 46606 |
| 418 | Ga0207648_10451979 | 3300026089 | Bacteria | 1170 |
| 419 | Ga0207676_10000104 | 3300026095 | Bacteria | 74872 |
| 420 | Ga0207676_10620146 | 3300026095 | Bacteria | 1041 |
| 421 | Ga0207676_10873200 | 3300026095 | Bacteria | 881 |
| 422 | Ga0207676_11031572 | 3300026095 | Bacteria | 811 |
| 423 | Ga0207674_10000604 | 3300026116 | Bacteria | 47244 |
| 424 | Ga0207674_10055162 | 3300026116 | Bacteria | 4042 |
| 425 | Ga0207674_10073650 | 3300026116 | Unclassified | 3428 |
| 426 | Ga0207674_10299159 | 3300026116 | Bacteria | 1558 |
| 427 | Ga0207674_10414924 | 3300026116 | Unclassified | 1301 |
| 428 | Ga0207675_100658481 | 3300026118 | Bacteria | 1054 |
| 429 | Ga0207675_101751709 | 3300026118 | Unclassified | 641 |
| 430 | Ga0207683_10000726 | 3300026121 | Bacteria | 29917 |
| 431 | Ga0207683_11183224 | 3300026121 | Bacteria | 709 |
| 432 | Ga0207698_10491622 | 3300026142 | Bacteria | 1192 |
| 433 | Ga0209179_1005202 | 3300027512 | Unclassified | 2020 |
| 434 | Ga0209179_1010011 | 3300027512 | Unclassified | 1641 |
| 435 | Ga0209588_1031914 | 3300027671 | Unclassified | 1686 |
| 436 | Ga0209588_1114198 | 3300027671 | Unclassified | 866 |
| 437 | Ga0268266_10004403 | 3300028379 | Bacteria | 13498 |
| 438 | Ga0268266_11426750 | 3300028379 | Bacteria | 668 |
| 439 | Ga0268265_10007199 | 3300028380 | Bacteria | 7519 |
| 440 | Ga0268264_10084179 | 3300028381 | Bacteria | 2726 |
| 441 | Ga0268264_10177350 | 3300028381 | Bacteria | 1932 |
| 442 | Ga0268264_10855655 | 3300028381 | Bacteria | 911 |
| 443 | Ga0268264_11156099 | 3300028381 | Bacteria | 783 |
| 444 | Ga0265337_1099747 | 3300028556 | Unclassified | 791 |
| 445 | Ga0265326_10073639 | 3300028558 | Bacteria | 966 |
| 446 | Ga0265318_10000442 | 3300028577 | Bacteria | 31287 |
| 447 | Ga0265338_10023680 | 3300028800 | Bacteria | 6300 |
| 448 | Ga0265775_102738 | 3300030762 | Unclassified | 925 |
| 449 | Ga0265760_10029199 | 3300031090 | Unclassified | 1621 |
| 450 | Ga0265760_10342146 | 3300031090 | Unclassified | 534 |
| 451 | Ga0265332_10369644 | 3300031238 | Unclassified | 592 |
| 452 | Ga0265320_10008116 | 3300031240 | Bacteria | 6452 |
| 453 | Ga0265325_10027884 | 3300031241 | Bacteria | 3049 |
| 454 | Ga0265329_10001439 | 3300031242 | Bacteria | 11465 |
| 455 | Ga0265340_10017289 | 3300031247 | Bacteria | 3728 |
| 456 | Ga0265339_10003070 | 3300031249 | Bacteria | 11753 |
| 457 | Ga0265331_10000360 | 3300031250 | Bacteria | 47793 |
| 458 | Ga0265327_10000008 | 3300031251 | Bacteria | 658870 |
| 459 | Ga0265327_10003326 | 3300031251 | Bacteria | 15541 |
| 460 | Ga0265327_10188426 | 3300031251 | Unclassified | 940 |
| 461 | Ga0265316_10004633 | 3300031344 | Bacteria | 13638 |
| 462 | Ga0265313_10018793 | 3300031595 | Bacteria | 3869 |
| 463 | Ga0265342_10000649 | 3300031712 | Bacteria | 36485 |
| 464 | Ga0373926_0363201 | 3300035083 | Unclassified | 569 |
| 465 | Ga0373934_0000393 | 3300035086 | Bacteria | 15250 |
| 466 | Ga0373934_0001662 | 3300035086 | Bacteria | 8160 |
| 467 | Ga0373934_0036970 | 3300035086 | Bacteria | 1923 |
| 468 | Ga0373923_0048157 | 3300035111 | Bacteria | 1779 |
| 469 | Ga0373953_0002652 | 3300035117 | Bacteria | 5423 |
| 470 | Ga0373953_0104701 | 3300035117 | Bacteria | 1193 |
| 471 | Ga0373954_0002072 | 3300035118 | Bacteria | 8328 |
| 472 | Ga0373956_0003602 | 3300035119 | Bacteria | 6251 |
| 473 | Ga0373956_0006130 | 3300035119 | Bacteria | 4808 |
| 474 | Ga0373956_0595010 | 3300035119 | Unclassified | 528 |
| 475 | Ga0373957_0039484 | 3300035120 | Unclassified | 1770 |
| 476 | Ga0373946_0550702 | 3300035171 | Bacteria | 595 |
| 477 | Ga0373955_0000064 | 3300035172 | Bacteria | 41989 |
| 478 | Ga0373955_0008806 | 3300035172 | Bacteria | 4703 |
| 479 | Ga0373955_0151360 | 3300035172 | Unclassified | 1366 |
| 480 | Ga0373924_0205936 | 3300035410 | Bacteria | 868 |
| 481 | Ga0373924_0486823 | 3300035410 | Bacteria | 554 |
| 482 | Ga0373935_0067686 | 3300035692 | Unclassified | 2297 |
| 483 | Ga0373935_0438003 | 3300035692 | Unclassified | 943 |
| 484 | Ga0373927_0365131 | 3300035695 | Bacteria | 952 |
| 485 | Ga0373933_0001374 | 3300035724 | Bacteria | 14330 |
| 486 | Ga0373933_0047005 | 3300035724 | Bacteria | 2565 |
| 487 | Ga0373933_0122456 | 3300035724 | Bacteria | 1630 |
| 488 | Ga0373933_0871632 | 3300035724 | Unclassified | 593 |
| 489 | Ga0373937_0000192 | 3300036401 | Bacteria | 60004 |
| 490 | Ga0373937_0019024 | 3300036401 | Bacteria | 6144 |
| 491 | Ga0373937_0025277 | 3300036401 | Bacteria | 5362 |
| 492 | Ga0373937_0140427 | 3300036401 | Bacteria | 2260 |
| 493 | Ga0373937_0546118 | 3300036401 | Bacteria | 1101 |
| 494 | Ga0373937_0804676 | 3300036401 | Bacteria | 888 |
| 495 | Ga0373937_1936651 | 3300036401 | Unclassified | 535 |
| 496 | Ga0265778_024805 | 3300036457 | Unclassified | 754 |
| 497 | Ga0373925_0411329 | 3300037068 | Unclassified | 1104 |
| 498 | Ga0373925_0471525 | 3300037068 | Unclassified | 1029 |
| 499 | Ga0395905_0148928 | 3300037471 | Bacteria | 2202 |
| 500 | Ga0242420_145848 | 3300038996 | Unclassified | 529 |
| 501 | Ga0436365_0020432 | 3300039437 | Unclassified | 634 |
| 502 | Ga0436365_0582251 | 3300039437 | Bacteria | 5743 |
| 503 | Ga0436365_0967462 | 3300039437 | Unclassified | 773 |
| 504 | Ga0436363_0235155 | 3300039450 | Bacteria | 1380 |
| 505 | Ga0436363_0571601 | 3300039450 | Unclassified | 1092 |
| 506 | Ga0436363_1308970 | 3300039450 | Unclassified | 569 |
| 507 | Ga0451807_0995951 | 3300041486 | Unclassified | 773 |
| 508 | Ga0451853_1121466 | 3300041512 | Bacteria | 1121 |
| 509 | Ga0439459_0236406 | 3300042438 | Bacteria | 511 |
| 510 | Ga0439464_0162436 | 3300042439 | Unclassified | 702 |
| 511 | Ga0439460_0272550 | 3300042461 | Unclassified | 588 |
| 512 | Ga0451577_0000082 | 3300042876 | Bacteria | 214418 |
| 513 | Ga0451577_0004854 | 3300042876 | Bacteria | 14026 |
| 514 | Ga0451577_0072471 | 3300042876 | Bacteria | 3073 |
| 515 | Ga0451577_1887681 | 3300042876 | Unclassified | 523 |
| 516 | Ga0453683_0063687 | 3300044673 | Bacteria | 2305 |
| 517 | Ga0453684_0001652 | 3300044712 | Bacteria | 60494 |
| 518 | Ga0453684_0030371 | 3300044712 | Bacteria | 7635 |
| 519 | Ga0453684_1558730 | 3300044712 | Bacteria | 679 |
| 520 | Ga0451576_0994484 | 3300045051 | Bacteria | 879 |
| 521 | Ga0495592_0342858 | 3300046454 | Bacteria | 960 |
| 522 | Ga0495651_0152299 | 3300046462 | Bacteria | 1665 |
| 523 | Ga0495651_0163775 | 3300046462 | Unclassified | 1591 |
| 524 | Ga0495664_0395503 | 3300046477 | Unclassified | 830 |
| 525 | Ga0495664_0884174 | 3300046477 | Bacteria | 523 |
| 526 | Ga0495594_0022843 | 3300046499 | Bacteria | 3349 |
| 527 | Ga0495608_0041262 | 3300046511 | Unclassified | 3089 |
| 528 | Ga0495618_0248377 | 3300046514 | Bacteria | 1117 |
| 529 | Ga0495628_0124228 | 3300046516 | Bacteria | 1978 |
| 530 | Ga0495642_0282888 | 3300046528 | Unclassified | 726 |
