F468853

General Info

Members Datasets Scaffolds Average Seq Length
609 305 609 50

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100494345|Ga0070706_1004943452
Length 58
Sequence LAGKEKIVDLLWTIAVILLILWLLGMVSSYTLGGFVHILLVLAVVVVLIRVIQGRRVV

Samples

Sample ID Description Type Environment
1 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
4 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
12 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
13 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
14 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
15 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
16 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
17 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
18 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
41 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
42 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
43 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
44 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
45 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
46 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
47 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
53 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
54 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
55 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
56 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
57 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
58 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
59 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
60 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
61 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
62 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
63 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
64 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
65 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
66 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
67 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
68 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
69 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
70 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
71 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
72 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
73 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
74 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
75 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
76 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
77 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
78 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
79 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
80 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
81 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
82 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
83 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
84 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
85 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
86 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
87 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
88 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
90 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
91 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
92 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
93 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
94 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
95 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
97 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
98 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
99 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
100 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
102 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
103 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
104 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
105 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
106 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
107 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
108 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
109 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
110 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
111 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
112 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
113 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
114 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
115 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
116 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
117 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
118 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
119 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
120 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
121 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
122 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
123 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
124 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
125 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
126 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
127 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
128 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
131 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
132 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
133 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
201 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
202 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
203 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
204 3300030762 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