| 531 | Ga0495652_0057328 | 3300046529 | Unclassified | 3304 |
| 532 | Ga0495640_0398345 | 3300046533 | Bacteria | 845 |
| 533 | Ga0495586_0049939 | 3300046535 | Bacteria | 2262 |
| 534 | Ga0495586_0062695 | 3300046535 | Bacteria | 2024 |
| 535 | Ga0495587_0002611 | 3300046536 | Bacteria | 12038 |
| 536 | Ga0495645_0242198 | 3300046543 | Bacteria | 1203 |
| 537 | Ga0495634_0036138 | 3300046642 | Bacteria | 3380 |
| 538 | Ga0495635_0124258 | 3300046663 | Unclassified | 1760 |
| 539 | Ga0495635_0413554 | 3300046663 | Bacteria | 895 |
| 540 | Ga0495635_0493887 | 3300046663 | Bacteria | 806 |
| 541 | Ga0495599_0068632 | 3300046678 | Bacteria | 2213 |
| 542 | Ga0495623_0018612 | 3300046679 | Unclassified | 4485 |
| 543 | Ga0495623_0422217 | 3300046679 | Unclassified | 714 |
| 544 | Ga0495646_0427607 | 3300046680 | Unclassified | 686 |
| 545 | Ga0495646_0488585 | 3300046680 | Bacteria | 633 |
| 546 | Ga0495658_0281546 | 3300046683 | Bacteria | 1049 |
| 547 | Ga0495669_0391046 | 3300046684 | Unclassified | 673 |
| 548 | Ga0495613_0201033 | 3300046689 | Bacteria | 1405 |
| 549 | Ga0495624_0200484 | 3300046690 | Bacteria | 1212 |
| 550 | Ga0495600_0677132 | 3300046809 | Unclassified | 622 |
| 551 | Ga0495604_0000524 | 3300047317 | Bacteria | 33845 |
| 552 | Ga0495636_0166217 | 3300047318 | Bacteria | 996 |
| 553 | Ga0495674_0071803 | 3300047319 | Bacteria | 2987 |
| 554 | Ga0495674_0658903 | 3300047319 | Bacteria | 825 |
| 555 | Ga0495674_0700268 | 3300047319 | Unclassified | 795 |
| 556 | Ga0495680_0081659 | 3300047322 | Bacteria | 2440 |
| 557 | Ga0495680_0984067 | 3300047322 | Unclassified | 540 |
| 558 | Ga0495684_0036844 | 3300047471 | Unclassified | 3750 |
| 559 | Ga0495684_0632016 | 3300047471 | Unclassified | 718 |
| 560 | Ga0495602_0006680 | 3300048088 | Bacteria | 12088 |
| 561 | Ga0495602_0263802 | 3300048088 | Bacteria | 1276 |
| 562 | Ga0496100_0367154 | 3300048903 | Bacteria | 1090 |
| 563 | Ga0496100_1220194 | 3300048903 | Unclassified | 593 |
| 564 | Ga0496102_0015347 | 3300048905 | Bacteria | 6671 |
| 565 | Ga0496102_0063793 | 3300048905 | Bacteria | 3374 |
| 566 | Ga0496102_0184083 | 3300048905 | Bacteria | 1968 |
| 567 | Ga0496103_0089197 | 3300048906 | Bacteria | 1945 |
| 568 | Ga0496104_0140304 | 3300048907 | Bacteria | 2322 |
| 569 | Ga0496104_0230714 | 3300048907 | Bacteria | 1763 |
| 570 | Ga0496104_1875733 | 3300048907 | Unclassified | 501 |
| 571 | Ga0496105_0175126 | 3300048908 | Bacteria | 1758 |
| 572 | Ga0496106_0027732 | 3300048909 | Bacteria | 4219 |
| 573 | Ga0496106_1400236 | 3300048909 | Unclassified | 540 |
| 574 | Ga0496108_0000539 | 3300048911 | Bacteria | 29583 |
| 575 | Ga0496109_0000099 | 3300048912 | Bacteria | 89901 |
| 576 | Ga0496110_0003615 | 3300048913 | Bacteria | 11898 |
| 577 | Ga0496112_0000043 | 3300048915 | Bacteria | 87684 |
| 578 | Ga0496112_0769740 | 3300048915 | Bacteria | 888 |
| 579 | Ga0496112_1264568 | 3300048915 | Bacteria | 654 |
| 580 | Ga0496113_0000107 | 3300048916 | Bacteria | 35660 |
| 581 | Ga0496115_0103742 | 3300048918 | Bacteria | 2333 |
| 582 | Ga0496115_0721648 | 3300048918 | Unclassified | 782 |
| 583 | Ga0496115_1345453 | 3300048918 | Unclassified | 530 |
| 584 | nmdc:mga06r32_137806_c1 | 3300050510 | Bacteria | 2415 |
| 585 | nmdc:mga06r32_5055_c1 | 3300050510 | Bacteria | 11878 |
| 586 | nmdc:mga06r32_600752_c1 | 3300050510 | Bacteria | 1071 |
| 587 | nmdc:mga0n895_19616_c1 | 3300050512 | Bacteria | 6287 |
| 588 | nmdc:mga0rr50_182967_c1 | 3300050513 | Bacteria | 1714 |
| 589 | nmdc:mga0a205_1010873_c1 | 3300050515 | Bacteria | 678 |
| 590 | nmdc:mga0a205_218599_c1 | 3300050515 | Bacteria | 1792 |
| 591 | Ga0495601_0012321 | 3300053077 | Bacteria | 5129 |
| 592 | Ga0495612_0443315 | 3300053078 | Unclassified | 593 |
| 593 | Ga0495619_0020280 | 3300053085 | Bacteria | 4232 |
| 594 | Ga0495619_0242953 | 3300053085 | Unclassified | 1247 |
| 595 | Ga0500595_022033 | 3300053119 | Bacteria | 2264 |
| 596 | Ga0500595_049142 | 3300053119 | Bacteria | 1315 |
| 597 | Ga0500564_060547 | 3300053138 | Unclassified | 1718 |
| 598 | Ga0500568_0000329 | 3300053139 | Bacteria | 37308 |
| 599 | Ga0587084_101856 | 3300059477 | Bacteria | 583 |
| 600 | Ga0587093_035150 | 3300059478 | Bacteria | 738 |
| 601 | Ga0587066_055940 | 3300059490 | Unclassified | 791 |
| 602 | Ga0587073_0040966 | 3300059492 | Unclassified | 1009 |
| 603 | Ga0587073_0055836 | 3300059492 | Unclassified | 910 |
| 604 | Ga0587077_240189 | 3300059493 | Unclassified | 519 |
| 605 | Ga0587080_035738 | 3300059503 | Unclassified | 886 |
| 606 | Ga0587082_185425 | 3300059504 | Unclassified | 512 |
| 607 | Ga0587072_188475 | 3300059643 | Unclassified | 518 |
| 608 | Ga0587107_039077 | 3300059652 | Unclassified | 759 |
| 609 | Ga0587107_122548 | 3300059652 | Unclassified | 538 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005289 | Ga0065704_10200846 | Ga0065704_102008462 | 48 |
| 2 | 3300020069 | Ga0197907_10112572 | Ga0197907_101125721 | 48 |
| 3 | 3300028556 | Ga0265337_1099747 | Ga0265337_10997471 | 48 |
| 4 | 3300028558 | Ga0265326_10073639 | Ga0265326_100736391 | 48 |
| 5 | 3300031251 | Ga0265327_10000008 | Ga0265327_10000008637 | 48 |
| 6 | 3300035086 | Ga0373934_0036970 | Ga0373934_0036970_1539_1685 | 48 |
| 7 | 3300035119 | Ga0373956_0595010 | Ga0373956_0595010_236_382 | 48 |
| 8 | 3300035724 | Ga0373933_0122456 | Ga0373933_0122456_968_1114 | 48 |
| 9 | 3300036401 | Ga0373937_0025277 | Ga0373937_0025277_789_935 | 48 |
| 10 | 3300042438 | Ga0439459_0236406 | Ga0439459_0236406_37_204 | 48 |
| 11 | 3300042439 | Ga0439464_0162436 | Ga0439464_0162436_310_477 | 48 |
| 12 | 3300042461 | Ga0439460_0272550 | Ga0439460_0272550_204_350 | 48 |
| 13 | 3300046690 | Ga0495624_0200484 | Ga0495624_0200484_419_565 | 48 |
| 14 | 3300053077 | Ga0495601_0012321 | Ga0495601_0012321_811_957 | 48 |
| 15 | 3300003162 | Ga0006778J45830_1022949 | Ga0006778J45830_10229496 | 49 |
| 16 | 3300003323 | rootH1_10193375 | rootH1_101933754 | 49 |
| 17 | 3300003577 | Ga0007416J51690_1087992 | Ga0007416J51690_10879923 | 49 |
| 18 | 3300003579 | Ga0007429J51699_1057182 | Ga0007429J51699_10571824 | 49 |
| 19 | 3300003693 | Ga0032354_1015450 | Ga0032354_10154506 | 49 |
| 20 | 3300004799 | Ga0058863_11746886 | Ga0058863_117468861 | 49 |
| 21 | 3300004800 | Ga0058861_11998395 | Ga0058861_119983953 | 49 |
| 22 | 3300004801 | Ga0058860_12203405 | Ga0058860_122034051 | 49 |
| 23 | 3300004803 | Ga0058862_10124568 | Ga0058862_101245683 | 49 |
| 24 | 3300004803 | Ga0058862_12853411 | Ga0058862_128534111 | 49 |
| 25 | 3300005295 | Ga0065707_10321536 | Ga0065707_103215362 | 49 |
| 26 | 3300005327 | Ga0070658_10000422 | Ga0070658_100004227 | 49 |
| 27 | 3300005331 | Ga0070670_101942561 | Ga0070670_1019425611 | 49 |
| 28 | 3300005334 | Ga0068869_101549438 | Ga0068869_1015494382 | 49 |
| 29 | 3300005335 | Ga0070666_10886131 | Ga0070666_108861312 | 49 |
| 30 | 3300005335 | Ga0070666_11327217 | Ga0070666_113272172 | 49 |
| 31 | 3300005336 | Ga0070680_100027238 | Ga0070680_1000272381 | 49 |
| 32 | 3300005336 | Ga0070680_100288828 | Ga0070680_1002888281 | 49 |
| 33 | 3300005336 | Ga0070680_100949136 | Ga0070680_1009491361 | 49 |
| 34 | 3300005337 | Ga0070682_100073854 | Ga0070682_1000738542 | 49 |
| 35 | 3300005338 | Ga0068868_101144972 | Ga0068868_1011449722 | 49 |
| 36 | 3300005340 | Ga0070689_100000001 | Ga0070689_100000001759 | 49 |
| 37 | 3300005343 | Ga0070687_101177081 | Ga0070687_1011770811 | 49 |
| 38 | 3300005344 | Ga0070661_100601151 | Ga0070661_1006011512 | 49 |
| 39 | 3300005347 | Ga0070668_102117890 | Ga0070668_1021178902 | 49 |
| 40 | 3300005354 | Ga0070675_101979192 | Ga0070675_1019791921 | 49 |
| 41 | 3300005364 | Ga0070673_101466180 | Ga0070673_1014661802 | 49 |
| 42 | 3300005365 | Ga0070688_100106766 | Ga0070688_1001067662 | 49 |
| 43 | 3300005366 | Ga0070659_100048039 | Ga0070659_1000480394 | 49 |
| 44 | 3300005366 | Ga0070659_101343974 | Ga0070659_1013439741 | 49 |
| 45 | 3300005367 | Ga0070667_100883897 | Ga0070667_1008838971 | 49 |
| 46 | 3300005406 | Ga0070703_10289867 | Ga0070703_102898672 | 49 |
| 47 | 3300005434 | Ga0070709_10001806 | Ga0070709_100018068 | 49 |
| 48 | 3300005434 | Ga0070709_10050343 | Ga0070709_100503433 | 49 |
| 49 | 3300005434 | Ga0070709_10401362 | Ga0070709_104013622 | 49 |
| 50 | 3300005434 | Ga0070709_10409784 | Ga0070709_104097842 | 49 |
| 51 | 3300005434 | Ga0070709_11287388 | Ga0070709_112873881 | 49 |
| 52 | 3300005435 | Ga0070714_100156776 | Ga0070714_1001567763 | 49 |
| 53 | 3300005435 | Ga0070714_100178922 | Ga0070714_1001789224 | 49 |
| 54 | 3300005435 | Ga0070714_100179166 | Ga0070714_1001791664 | 49 |
| 55 | 3300005435 | Ga0070714_100207979 | Ga0070714_1002079792 | 49 |
| 56 | 3300005435 | Ga0070714_100426082 | Ga0070714_1004260822 | 49 |
| 57 | 3300005435 | Ga0070714_100896536 | Ga0070714_1008965362 | 49 |
| 58 | 3300005435 | Ga0070714_101426698 | Ga0070714_1014266982 | 49 |
| 59 | 3300005435 | Ga0070714_102419691 | Ga0070714_1024196911 | 49 |
| 60 | 3300005436 | Ga0070713_100058587 | Ga0070713_1000585872 | 49 |
| 61 | 3300005436 | Ga0070713_100089141 | Ga0070713_1000891413 | 49 |
| 62 | 3300005436 | Ga0070713_100130529 | Ga0070713_1001305293 | 49 |
| 63 | 3300005436 | Ga0070713_100358287 | Ga0070713_1003582871 | 49 |
| 64 | 3300005437 | Ga0070710_10350674 | Ga0070710_103506743 | 49 |
| 65 | 3300005437 | Ga0070710_10429847 | Ga0070710_104298472 | 49 |
| 66 | 3300005437 | Ga0070710_11347163 | Ga0070710_113471632 | 49 |
| 67 | 3300005439 | Ga0070711_100130218 | Ga0070711_1001302182 | 49 |
| 68 | 3300005439 | Ga0070711_100725570 | Ga0070711_1007255702 | 49 |
| 69 | 3300005444 | Ga0070694_101359848 | Ga0070694_1013598482 | 49 |
| 70 | 3300005445 | Ga0070708_100139421 | Ga0070708_1001394213 | 49 |
| 71 | 3300005445 | Ga0070708_100310572 | Ga0070708_1003105722 | 49 |
| 72 | 3300005455 | Ga0070663_101594605 | Ga0070663_1015946052 | 49 |
| 73 | 3300005457 | Ga0070662_101400633 | Ga0070662_1014006332 | 49 |
| 74 | 3300005458 | Ga0070681_10154669 | Ga0070681_101546697 | 49 |
| 75 | 3300005459 | Ga0068867_101544608 | Ga0068867_1015446081 | 49 |
| 76 | 3300005467 | Ga0070706_100251395 | Ga0070706_1002513952 | 49 |
| 77 | 3300005467 | Ga0070706_100494345 | Ga0070706_1004943452 | 49 |
| 78 | 3300005468 | Ga0070707_100634481 | Ga0070707_1006344811 | 49 |
| 79 | 3300005471 | Ga0070698_100000537 | Ga0070698_10000053727 | 49 |
| 80 | 3300005471 | Ga0070698_100047112 | Ga0070698_1000471123 | 49 |
| 81 | 3300005471 | Ga0070698_101914252 | Ga0070698_1019142522 | 49 |
| 82 | 3300005518 | Ga0070699_100020703 | Ga0070699_1000207032 | 49 |
| 83 | 3300005518 | Ga0070699_100030623 | Ga0070699_1000306232 | 49 |
| 84 | 3300005518 | Ga0070699_100180594 | Ga0070699_1001805942 | 49 |
| 85 | 3300005518 | Ga0070699_100519064 | Ga0070699_1005190641 | 49 |
| 86 | 3300005518 | Ga0070699_101705039 | Ga0070699_1017050392 | 49 |
| 87 | 3300005530 | Ga0070679_100005155 | Ga0070679_1000051551 | 49 |
| 88 | 3300005530 | Ga0070679_100042805 | Ga0070679_1000428055 | 49 |
| 89 | 3300005530 | Ga0070679_101679494 | Ga0070679_1016794942 | 49 |
| 90 | 3300005536 | Ga0070697_100000703 | Ga0070697_10000070322 | 49 |
| 91 | 3300005536 | Ga0070697_100976644 | Ga0070697_1009766441 | 49 |
| 92 | 3300005543 | Ga0070672_101558164 | Ga0070672_1015581642 | 49 |
| 93 | 3300005544 | Ga0070686_100210148 | Ga0070686_1002101482 | 49 |
| 94 | 3300005545 | Ga0070695_100033595 | Ga0070695_1000335952 | 49 |
| 95 | 3300005545 | Ga0070695_101543060 | Ga0070695_1015430602 | 49 |
| 96 | 3300005547 | Ga0070693_100088834 | Ga0070693_1000888343 | 49 |
| 97 | 3300005547 | Ga0070693_100135900 | Ga0070693_1001359002 | 49 |
| 98 | 3300005549 | Ga0070704_100302399 | Ga0070704_1003023992 | 49 |
| 99 | 3300005549 | Ga0070704_100329321 | Ga0070704_1003293211 | 49 |
| 100 | 3300005563 | Ga0068855_100091697 | Ga0068855_1000916977 | 49 |
| 101 | 3300005563 | Ga0068855_100399985 | Ga0068855_1003999853 | 49 |
| 102 | 3300005577 | Ga0068857_100110263 | Ga0068857_1001102632 | 49 |
| 103 | 3300005614 | Ga0068856_100200443 | Ga0068856_1002004434 | 49 |
| 104 | 3300005614 | Ga0068856_102212243 | Ga0068856_1022122431 | 49 |
| 105 | 3300005617 | Ga0068859_100440382 | Ga0068859_1004403822 | 49 |
| 106 | 3300005617 | Ga0068859_100460732 | Ga0068859_1004607323 | 49 |
| 107 | 3300005617 | Ga0068859_101959880 | Ga0068859_1019598801 | 49 |
| 108 | 3300005618 | Ga0068864_100335584 | Ga0068864_1003355843 | 49 |
| 109 | 3300005618 | Ga0068864_100658043 | Ga0068864_1006580432 | 49 |
| 110 | 3300005718 | Ga0068866_10172642 | Ga0068866_101726423 | 49 |
| 111 | 3300005718 | Ga0068866_10499885 | Ga0068866_104998852 | 49 |
| 112 | 3300005841 | Ga0068863_100102378 | Ga0068863_1001023785 | 49 |
| 113 | 3300005842 | Ga0068858_100712144 | Ga0068858_1007121442 | 49 |
| 114 | 3300005842 | Ga0068858_101303019 | Ga0068858_1013030192 | 49 |
| 115 | 3300005843 | Ga0068860_100010295 | Ga0068860_1000102953 | 49 |
| 116 | 3300005843 | Ga0068860_101966690 | Ga0068860_1019666902 | 49 |
| 117 | 3300005844 | Ga0068862_102047744 | Ga0068862_1020477442 | 49 |
| 118 | 3300006028 | Ga0070717_10561192 | Ga0070717_105611922 | 49 |
| 119 | 3300006028 | Ga0070717_11103282 | Ga0070717_111032822 | 49 |
| 120 | 3300006028 | Ga0070717_11943290 | Ga0070717_119432902 | 49 |
| 121 | 3300006163 | Ga0070715_10146549 | Ga0070715_101465492 | 49 |
| 122 | 3300006163 | Ga0070715_10148187 | Ga0070715_101481873 | 49 |
| 123 | 3300006163 | Ga0070715_10217762 | Ga0070715_102177622 | 49 |
| 124 | 3300006163 | Ga0070715_10279765 | Ga0070715_102797652 | 49 |
| 125 | 3300006163 | Ga0070715_11042564 | Ga0070715_110425642 | 49 |
| 126 | 3300006163 | Ga0070715_11044936 | Ga0070715_110449362 | 49 |
| 127 | 3300006173 | Ga0070716_100018670 | Ga0070716_1000186705 | 49 |
| 128 | 3300006173 | Ga0070716_100089826 | Ga0070716_1000898262 | 49 |