207 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
208 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
209 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
210 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
211 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
212 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
213 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
214 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
215 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
216 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
217 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
218 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
219 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
220 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
221 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
222 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
223 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
224 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
225 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
226 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
227 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
228 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
229 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
230 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
231 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
233 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
234 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
235 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
236 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
237 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
238 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
239 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
240 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
241 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
242 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
243 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
244 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
245 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
246 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
247 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
248 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
249 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
250 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
251 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
252 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
253 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
254 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
255 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
256 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
257 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
258 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
259 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
260 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
261 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
262 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
263 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
264 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
265 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
266 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
267 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
268 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
269 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
270 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
271 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
272 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
273 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
274 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
275 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
276 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
277 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
278 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
279 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
280 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
281 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
282 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
283 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
284 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
285 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
286 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
287 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
288 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
289 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
290 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
291 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
292 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
293 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
294 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
295 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
296 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
297 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
298 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
299 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
300 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
301 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
302 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
303 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
304 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
305 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.24
Metatranscriptomes 4.76
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.66
Nodule 0
Rhizoplane 3.78
Rhizosphere 93.76
Stem 0
Stem Tuber 0
Unclassified 1.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1003164 3300001976 Bacteria 2173
2 JGI24743J22301_10005886 3300001991 Bacteria 2067
3 JGI24745J21846_1016410 3300002073 Unclassified 859
4 JGI24748J21848_1011022 3300002074 Eukaryota 1064
5 JGI24034J26672_10045692 3300002239 Unclassified 744
6 JGI24751J29686_10001680 3300002459 Bacteria 4552
7 Ga0006778J45830_1022949 3300003162 Bacteria 1806
8 rootH1_10193375 3300003323 Bacteria 1671
9 Ga0007416J51690_1087992 3300003577 Bacteria 748
10 Ga0007429J51699_1057182 3300003579 Bacteria 1363
11 Ga0032354_1015450 3300003693 Bacteria 1809
12 Ga0058863_11746886 3300004799 Bacteria 652
13 Ga0058861_11998395 3300004800 Bacteria 659
14 Ga0058860_12203405 3300004801 Bacteria 936
15 Ga0058862_10124568 3300004803 Bacteria 1157
16 Ga0058862_12853411 3300004803 Bacteria 1825
17 Ga0065704_10200846 3300005289 Bacteria 1147
18 Ga0065712_10370906 3300005290 Unclassified 740
19 Ga0065707_10320550 3300005295 Bacteria 967
20 Ga0065707_10321536 3300005295 Bacteria 959
21 Ga0070658_10000422 3300005327 Bacteria 36720
22 Ga0070683_100007493 3300005329 Bacteria 9224
23 Ga0070683_100735285 3300005329 Bacteria 945
24 Ga0070690_100600720 3300005330 Unclassified 835
25 Ga0070670_101942561 3300005331 Bacteria 542
26 Ga0068869_100155933 3300005334 Bacteria 1774
27 Ga0068869_101549438 3300005334 Bacteria 589
28 Ga0070666_10886131 3300005335 Unclassified 659
29 Ga0070666_11327217 3300005335 Unclassified 537
30 Ga0070680_100027238 3300005336 Bacteria 4577
31 Ga0070680_100288828 3300005336 Bacteria 1390
32 Ga0070680_100949136 3300005336 Unclassified 742
33 Ga0070682_100038123 3300005337 Bacteria 2946
34 Ga0070682_100073854 3300005337 Bacteria 2189
35 Ga0068868_100012529 3300005338 Bacteria 6200
36 Ga0068868_100013166 3300005338 Bacteria 6059
37 Ga0068868_101144972 3300005338 Unclassified 717
38 Ga0070660_100059277 3300005339 Bacteria 2968
39 Ga0070660_100517788 3300005339 Bacteria 993
40 Ga0070689_100000001 3300005340 Bacteria 1334580
41 Ga0070689_100053569 3300005340 Bacteria 3122
42 Ga0070689_100302276 3300005340 Unclassified 1332
43 Ga0070687_101177081 3300005343 Bacteria 564
44 Ga0070661_100003544 3300005344 Bacteria 10751
45 Ga0070661_100601151 3300005344 Bacteria 889
46 Ga0070661_100856807 3300005344 Bacteria 748
47 Ga0070668_102117890 3300005347 Bacteria 519
48 Ga0070669_100644003 3300005353 Unclassified 891
49 Ga0070675_101979192 3300005354 Unclassified 537
50 Ga0070674_100001002 3300005356 Bacteria 14730
51 Ga0070673_100371481 3300005364 Unclassified 1273
52 Ga0070673_101466180 3300005364 Unclassified 643
53 Ga0070688_100106766 3300005365 Bacteria 1855
54 Ga0070688_100405382 3300005365 Unclassified 1010
55 Ga0070659_100012377 3300005366 Bacteria 6326
56 Ga0070659_100048039 3300005366 Bacteria 3351
57 Ga0070659_101343974 3300005366 Bacteria 634
58 Ga0070667_100059176 3300005367 Bacteria 3241
59 Ga0070667_100883897 3300005367 Bacteria 831
60 Ga0070703_10289867 3300005406 Bacteria 678
61 Ga0070709_10001806 3300005434 Bacteria 11600
62 Ga0070709_10050343 3300005434 Bacteria 2610
63 Ga0070709_10401362 3300005434 Bacteria 1023
64 Ga0070709_10409784 3300005434 Unclassified 1014
65 Ga0070709_11239556 3300005434 Unclassified 600
66 Ga0070709_11287388 3300005434 Bacteria 589
67 Ga0070714_100156776 3300005435 Bacteria 2056
68 Ga0070714_100178922 3300005435 Bacteria 1929
69 Ga0070714_100179166 3300005435 Unclassified 1927
70 Ga0070714_100207979 3300005435 Unclassified 1793
71 Ga0070714_100426082 3300005435 Bacteria 1257
72 Ga0070714_100684197 3300005435 Unclassified 989
73 Ga0070714_100896536 3300005435 Unclassified 861
74 Ga0070714_101426698 3300005435 Bacteria 676
75 Ga0070714_102419691 3300005435 Unclassified 510
76 Ga0070713_100031741 3300005436 Unclassified 4210
77 Ga0070713_100058587 3300005436 Bacteria 3212
78 Ga0070713_100089141 3300005436 Unclassified 2649
79 Ga0070713_100130529 3300005436 Bacteria 2215
80 Ga0070713_100358287 3300005436 Bacteria 1355
81 Ga0070710_10350674 3300005437 Unclassified 977
82 Ga0070710_10388641 3300005437 Unclassified 932
83 Ga0070710_10429847 3300005437 Bacteria 891
84 Ga0070710_11347163 3300005437 Unclassified 532
85 Ga0070711_100025034 3300005439 Bacteria 3901
86 Ga0070711_100130218 3300005439 Bacteria 1873
87 Ga0070711_100725570 3300005439 Bacteria 838
88 Ga0070694_101201610 3300005444 Unclassified 635
89 Ga0070694_101359848 3300005444 Bacteria 598
90 Ga0070708_100139421 3300005445 Bacteria 2248
91 Ga0070708_100310572 3300005445 Unclassified 1485
92 Ga0070663_101594605 3300005455 Unclassified 582
93 Ga0070662_100021878 3300005457 Bacteria 4370
94 Ga0070662_101400633 3300005457 Unclassified 602
95 Ga0070681_10154669 3300005458 Bacteria 2219
96 Ga0068867_101544608 3300005459 Unclassified 619
97 Ga0070685_10004460 3300005466 Bacteria 7079
98 Ga0070706_100251395 3300005467 Bacteria 1650
99 Ga0070706_100494345 3300005467 Unclassified 1138
100 Ga0070707_100634481 3300005468 Unclassified 1031
101 Ga0070698_100000537 3300005471 Bacteria 40532
102 Ga0070698_100047112 3300005471 Bacteria 4407
103 Ga0070698_100052145 3300005471 Bacteria 4163
104 Ga0070698_101914252 3300005471 Unclassified 546
105 Ga0070699_100020703 3300005518 Bacteria 5673
106 Ga0070699_100030623 3300005518 Bacteria 4646
107 Ga0070699_100180594 3300005518 Bacteria 1872
108 Ga0070699_100519064 3300005518 Bacteria 1083
109 Ga0070699_101705039 3300005518 Unclassified 577
110 Ga0070679_100005155 3300005530 Bacteria 12089
111 Ga0070679_100042805 3300005530 Bacteria 4510
112 Ga0070679_101679494 3300005530 Bacteria 583
113 Ga0070684_101107426 3300005535 Bacteria 744
114 Ga0070697_100000703 3300005536 Bacteria 25005
115 Ga0070697_100976644 3300005536 Unclassified 752
116 Ga0068853_100022607 3300005539 Bacteria 5254
117 Ga0070672_100127165 3300005543 Bacteria 2091