| 129 | 3300006173 | Ga0070716_100268738 | Ga0070716_1002687381 | 49 |
| 130 | 3300006173 | Ga0070716_100390950 | Ga0070716_1003909502 | 49 |
| 131 | 3300006173 | Ga0070716_100832497 | Ga0070716_1008324971 | 49 |
| 132 | 3300006173 | Ga0070716_100896508 | Ga0070716_1008965082 | 49 |
| 133 | 3300006173 | Ga0070716_101051491 | Ga0070716_1010514911 | 49 |
| 134 | 3300006173 | Ga0070716_101511068 | Ga0070716_1015110682 | 49 |
| 135 | 3300006175 | Ga0070712_100020416 | Ga0070712_1000204165 | 49 |
| 136 | 3300006175 | Ga0070712_100212006 | Ga0070712_1002120062 | 49 |
| 137 | 3300006237 | Ga0097621_100403549 | Ga0097621_1004035492 | 49 |
| 138 | 3300006237 | Ga0097621_100684051 | Ga0097621_1006840513 | 49 |
| 139 | 3300006358 | Ga0068871_100570910 | Ga0068871_1005709102 | 49 |
| 140 | 3300006358 | Ga0068871_101701341 | Ga0068871_1017013412 | 49 |
| 141 | 3300006844 | Ga0075428_100045670 | Ga0075428_1000456705 | 49 |
| 142 | 3300006844 | Ga0075428_100836555 | Ga0075428_1008365552 | 49 |
| 143 | 3300006847 | Ga0075431_100008554 | Ga0075431_10000855413 | 49 |
| 144 | 3300006847 | Ga0075431_100076057 | Ga0075431_1000760574 | 49 |
| 145 | 3300006852 | Ga0075433_11479347 | Ga0075433_114793472 | 49 |
| 146 | 3300006880 | Ga0075429_101974225 | Ga0075429_1019742252 | 49 |
| 147 | 3300006881 | Ga0068865_100863932 | Ga0068865_1008639322 | 49 |
| 148 | 3300006931 | Ga0097620_100440369 | Ga0097620_1004403693 | 49 |
| 149 | 3300006931 | Ga0097620_100460688 | Ga0097620_1004606883 | 49 |
| 150 | 3300006931 | Ga0097620_101960007 | Ga0097620_1019600071 | 49 |
| 151 | 3300007265 | Ga0099794_10009736 | Ga0099794_100097363 | 49 |
| 152 | 3300007265 | Ga0099794_10028192 | Ga0099794_100281924 | 49 |
| 153 | 3300007265 | Ga0099794_10043797 | Ga0099794_100437975 | 49 |
| 154 | 3300007788 | Ga0099795_10002146 | Ga0099795_100021465 | 49 |
| 155 | 3300009093 | Ga0105240_10005890 | Ga0105240_100058905 | 49 |
| 156 | 3300009093 | Ga0105240_10190974 | Ga0105240_101909743 | 49 |
| 157 | 3300009093 | Ga0105240_12127758 | Ga0105240_121277582 | 49 |
| 158 | 3300009098 | Ga0105245_10644121 | Ga0105245_106441212 | 49 |
| 159 | 3300009098 | Ga0105245_12093725 | Ga0105245_120937252 | 49 |
| 160 | 3300009101 | Ga0105247_10429959 | Ga0105247_104299592 | 49 |
| 161 | 3300009176 | Ga0105242_10067596 | Ga0105242_100675962 | 49 |
| 162 | 3300009176 | Ga0105242_13162552 | Ga0105242_131625521 | 49 |
| 163 | 3300009177 | Ga0105248_10088095 | Ga0105248_100880956 | 49 |
| 164 | 3300009545 | Ga0105237_10000151 | Ga0105237_1000015166 | 49 |
| 165 | 3300009553 | Ga0105249_10953292 | Ga0105249_109532923 | 49 |
| 166 | 3300010159 | Ga0099796_10091027 | Ga0099796_100910273 | 49 |
| 167 | 3300010159 | Ga0099796_10142282 | Ga0099796_101422822 | 49 |
| 168 | 3300010159 | Ga0099796_10282840 | Ga0099796_102828402 | 49 |
| 169 | 3300010375 | Ga0105239_10082436 | Ga0105239_100824364 | 49 |
| 170 | 3300010375 | Ga0105239_10115727 | Ga0105239_101157271 | 49 |
| 171 | 3300010375 | Ga0105239_10413795 | Ga0105239_104137952 | 49 |
| 172 | 3300010375 | Ga0105239_11868604 | Ga0105239_118686042 | 49 |
| 173 | 3300011119 | Ga0105246_11469724 | Ga0105246_114697242 | 49 |
| 174 | 3300011119 | Ga0105246_11980337 | Ga0105246_119803371 | 49 |
| 175 | 3300013104 | Ga0157370_10119841 | Ga0157370_101198414 | 49 |
| 176 | 3300013105 | Ga0157369_11793261 | Ga0157369_117932611 | 49 |
| 177 | 3300013297 | Ga0157378_10000185 | Ga0157378_1000018528 | 49 |
| 178 | 3300013297 | Ga0157378_10468101 | Ga0157378_104681012 | 49 |
| 179 | 3300013306 | Ga0163162_10005281 | Ga0163162_100052815 | 49 |
| 180 | 3300013306 | Ga0163162_11740584 | Ga0163162_117405842 | 49 |
| 181 | 3300013306 | Ga0163162_11951614 | Ga0163162_119516142 | 49 |
| 182 | 3300013307 | Ga0157372_10128756 | Ga0157372_101287563 | 49 |
| 183 | 3300013307 | Ga0157372_11693659 | Ga0157372_116936592 | 49 |
| 184 | 3300013307 | Ga0157372_11986590 | Ga0157372_119865902 | 49 |
| 185 | 3300013308 | Ga0157375_10404946 | Ga0157375_104049463 | 49 |
| 186 | 3300013308 | Ga0157375_12874836 | Ga0157375_128748361 | 49 |
| 187 | 3300014325 | Ga0163163_10481664 | Ga0163163_104816643 | 49 |
| 188 | 3300014325 | Ga0163163_11079938 | Ga0163163_110799382 | 49 |
| 189 | 3300014326 | Ga0157380_10618256 | Ga0157380_106182562 | 49 |
| 190 | 3300014745 | Ga0157377_10398796 | Ga0157377_103987963 | 49 |
| 191 | 3300014968 | Ga0157379_10219183 | Ga0157379_102191833 | 49 |
| 192 | 3300014968 | Ga0157379_10511829 | Ga0157379_105118293 | 49 |
| 193 | 3300014968 | Ga0157379_10960857 | Ga0157379_109608572 | 49 |
| 194 | 3300014969 | Ga0157376_10879038 | Ga0157376_108790381 | 49 |
| 195 | 3300015265 | Ga0182005_1206618 | Ga0182005_12066181 | 49 |
| 196 | 3300020070 | Ga0206356_11546949 | Ga0206356_115469493 | 49 |
| 197 | 3300020075 | Ga0206349_1447815 | Ga0206349_14478153 | 49 |
| 198 | 3300020078 | Ga0206352_10155209 | Ga0206352_101552091 | 49 |
| 199 | 3300020078 | Ga0206352_11013089 | Ga0206352_110130895 | 49 |
| 200 | 3300021384 | Ga0213876_10520575 | Ga0213876_105205752 | 49 |
| 201 | 3300021384 | Ga0213876_10733762 | Ga0213876_107337621 | 49 |
| 202 | 3300025898 | Ga0207692_10953786 | Ga0207692_109537862 | 49 |
| 203 | 3300025899 | Ga0207642_10163481 | Ga0207642_101634813 | 49 |
| 204 | 3300025899 | Ga0207642_10763334 | Ga0207642_107633342 | 49 |
| 205 | 3300025905 | Ga0207685_10035766 | Ga0207685_100357662 | 49 |
| 206 | 3300025905 | Ga0207685_10621967 | Ga0207685_106219671 | 49 |
| 207 | 3300025905 | Ga0207685_10704095 | Ga0207685_107040952 | 49 |
| 208 | 3300025905 | Ga0207685_10813302 | Ga0207685_108133022 | 49 |
| 209 | 3300025906 | Ga0207699_10001019 | Ga0207699_1000101913 | 49 |
| 210 | 3300025906 | Ga0207699_10355094 | Ga0207699_103550943 | 49 |
| 211 | 3300025906 | Ga0207699_10527595 | Ga0207699_105275952 | 49 |
| 212 | 3300025906 | Ga0207699_11351708 | Ga0207699_113517081 | 49 |
| 213 | 3300025909 | Ga0207705_10046957 | Ga0207705_100469573 | 49 |
| 214 | 3300025910 | Ga0207684_10207295 | Ga0207684_102072953 | 49 |
| 215 | 3300025912 | Ga0207707_10298100 | Ga0207707_102981001 | 49 |
| 216 | 3300025914 | Ga0207671_10001259 | Ga0207671_1000125912 | 49 |
| 217 | 3300025914 | Ga0207671_10446370 | Ga0207671_104463702 | 49 |
| 218 | 3300025915 | Ga0207693_10032697 | Ga0207693_100326974 | 49 |
| 219 | 3300025915 | Ga0207693_10069928 | Ga0207693_100699283 | 49 |
| 220 | 3300025915 | Ga0207693_10128538 | Ga0207693_101285381 | 49 |
| 221 | 3300025916 | Ga0207663_10437974 | Ga0207663_104379742 | 49 |
| 222 | 3300025917 | Ga0207660_10023409 | Ga0207660_100234091 | 49 |
| 223 | 3300025921 | Ga0207652_10003090 | Ga0207652_100030905 | 49 |
| 224 | 3300025921 | Ga0207652_10014841 | Ga0207652_100148417 | 49 |
| 225 | 3300025922 | Ga0207646_10000472 | Ga0207646_1000047227 | 49 |
| 226 | 3300025922 | Ga0207646_10012427 | Ga0207646_100124275 | 49 |
| 227 | 3300025922 | Ga0207646_10062627 | Ga0207646_100626272 | 49 |
| 228 | 3300025922 | Ga0207646_10515249 | Ga0207646_105152492 | 49 |
| 229 | 3300025922 | Ga0207646_10583534 | Ga0207646_105835342 | 49 |
| 230 | 3300025924 | Ga0207694_10872371 | Ga0207694_108723711 | 49 |
| 231 | 3300025927 | Ga0207687_10640601 | Ga0207687_106406011 | 49 |
| 232 | 3300025928 | Ga0207700_10068779 | Ga0207700_100687794 | 49 |
| 233 | 3300025928 | Ga0207700_10071786 | Ga0207700_100717863 | 49 |
| 234 | 3300025928 | Ga0207700_10101556 | Ga0207700_101015561 | 49 |
| 235 | 3300025928 | Ga0207700_10210369 | Ga0207700_102103692 | 49 |
| 236 | 3300025928 | Ga0207700_10320247 | Ga0207700_103202472 | 49 |
| 237 | 3300025928 | Ga0207700_10401344 | Ga0207700_104013441 | 49 |
| 238 | 3300025928 | Ga0207700_11797651 | Ga0207700_117976512 | 49 |
| 239 | 3300025928 | Ga0207700_11928959 | Ga0207700_119289591 | 49 |
| 240 | 3300025929 | Ga0207664_10133959 | Ga0207664_101339592 | 49 |
| 241 | 3300025929 | Ga0207664_10140748 | Ga0207664_101407484 | 49 |
| 242 | 3300025929 | Ga0207664_10178774 | Ga0207664_101787741 | 49 |
| 243 | 3300025929 | Ga0207664_10274962 | Ga0207664_102749622 | 49 |
| 244 | 3300025929 | Ga0207664_11917702 | Ga0207664_119177021 | 49 |
| 245 | 3300025932 | Ga0207690_11054981 | Ga0207690_110549812 | 49 |
| 246 | 3300025933 | Ga0207706_10926317 | Ga0207706_109263172 | 49 |
| 247 | 3300025934 | Ga0207686_10158528 | Ga0207686_101585282 | 49 |
| 248 | 3300025934 | Ga0207686_10486985 | Ga0207686_104869852 | 49 |
| 249 | 3300025936 | Ga0207670_10000002 | Ga0207670_10000002655 | 49 |
| 250 | 3300025936 | Ga0207670_11236123 | Ga0207670_112361232 | 49 |
| 251 | 3300025939 | Ga0207665_10001016 | Ga0207665_1000101610 | 49 |
| 252 | 3300025939 | Ga0207665_10016213 | Ga0207665_100162138 | 49 |
| 253 | 3300025939 | Ga0207665_10070674 | Ga0207665_100706742 | 49 |
| 254 | 3300025939 | Ga0207665_10432421 | Ga0207665_104324212 | 49 |
| 255 | 3300025940 | Ga0207691_11215116 | Ga0207691_112151162 | 49 |
| 256 | 3300025941 | Ga0207711_11130779 | Ga0207711_111307792 | 49 |
| 257 | 3300025941 | Ga0207711_11650589 | Ga0207711_116505891 | 49 |
| 258 | 3300025942 | Ga0207689_11196538 | Ga0207689_111965382 | 49 |
| 259 | 3300025949 | Ga0207667_10128298 | Ga0207667_101282984 | 49 |
| 260 | 3300025949 | Ga0207667_10491161 | Ga0207667_104911612 | 49 |
| 261 | 3300025960 | Ga0207651_10712060 | Ga0207651_107120602 | 49 |
| 262 | 3300025972 | Ga0207668_11473891 | Ga0207668_114738912 | 49 |
| 263 | 3300025981 | Ga0207640_10913750 | Ga0207640_109137502 | 49 |
| 264 | 3300026035 | Ga0207703_10228835 | Ga0207703_102288352 | 49 |
| 265 | 3300026035 | Ga0207703_10450601 | Ga0207703_104506011 | 49 |
| 266 | 3300026035 | Ga0207703_11207706 | Ga0207703_112077062 | 49 |
| 267 | 3300026078 | Ga0207702_10303853 | Ga0207702_103038533 | 49 |
| 268 | 3300026078 | Ga0207702_10894410 | Ga0207702_108944103 | 49 |
| 269 | 3300026088 | Ga0207641_10242871 | Ga0207641_102428713 | 49 |
| 270 | 3300026089 | Ga0207648_10451979 | Ga0207648_104519792 | 49 |
| 271 | 3300026095 | Ga0207676_10620146 | Ga0207676_106201462 | 49 |
| 272 | 3300026095 | Ga0207676_10873200 | Ga0207676_108732002 | 49 |
| 273 | 3300026116 | Ga0207674_10055162 | Ga0207674_100551628 | 49 |
| 274 | 3300026116 | Ga0207674_10073650 | Ga0207674_100736502 | 49 |
| 275 | 3300026116 | Ga0207674_10299159 | Ga0207674_102991592 | 49 |
| 276 | 3300026118 | Ga0207675_101751709 | Ga0207675_1017517092 | 49 |
| 277 | 3300026121 | Ga0207683_11183224 | Ga0207683_111832242 | 49 |
| 278 | 3300027512 | Ga0209179_1005202 | Ga0209179_10052022 | 49 |
| 279 | 3300027512 | Ga0209179_1010011 | Ga0209179_10100113 | 49 |
| 280 | 3300027671 | Ga0209588_1031914 | Ga0209588_10319144 | 49 |
| 281 | 3300027671 | Ga0209588_1114198 | Ga0209588_11141984 | 49 |
| 282 | 3300028381 | Ga0268264_10084179 | Ga0268264_100841793 | 49 |
| 283 | 3300028381 | Ga0268264_10855655 | Ga0268264_108556552 | 49 |
| 284 | 3300028381 | Ga0268264_11156099 | Ga0268264_111560992 | 49 |
| 285 | 3300030762 | Ga0265775_102738 | Ga0265775_1027382 | 49 |
| 286 | 3300031251 | Ga0265327_10003326 | Ga0265327_100033269 | 49 |
| 287 | 3300031251 | Ga0265327_10188426 | Ga0265327_101884262 | 49 |
| 288 | 3300035083 | Ga0373926_0363201 | Ga0373926_0363201_264_419 | 49 |
| 289 | 3300035086 | Ga0373934_0000393 | Ga0373934_0000393_13158_13307 | 49 |
| 290 | 3300035111 | Ga0373923_0048157 | Ga0373923_0048157_889_1038 | 49 |
| 291 | 3300035117 | Ga0373953_0104701 | Ga0373953_0104701_759_908 | 49 |
| 292 | 3300035119 | Ga0373956_0006130 | Ga0373956_0006130_1376_1525 | 49 |
| 293 | 3300035171 | Ga0373946_0550702 | Ga0373946_0550702_33_182 | 49 |
| 294 | 3300035172 | Ga0373955_0008806 | Ga0373955_0008806_4161_4310 | 49 |
| 295 | 3300035172 | Ga0373955_0151360 | Ga0373955_0151360_1020_1169 | 49 |
| 296 | 3300035410 | Ga0373924_0205936 | Ga0373924_0205936_436_585 | 49 |
| 297 | 3300035410 | Ga0373924_0486823 | Ga0373924_0486823_51_200 | 49 |
| 298 | 3300035692 | Ga0373935_0067686 | Ga0373935_0067686_1932_2081 | 49 |
| 299 | 3300035692 | Ga0373935_0438003 | Ga0373935_0438003_781_930 | 49 |
| 300 | 3300035695 | Ga0373927_0365131 | Ga0373927_0365131_105_254 | 49 |
| 301 | 3300035724 | Ga0373933_0047005 | Ga0373933_0047005_598_747 | 49 |
| 302 | 3300035724 | Ga0373933_0871632 | Ga0373933_0871632_282_431 | 49 |
| 303 | 3300036401 | Ga0373937_0000192 | Ga0373937_0000192_6543_6692 | 49 |
| 304 | 3300036401 | Ga0373937_0140427 | Ga0373937_0140427_1651_1800 | 49 |
| 305 | 3300036401 | Ga0373937_0804676 | Ga0373937_0804676_436_585 | 49 |
| 306 | 3300036457 | Ga0265778_024805 | Ga0265778_024805_62_217 | 49 |
| 307 | 3300037068 | Ga0373925_0411329 | Ga0373925_0411329_870_1019 | 49 |
| 308 | 3300037068 | Ga0373925_0471525 | Ga0373925_0471525_621_776 | 49 |
| 309 | 3300037471 | Ga0395905_0148928 | Ga0395905_0148928_1847_1996 | 49 |
| 310 | 3300039437 | Ga0436365_0020432 | Ga0436365_0020432_262_417 | 49 |
| 311 | 3300039437 | Ga0436365_0582251 | Ga0436365_0582251_2936_3091 | 49 |
| 312 | 3300039437 | Ga0436365_0967462 | Ga0436365_0967462_74_229 | 49 |
| 313 | 3300039450 | Ga0436363_1308970 | Ga0436363_1308970_220_369 | 49 |
| 314 | 3300041486 | Ga0451807_0995951 | Ga0451807_0995951_236_385 | 49 |
| 315 | 3300041512 | Ga0451853_1121466 | Ga0451853_1121466_763_912 | 49 |
| 316 | 3300042876 | Ga0451577_0000082 | Ga0451577_0000082_138889_139038 | 49 |
| 317 | 3300042876 | Ga0451577_0004854 | Ga0451577_0004854_9915_10064 | 49 |
| 318 | 3300042876 | Ga0451577_0072471 | Ga0451577_0072471_654_803 | 49 |
| 319 | 3300042876 | Ga0451577_1887681 | Ga0451577_1887681_96_245 | 49 |
| 320 | 3300044673 | Ga0453683_0063687 | Ga0453683_0063687_169_318 | 49 |
| 321 | 3300044712 | Ga0453684_0001652 | Ga0453684_0001652_25396_25545 | 49 |
| 322 | 3300044712 | Ga0453684_0030371 | Ga0453684_0030371_3346_3495 | 49 |
| 323 | 3300044712 | Ga0453684_1558730 | Ga0453684_1558730_387_536 | 49 |