118 Ga0070672_101558164 3300005543 Unclassified 592
119 Ga0070686_100210148 3300005544 Unclassified 1400
120 Ga0070686_101784613 3300005544 Unclassified 523
121 Ga0070695_100033595 3300005545 Unclassified 3210
122 Ga0070695_101543060 3300005545 Unclassified 553
123 Ga0070693_100088834 3300005547 Unclassified 1859
124 Ga0070693_100135900 3300005547 Bacteria 1542
125 Ga0070693_100563738 3300005547 Bacteria 817
126 Ga0070665_101399567 3300005548 Bacteria 708
127 Ga0070665_101834399 3300005548 Unclassified 613
128 Ga0070704_100302399 3300005549 Bacteria 1333
129 Ga0070704_100329321 3300005549 Bacteria 1282
130 Ga0070704_101902433 3300005549 Bacteria 551
131 Ga0068855_100091697 3300005563 Bacteria 3504
132 Ga0068855_100190636 3300005563 Bacteria 2313
133 Ga0068855_100399985 3300005563 Bacteria 1505
134 Ga0070664_100047275 3300005564 Bacteria 3635
135 Ga0070664_100064395 3300005564 Bacteria 3126
136 Ga0068857_100004945 3300005577 Bacteria 11319
137 Ga0068857_100110263 3300005577 Unclassified 2473
138 Ga0068854_100189527 3300005578 Bacteria 1610
139 Ga0068856_100006884 3300005614 Bacteria 11119
140 Ga0068856_100200443 3300005614 Bacteria 2010
141 Ga0068856_102212243 3300005614 Unclassified 559
142 Ga0070702_100042825 3300005615 Bacteria 2548
143 Ga0068852_100033192 3300005616 Bacteria 4283
144 Ga0068859_100440382 3300005617 Bacteria 1399
145 Ga0068859_100460732 3300005617 Unclassified 1367
146 Ga0068859_101959880 3300005617 Unclassified 647
147 Ga0068864_100019656 3300005618 Bacteria 5649
148 Ga0068864_100218377 3300005618 Unclassified 1758
149 Ga0068864_100335584 3300005618 Bacteria 1423
150 Ga0068864_100658043 3300005618 Bacteria 1020
151 Ga0068866_10008281 3300005718 Bacteria 4376
152 Ga0068866_10172642 3300005718 Bacteria 1270
153 Ga0068866_10499885 3300005718 Unclassified 804
154 Ga0068861_100597042 3300005719 Bacteria 1013
155 Ga0068861_101631807 3300005719 Bacteria 636
156 Ga0068851_10001293 3300005834 Bacteria 10917
157 Ga0068870_10003151 3300005840 Bacteria 6955
158 Ga0068863_100042710 3300005841 Bacteria 4308
159 Ga0068863_100102378 3300005841 Bacteria 2723
160 Ga0068863_100190082 3300005841 Bacteria 1973
161 Ga0068858_100067306 3300005842 Bacteria 3317
162 Ga0068858_100712144 3300005842 Bacteria 977
163 Ga0068858_101303019 3300005842 Bacteria 715
164 Ga0068860_100010295 3300005843 Bacteria 9251
165 Ga0068860_100028673 3300005843 Bacteria 5358
166 Ga0068860_101966690 3300005843 Bacteria 606
167 Ga0068862_100019961 3300005844 Bacteria 5593
168 Ga0068862_102047744 3300005844 Bacteria 583
169 Ga0070717_10209605 3300006028 Unclassified 1710
170 Ga0070717_10561192 3300006028 Bacteria 1034
171 Ga0070717_11103282 3300006028 Bacteria 723
172 Ga0070717_11943290 3300006028 Bacteria 531
173 Ga0070715_10146549 3300006163 Unclassified 1152
174 Ga0070715_10148187 3300006163 Bacteria 1147
175 Ga0070715_10217762 3300006163 Unclassified 980
176 Ga0070715_10279765 3300006163 Bacteria 884
177 Ga0070715_10904658 3300006163 Unclassified 543
178 Ga0070715_11042564 3300006163 Bacteria 512
179 Ga0070715_11044936 3300006163 Unclassified 511
180 Ga0070716_100018670 3300006173 Unclassified 3616
181 Ga0070716_100089826 3300006173 Bacteria 1857
182 Ga0070716_100268738 3300006173 Unclassified 1170
183 Ga0070716_100390950 3300006173 Unclassified 997
184 Ga0070716_100832497 3300006173 Unclassified 717
185 Ga0070716_100896508 3300006173 Unclassified 694
186 Ga0070716_101051491 3300006173 Bacteria 646
187 Ga0070716_101511068 3300006173 Unclassified 549
188 Ga0070712_100020416 3300006175 Bacteria 4335
189 Ga0070712_100212006 3300006175 Bacteria 1528
190 Ga0070712_100399485 3300006175 Unclassified 1135
191 Ga0097621_100206182 3300006237 Bacteria 1708
192 Ga0097621_100403549 3300006237 Bacteria 1224
193 Ga0097621_100684051 3300006237 Unclassified 943
194 Ga0068871_100570910 3300006358 Unclassified 1026
195 Ga0068871_101701341 3300006358 Unclassified 598
196 Ga0075428_100045670 3300006844 Unclassified 4813
197 Ga0075428_100836555 3300006844 Unclassified 978
198 Ga0075431_100008554 3300006847 Bacteria 10250
199 Ga0075431_100076057 3300006847 Bacteria 3465
200 Ga0075433_11479347 3300006852 Bacteria 587
201 Ga0075429_101974225 3300006880 Unclassified 505
202 Ga0068865_100162324 3300006881 Bacteria 1706
203 Ga0068865_100448212 3300006881 Bacteria 1066
204 Ga0068865_100863932 3300006881 Unclassified 784
205 Ga0097620_100440369 3300006931 Bacteria 1399
206 Ga0097620_100460688 3300006931 Unclassified 1367
207 Ga0097620_101960007 3300006931 Unclassified 647
208 Ga0099794_10009736 3300007265 Unclassified 4055
209 Ga0099794_10028192 3300007265 Unclassified 2610
210 Ga0099794_10043797 3300007265 Bacteria 2137
211 Ga0099795_10002146 3300007788 Bacteria 4550
212 Ga0105251_10036448 3300009011 Bacteria 2420
213 Ga0105240_10005890 3300009093 Bacteria 18155
214 Ga0105240_10190974 3300009093 Unclassified 2408
215 Ga0105240_12127758 3300009093 Unclassified 582
216 Ga0111539_10792091 3300009094 Bacteria 1103
217 Ga0105245_10040249 3300009098 Bacteria 4163
218 Ga0105245_10644121 3300009098 Bacteria 1089
219 Ga0105245_12093725 3300009098 Unclassified 619
220 Ga0105247_10002094 3300009101 Bacteria 13797
221 Ga0105247_10429959 3300009101 Bacteria 947
222 Ga0105243_10929491 3300009148 Bacteria 867
223 Ga0105241_10009943 3300009174 Bacteria 6988
224 Ga0105242_10067596 3300009176 Bacteria 2955
225 Ga0105242_10137668 3300009176 Bacteria 2115
226 Ga0105242_13162552 3300009176 Bacteria 511
227 Ga0105248_10088095 3300009177 Bacteria 3494
228 Ga0105237_10000151 3300009545 Bacteria 96844
229 Ga0105237_10804750 3300009545 Bacteria 947
230 Ga0105237_11840103 3300009545 Bacteria 613
231 Ga0105238_10105703 3300009551 Bacteria 2797
232 Ga0105238_13072471 3300009551 Unclassified 501
233 Ga0105249_10140893 3300009553 Bacteria 2312
234 Ga0105249_10953292 3300009553 