| 324 | 3300045051 | Ga0451576_0994484 | Ga0451576_0994484_302_457 | 49 |
| 325 | 3300046454 | Ga0495592_0342858 | Ga0495592_0342858_408_557 | 49 |
| 326 | 3300046462 | Ga0495651_0152299 | Ga0495651_0152299_915_1064 | 49 |
| 327 | 3300046477 | Ga0495664_0395503 | Ga0495664_0395503_466_621 | 49 |
| 328 | 3300046514 | Ga0495618_0248377 | Ga0495618_0248377_624_773 | 49 |
| 329 | 3300046516 | Ga0495628_0124228 | Ga0495628_0124228_779_928 | 49 |
| 330 | 3300046535 | Ga0495586_0049939 | Ga0495586_0049939_1732_1881 | 49 |
| 331 | 3300046543 | Ga0495645_0242198 | Ga0495645_0242198_884_1033 | 49 |
| 332 | 3300046663 | Ga0495635_0413554 | Ga0495635_0413554_62_211 | 49 |
| 333 | 3300046678 | Ga0495599_0068632 | Ga0495599_0068632_52_201 | 49 |
| 334 | 3300046679 | Ga0495623_0422217 | Ga0495623_0422217_252_407 | 49 |
| 335 | 3300046680 | Ga0495646_0427607 | Ga0495646_0427607_363_518 | 49 |
| 336 | 3300046680 | Ga0495646_0488585 | Ga0495646_0488585_348_497 | 49 |
| 337 | 3300046809 | Ga0495600_0677132 | Ga0495600_0677132_173_322 | 49 |
| 338 | 3300047319 | Ga0495674_0071803 | Ga0495674_0071803_15_164 | 49 |
| 339 | 3300047322 | Ga0495680_0081659 | Ga0495680_0081659_2008_2157 | 49 |
| 340 | 3300047471 | Ga0495684_0632016 | Ga0495684_0632016_316_471 | 49 |
| 341 | 3300048088 | Ga0495602_0263802 | Ga0495602_0263802_999_1154 | 49 |
| 342 | 3300048903 | Ga0496100_1220194 | Ga0496100_1220194_62_217 | 49 |
| 343 | 3300048905 | Ga0496102_0015347 | Ga0496102_0015347_6339_6494 | 49 |
| 344 | 3300048906 | Ga0496103_0089197 | Ga0496103_0089197_1002_1157 | 49 |
| 345 | 3300048907 | Ga0496104_0140304 | Ga0496104_0140304_1683_1838 | 49 |
| 346 | 3300048907 | Ga0496104_0230714 | Ga0496104_0230714_735_884 | 49 |
| 347 | 3300048907 | Ga0496104_1875733 | Ga0496104_1875733_335_484 | 49 |
| 348 | 3300048909 | Ga0496106_0027732 | Ga0496106_0027732_571_726 | 49 |
| 349 | 3300048915 | Ga0496112_1264568 | Ga0496112_1264568_95_250 | 49 |
| 350 | 3300048918 | Ga0496115_0721648 | Ga0496115_0721648_585_740 | 49 |
| 351 | 3300048918 | Ga0496115_1345453 | Ga0496115_1345453_180_329 | 49 |
| 352 | 3300050510 | nmdc:mga06r32_137806_c1 | nmdc:mga06r32_137806_c1_1675_1824 | 49 |
| 353 | 3300050510 | nmdc:mga06r32_5055_c1 | nmdc:mga06r32_5055_c1_9243_9392 | 49 |
| 354 | 3300050510 | nmdc:mga06r32_600752_c1 | nmdc:mga06r32_600752_c1_338_487 | 49 |
| 355 | 3300050515 | nmdc:mga0a205_1010873_c1 | nmdc:mga0a205_1010873_c1_364_519 | 49 |
| 356 | 3300053078 | Ga0495612_0443315 | Ga0495612_0443315_17_166 | 49 |
| 357 | 3300053085 | Ga0495619_0020280 | Ga0495619_0020280_2226_2381 | 49 |
| 358 | 3300053119 | Ga0500595_022033 | Ga0500595_022033_1224_1373 | 49 |
| 359 | 3300053119 | Ga0500595_049142 | Ga0500595_049142_433_582 | 49 |
| 360 | 3300053138 | Ga0500564_060547 | Ga0500564_060547_53_202 | 49 |
| 361 | 3300053139 | Ga0500568_0000329 | Ga0500568_0000329_7679_7828 | 49 |
| 362 | 3300059490 | Ga0587066_055940 | Ga0587066_055940_547_702 | 49 |
| 363 | 3300059492 | Ga0587073_0040966 | Ga0587073_0040966_680_835 | 49 |
| 364 | 3300059492 | Ga0587073_0055836 | Ga0587073_0055836_246_401 | 49 |
| 365 | 3300059493 | Ga0587077_240189 | Ga0587077_240189_256_411 | 49 |
| 366 | 3300059503 | Ga0587080_035738 | Ga0587080_035738_557_712 | 49 |
| 367 | 3300059504 | Ga0587082_185425 | Ga0587082_185425_279_434 | 49 |
| 368 | 3300059643 | Ga0587072_188475 | Ga0587072_188475_186_341 | 49 |
| 369 | 3300059652 | Ga0587107_039077 | Ga0587107_039077_48_203 | 49 |
| 370 | 3300059652 | Ga0587107_122548 | Ga0587107_122548_92_247 | 49 |
| 371 | 3300001976 | JGI24752J21851_1003164 | JGI24752J21851_10031642 | 50 |
| 372 | 3300001991 | JGI24743J22301_10005886 | JGI24743J22301_100058863 | 50 |
| 373 | 3300002073 | JGI24745J21846_1016410 | JGI24745J21846_10164101 | 50 |
| 374 | 3300002074 | JGI24748J21848_1011022 | JGI24748J21848_10110222 | 50 |
| 375 | 3300002239 | JGI24034J26672_10045692 | JGI24034J26672_100456922 | 50 |
| 376 | 3300002459 | JGI24751J29686_10001680 | JGI24751J29686_100016803 | 50 |
| 377 | 3300005290 | Ga0065712_10370906 | Ga0065712_103709062 | 50 |
| 378 | 3300005295 | Ga0065707_10320550 | Ga0065707_103205502 | 50 |
| 379 | 3300005329 | Ga0070683_100007493 | Ga0070683_1000074938 | 50 |
| 380 | 3300005329 | Ga0070683_100735285 | Ga0070683_1007352852 | 50 |
| 381 | 3300005330 | Ga0070690_100600720 | Ga0070690_1006007202 | 50 |
| 382 | 3300005334 | Ga0068869_100155933 | Ga0068869_1001559332 | 50 |
| 383 | 3300005337 | Ga0070682_100038123 | Ga0070682_1000381233 | 50 |
| 384 | 3300005338 | Ga0068868_100012529 | Ga0068868_1000125293 | 50 |
| 385 | 3300005338 | Ga0068868_100013166 | Ga0068868_1000131664 | 50 |
| 386 | 3300005339 | Ga0070660_100059277 | Ga0070660_1000592772 | 50 |
| 387 | 3300005339 | Ga0070660_100517788 | Ga0070660_1005177882 | 50 |
| 388 | 3300005340 | Ga0070689_100053569 | Ga0070689_1000535693 | 50 |
| 389 | 3300005340 | Ga0070689_100302276 | Ga0070689_1003022763 | 50 |
| 390 | 3300005344 | Ga0070661_100003544 | Ga0070661_1000035443 | 50 |
| 391 | 3300005344 | Ga0070661_100856807 | Ga0070661_1008568072 | 50 |
| 392 | 3300005353 | Ga0070669_100644003 | Ga0070669_1006440032 | 50 |
| 393 | 3300005356 | Ga0070674_100001002 | Ga0070674_1000010028 | 50 |
| 394 | 3300005364 | Ga0070673_100371481 | Ga0070673_1003714811 | 50 |
| 395 | 3300005365 | Ga0070688_100405382 | Ga0070688_1004053823 | 50 |
| 396 | 3300005366 | Ga0070659_100012377 | Ga0070659_1000123771 | 50 |
| 397 | 3300005367 | Ga0070667_100059176 | Ga0070667_1000591762 | 50 |
| 398 | 3300005434 | Ga0070709_11239556 | Ga0070709_112395562 | 50 |
| 399 | 3300005435 | Ga0070714_100684197 | Ga0070714_1006841973 | 50 |
| 400 | 3300005436 | Ga0070713_100031741 | Ga0070713_1000317414 | 50 |
| 401 | 3300005437 | Ga0070710_10388641 | Ga0070710_103886411 | 50 |
| 402 | 3300005439 | Ga0070711_100025034 | Ga0070711_1000250345 | 50 |
| 403 | 3300005444 | Ga0070694_101201610 | Ga0070694_1012016101 | 50 |
| 404 | 3300005457 | Ga0070662_100021878 | Ga0070662_1000218786 | 50 |
| 405 | 3300005466 | Ga0070685_10004460 | Ga0070685_100044603 | 50 |
| 406 | 3300005471 | Ga0070698_100052145 | Ga0070698_1000521452 | 50 |
| 407 | 3300005535 | Ga0070684_101107426 | Ga0070684_1011074262 | 50 |
| 408 | 3300005539 | Ga0068853_100022607 | Ga0068853_1000226073 | 50 |
| 409 | 3300005543 | Ga0070672_100127165 | Ga0070672_1001271653 | 50 |
| 410 | 3300005544 | Ga0070686_101784613 | Ga0070686_1017846132 | 50 |
| 411 | 3300005547 | Ga0070693_100563738 | Ga0070693_1005637381 | 50 |
| 412 | 3300005548 | Ga0070665_101399567 | Ga0070665_1013995671 | 50 |
| 413 | 3300005548 | Ga0070665_101834399 | Ga0070665_1018343991 | 50 |
| 414 | 3300005549 | Ga0070704_101902433 | Ga0070704_1019024332 | 50 |
| 415 | 3300005563 | Ga0068855_100190636 | Ga0068855_1001906361 | 50 |
| 416 | 3300005564 | Ga0070664_100047275 | Ga0070664_1000472752 | 50 |
| 417 | 3300005564 | Ga0070664_100064395 | Ga0070664_1000643952 | 50 |
| 418 | 3300005577 | Ga0068857_100004945 | Ga0068857_10000494511 | 50 |
| 419 | 3300005578 | Ga0068854_100189527 | Ga0068854_1001895273 | 50 |
| 420 | 3300005614 | Ga0068856_100006884 | Ga0068856_10000688410 | 50 |
| 421 | 3300005615 | Ga0070702_100042825 | Ga0070702_1000428252 | 50 |
| 422 | 3300005616 | Ga0068852_100033192 | Ga0068852_1000331922 | 50 |
| 423 | 3300005618 | Ga0068864_100019656 | Ga0068864_1000196567 | 50 |
| 424 | 3300005618 | Ga0068864_100218377 | Ga0068864_1002183773 | 50 |
| 425 | 3300005718 | Ga0068866_10008281 | Ga0068866_100082812 | 50 |
| 426 | 3300005719 | Ga0068861_100597042 | Ga0068861_1005970422 | 50 |
| 427 | 3300005719 | Ga0068861_101631807 | Ga0068861_1016318071 | 50 |
| 428 | 3300005834 | Ga0068851_10001293 | Ga0068851_100012933 | 50 |
| 429 | 3300005840 | Ga0068870_10003151 | Ga0068870_100031516 | 50 |
| 430 | 3300005841 | Ga0068863_100042710 | Ga0068863_1000427101 | 50 |
| 431 | 3300005841 | Ga0068863_100190082 | Ga0068863_1001900823 | 50 |
| 432 | 3300005842 | Ga0068858_100067306 | Ga0068858_1000673063 | 50 |
| 433 | 3300005843 | Ga0068860_100028673 | Ga0068860_1000286733 | 50 |
| 434 | 3300005844 | Ga0068862_100019961 | Ga0068862_1000199612 | 50 |
| 435 | 3300006028 | Ga0070717_10209605 | Ga0070717_102096053 | 50 |
| 436 | 3300006163 | Ga0070715_10904658 | Ga0070715_109046582 | 50 |
| 437 | 3300006175 | Ga0070712_100399485 | Ga0070712_1003994853 | 50 |
| 438 | 3300006237 | Ga0097621_100206182 | Ga0097621_1002061821 | 50 |
| 439 | 3300006881 | Ga0068865_100162324 | Ga0068865_1001623241 | 50 |
| 440 | 3300006881 | Ga0068865_100448212 | Ga0068865_1004482122 | 50 |
| 441 | 3300009011 | Ga0105251_10036448 | Ga0105251_100364483 | 50 |
| 442 | 3300009094 | Ga0111539_10792091 | Ga0111539_107920912 | 50 |
| 443 | 3300009098 | Ga0105245_10040249 | Ga0105245_100402492 | 50 |
| 444 | 3300009101 | Ga0105247_10002094 | Ga0105247_100020943 | 50 |
| 445 | 3300009148 | Ga0105243_10929491 | Ga0105243_109294911 | 50 |
| 446 | 3300009174 | Ga0105241_10009943 | Ga0105241_100099432 | 50 |
| 447 | 3300009176 | Ga0105242_10137668 | Ga0105242_101376683 | 50 |
| 448 | 3300009545 | Ga0105237_10804750 | Ga0105237_108047501 | 50 |
| 449 | 3300009545 | Ga0105237_11840103 | Ga0105237_118401031 | 50 |
| 450 | 3300009551 | Ga0105238_10105703 | Ga0105238_101057032 | 50 |
| 451 | 3300009551 | Ga0105238_13072471 | Ga0105238_130724711 | 50 |
| 452 | 3300009553 | Ga0105249_10140893 | Ga0105249_101408933 | 50 |
| 453 | 3300009553 | Ga0105249_13150424 | Ga0105249_131504242 | 50 |
| 454 | 3300009553 | Ga0105249_13368626 | Ga0105249_133686262 | 50 |
| 455 | 3300010375 | Ga0105239_10012012 | Ga0105239_100120121 | 50 |
| 456 | 3300010375 | Ga0105239_12424988 | Ga0105239_124249881 | 50 |
| 457 | 3300011119 | Ga0105246_10612286 | Ga0105246_106122862 | 50 |
| 458 | 3300011119 | Ga0105246_12517096 | Ga0105246_125170962 | 50 |
| 459 | 3300013100 | Ga0157373_10032674 | Ga0157373_100326741 | 50 |
| 460 | 3300013105 | Ga0157369_10008874 | Ga0157369_100088743 | 50 |
| 461 | 3300013296 | Ga0157374_10108758 | Ga0157374_101087582 | 50 |
| 462 | 3300013297 | Ga0157378_10962918 | Ga0157378_109629181 | 50 |
| 463 | 3300013306 | Ga0163162_10024158 | Ga0163162_100241583 | 50 |
| 464 | 3300013307 | Ga0157372_10009715 | Ga0157372_100097158 | 50 |
| 465 | 3300014325 | Ga0163163_10018915 | Ga0163163_100189157 | 50 |
| 466 | 3300014325 | Ga0163163_10565885 | Ga0163163_105658852 | 50 |
| 467 | 3300014326 | Ga0157380_10389989 | Ga0157380_103899891 | 50 |
| 468 | 3300014745 | Ga0157377_10026235 | Ga0157377_100262352 | 50 |
| 469 | 3300014969 | Ga0157376_10123068 | Ga0157376_101230683 | 50 |
| 470 | 3300014969 | Ga0157376_12127974 | Ga0157376_121279741 | 50 |
| 471 | 3300014969 | Ga0157376_12591463 | Ga0157376_125914631 | 50 |
| 472 | 3300017792 | Ga0163161_10093744 | Ga0163161_100937442 | 50 |
| 473 | 3300025315 | Ga0207697_10000518 | Ga0207697_100005186 | 50 |
| 474 | 3300025321 | Ga0207656_10117860 | Ga0207656_101178602 | 50 |
| 475 | 3300025893 | Ga0207682_10018953 | Ga0207682_100189533 | 50 |
| 476 | 3300025899 | Ga0207642_10004682 | Ga0207642_100046826 | 50 |
| 477 | 3300025901 | Ga0207688_10017554 | Ga0207688_100175543 | 50 |
| 478 | 3300025903 | Ga0207680_10197707 | Ga0207680_101977072 | 50 |
| 479 | 3300025904 | Ga0207647_10026399 | Ga0207647_100263993 | 50 |
| 480 | 3300025906 | Ga0207699_11045604 | Ga0207699_110456041 | 50 |
| 481 | 3300025907 | Ga0207645_10000351 | Ga0207645_1000035115 | 50 |
| 482 | 3300025908 | Ga0207643_10001192 | Ga0207643_100011925 | 50 |
| 483 | 3300025909 | Ga0207705_10020482 | Ga0207705_100204822 | 50 |
| 484 | 3300025911 | Ga0207654_10139362 | Ga0207654_101393622 | 50 |
| 485 | 3300025916 | Ga0207663_10004898 | Ga0207663_100048988 | 50 |
| 486 | 3300025917 | Ga0207660_10560942 | Ga0207660_105609421 | 50 |
| 487 | 3300025918 | Ga0207662_10048072 | Ga0207662_100480723 | 50 |
| 488 | 3300025919 | Ga0207657_10004756 | Ga0207657_100047567 | 50 |
| 489 | 3300025920 | Ga0207649_10000928 | Ga0207649_100009285 | 50 |
| 490 | 3300025920 | Ga0207649_10293879 | Ga0207649_102938792 | 50 |
| 491 | 3300025921 | Ga0207652_11109570 | Ga0207652_111095702 | 50 |
| 492 | 3300025923 | Ga0207681_10053608 | Ga0207681_100536081 | 50 |
| 493 | 3300025924 | Ga0207694_10067452 | Ga0207694_100674522 | 50 |
| 494 | 3300025925 | Ga0207650_10000059 | Ga0207650_10000059104 | 50 |
| 495 | 3300025926 | Ga0207659_10243074 | Ga0207659_102430742 | 50 |
| 496 | 3300025928 | Ga0207700_10220130 | Ga0207700_102201303 | 50 |
| 497 | 3300025929 | Ga0207664_10772203 | Ga0207664_107722033 | 50 |
| 498 | 3300025931 | Ga0207644_10001085 | Ga0207644_100010856 | 50 |
| 499 | 3300025931 | Ga0207644_10007479 | Ga0207644_100074794 | 50 |
| 500 | 3300025932 | Ga0207690_10038534 | Ga0207690_100385343 | 50 |
| 501 | 3300025933 | Ga0207706_10006275 | Ga0207706_100062751 | 50 |
| 502 | 3300025934 | Ga0207686_10177888 | Ga0207686_101778882 | 50 |
| 503 | 3300025935 | Ga0207709_10694792 | Ga0207709_106947921 | 50 |
| 504 | 3300025936 | Ga0207670_10133977 | Ga0207670_101339772 | 50 |
| 505 | 3300025936 | Ga0207670_10150983 | Ga0207670_101509832 | 50 |
| 506 | 3300025937 | Ga0207669_10154690 | Ga0207669_101546901 | 50 |
| 507 | 3300025941 | Ga0207711_10185744 | Ga0207711_101857442 | 50 |
| 508 | 3300025942 | Ga0207689_10174160 | Ga0207689_101741602 | 50 |
| 509 | 3300025944 | Ga0207661_10000352 | Ga0207661_1000035213 | 50 |
| 510 | 3300025944 | Ga0207661_10601931 | Ga0207661_106019312 | 50 |
| 511 | 3300025945 | Ga0207679_10000039 | Ga0207679_1000003947 | 50 |
| 512 | 3300025945 | Ga0207679_10017715 | Ga0207679_100177156 | 50 |
| 513 | 3300025945 | Ga0207679_10037556 | Ga0207679_100375562 | 50 |
| 514 | 3300025949 | Ga0207667_10222582 | Ga0207667_102225823 | 50 |
| 515 | 3300025960 | Ga0207651_10003379 | Ga0207651_100033795 | 50 |
| 516 | 3300025961 | Ga0207712_10127027 | Ga0207712_101270272 | 50 |
| 517 | 3300025961 | Ga0207712_10798208 | Ga0207712_107982084 | 50 |
| 518 | 3300025961 | Ga0207712_11189374 | Ga0207712_111893741 | 50 |
| 519 | 3300025972 | Ga0207668_10115880 | Ga0207668_101158802 | 50 |
| 520 | 3300025981 | Ga0207640_10171684 | Ga0207640_101716841 | 50 |
| 521 | 3300025986 | Ga0207658_10003811 | Ga0207658_1000381110 | 50 |
| 522 | 3300026023 | Ga0207677_10015370 | Ga0207677_100153705 | 50 |
| 523 | 3300026023 | Ga0207677_10088616 | Ga0207677_100886163 | 50 |
| 524 | 3300026035 | Ga0207703_10073189 | Ga0207703_100731893 | 50 |
| 525 | 3300026041 | Ga0207639_10033545 | Ga0207639_100335455 | 50 |
| 526 | 3300026078 | Ga0207702_10323491 | Ga0207702_103234912 | 50 |
| 527 | 3300026088 | Ga0207641_10000025 | Ga0207641_10000025106 | 50 |
| 528 | 3300026088 | Ga0207641_10222687 | Ga0207641_102226872 | 50 |
| 529 | 3300026088 | Ga0207641_10277866 | Ga0207641_102778662 | 50 |
| 530 | 3300026089 | Ga0207648_10000420 | Ga0207648_1000042017 | 50 |
| 531 | 3300026095 | Ga0207676_10000104 | Ga0207676_1000010414 | 50 |
| 532 | 3300026095 | Ga0207676_11031572 | Ga0207676_110315722 | 50 |
| 533 | 3300026116 | Ga0207674_10000604 | Ga0207674_1000060416 | 50 |
| 534 | 3300026116 | Ga0207674_10414924 | Ga0207674_104149242 | 50 |
| 535 | 3300026118 | Ga0207675_100658481 | Ga0207675_1006584812 | 50 |
| 536 | 3300026121 | Ga0207683_10000726 | Ga0207683_1000072614 | 50 |
| 537 | 3300026142 | Ga0207698_10491622 | Ga0207698_104916222 | 50 |
| 538 | 3300028379 | Ga0268266_10004403 | Ga0268266_1000440311 | 50 |
| 539 | 3300028379 | Ga0268266_11426750 | Ga0268266_114267501 | 50 |
| 540 | 3300028380 | Ga0268265_10007199 | Ga0268265_100071997 | 50 |
| 541 | 3300028381 | Ga0268264_10177350 | Ga0268264_101773503 | 50 |
| 542 | 3300028577 | Ga0265318_10000442 | Ga0265318_100004424 | 50 |
| 543 | 3300028800 | Ga0265338_10023680 | Ga0265338_100236807 | 50 |
| 544 | 3300031090 | Ga0265760_10029199 | Ga0265760_100291992 | 50 |
| 545 | 3300031090 | Ga0265760_10342146 | Ga0265760_103421461 | 50 |
| 546 | 3300031238 | Ga0265332_10369644 | Ga0265332_103696441 | 50 |
| 547 | 3300031240 | Ga0265320_10008116 | Ga0265320_100081164 | 50 |
| 548 | 3300031241 | Ga0265325_10027884 | Ga0265325_100278845 | 50 |
| 549 | 3300031242 | Ga0265329_10001439 | Ga0265329_100014392 | 50 |
| 550 | 3300031247 | Ga0265340_10017289 | Ga0265340_100172893 | 50 |
| 551 | 3300031249 | Ga0265339_10003070 | Ga0265339_1000307018 | 50 |
| 552 | 3300031250 | Ga0265331_10000360 | Ga0265331_1000036015 | 50 |
| 553 | 3300031344 | Ga0265316_10004633 | Ga0265316_100046334 | 50 |
| 554 | 3300031595 | Ga0265313_10018793 | Ga0265313_100187931 | 50 |
| 555 | 3300031712 | Ga0265342_10000649 | Ga0265342_1000064919 | 50 |
| 556 | 3300035086 | Ga0373934_0001662 | Ga0373934_0001662_7675_7833 | 50 |
| 557 | 3300035117 | Ga0373953_0002652 | Ga0373953_0002652_1803_1961 | 50 |
| 558 | 3300035118 | Ga0373954_0002072 | Ga0373954_0002072_2081_2239 | 50 |
| 559 | 3300035119 | Ga0373956_0003602 | Ga0373956_0003602_3041_3199 | 50 |
| 560 | 3300035120 | Ga0373957_0039484 | Ga0373957_0039484_1582_1740 | 50 |
| 561 | 3300035172 | Ga0373955_0000064 | Ga0373955_0000064_12786_12944 | 50 |
| 562 | 3300035724 | Ga0373933_0001374 | Ga0373933_0001374_4103_4261 | 50 |
| 563 | 3300036401 | Ga0373937_0019024 | Ga0373937_0019024_1470_1628 | 50 |
| 564 | 3300036401 | Ga0373937_0546118 | Ga0373937_0546118_468_620 | 50 |
| 565 | 3300036401 | Ga0373937_1936651 | Ga0373937_1936651_20_178 | 50 |
| 566 | 3300038996 | Ga0242420_145848 | Ga0242420_145848_292_444 | 50 |
| 567 | 3300039450 | Ga0436363_0235155 | Ga0436363_0235155_1201_1359 | 50 |
| 568 | 3300039450 | Ga0436363_0571601 | Ga0436363_0571601_65_217 | 50 |
| 569 | 3300046462 | Ga0495651_0163775 | Ga0495651_0163775_715_873 | 50 |
| 570 | 3300046477 | Ga0495664_0884174 | Ga0495664_0884174_342_494 | 50 |
| 571 | 3300046499 | Ga0495594_0022843 | Ga0495594_0022843_775_927 | 50 |
| 572 | 3300046511 | Ga0495608_0041262 | Ga0495608_0041262_2544_2702 | 50 |
| 573 | 3300046528 | Ga0495642_0282888 | Ga0495642_0282888_152_304 | 50 |
| 574 | 3300046529 | Ga0495652_0057328 | Ga0495652_0057328_2717_2875 | 50 |
| 575 | 3300046533 | Ga0495640_0398345 | Ga0495640_0398345_656_808 | 50 |
| 576 | 3300046535 | Ga0495586_0062695 | Ga0495586_0062695_463_615 | 50 |
| 577 | 3300046536 | Ga0495587_0002611 | Ga0495587_0002611_2137_2295 | 50 |
| 578 | 3300046642 | Ga0495634_0036138 | Ga0495634_0036138_23_175 | 50 |
| 579 | 3300046663 | Ga0495635_0124258 | Ga0495635_0124258_1003_1161 | 50 |
| 580 | 3300046663 | Ga0495635_0493887 | Ga0495635_0493887_525_677 | 50 |
| 581 | 3300046679 | Ga0495623_0018612 | Ga0495623_0018612_4050_4208 | 50 |
| 582 | 3300046683 | Ga0495658_0281546 | Ga0495658_0281546_44_196 | 50 |
| 583 | 3300046684 | Ga0495669_0391046 | Ga0495669_0391046_131_283 | 50 |
| 584 | 3300046689 | Ga0495613_0201033 | Ga0495613_0201033_496_648 | 50 |
| 585 | 3300047317 | Ga0495604_0000524 | Ga0495604_0000524_10624_10782 | 50 |
| 586 | 3300047318 | Ga0495636_0166217 | Ga0495636_0166217_320_472 | 50 |
| 587 | 3300047319 | Ga0495674_0658903 | Ga0495674_0658903_15_167 | 50 |
| 588 | 3300047319 | Ga0495674_0700268 | Ga0495674_0700268_399_551 | 50 |
| 589 | 3300047322 | Ga0495680_0984067 | Ga0495680_0984067_93_245 | 50 |
| 590 | 3300047471 | Ga0495684_0036844 | Ga0495684_0036844_72_230 | 50 |
| 591 | 3300048088 | Ga0495602_0006680 | Ga0495602_0006680_3384_3542 | 50 |
| 592 | 3300048903 | Ga0496100_0367154 | Ga0496100_0367154_737_889 | 50 |
| 593 | 3300048905 | Ga0496102_0063793 | Ga0496102_0063793_1694_1846 | 50 |
| 594 | 3300048905 | Ga0496102_0184083 | Ga0496102_0184083_1502_1654 | 50 |
| 595 | 3300048908 | Ga0496105_0175126 | Ga0496105_0175126_1555_1707 | 50 |
| 596 | 3300048909 | Ga0496106_1400236 | Ga0496106_1400236_107_259 | 50 |
| 597 | 3300048911 | Ga0496108_0000539 | Ga0496108_0000539_25818_25970 | 50 |
| 598 | 3300048912 | Ga0496109_0000099 | Ga0496109_0000099_75204_75356 | 50 |
| 599 | 3300048913 | Ga0496110_0003615 | Ga0496110_0003615_1853_2005 | 50 |
| 600 | 3300048915 | Ga0496112_0000043 | Ga0496112_0000043_37685_37837 | 50 |
| 601 | 3300048915 | Ga0496112_0769740 | Ga0496112_0769740_313_465 | 50 |
| 602 | 3300048916 | Ga0496113_0000107 | Ga0496113_0000107_6604_6756 | 50 |
| 603 | 3300048918 | Ga0496115_0103742 | Ga0496115_0103742_2041_2193 | 50 |
| 604 | 3300050512 | nmdc:mga0n895_19616_c1 | nmdc:mga0n895_19616_c1_4765_4917 | 50 |
| 605 | 3300050513 | nmdc:mga0rr50_182967_c1 | nmdc:mga0rr50_182967_c1_770_922 | 50 |
| 606 | 3300050515 | nmdc:mga0a205_218599_c1 | nmdc:mga0a205_218599_c1_688_840 | 50 |
| 607 | 3300053085 | Ga0495619_0242953 | Ga0495619_0242953_884_1042 | 50 |
| 608 | 3300059477 | Ga0587084_101856 | Ga0587084_101856_415_567 | 50 |
| 609 | 3300059478 | Ga0587093_035150 | Ga0587093_035150_168_320 | 50 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar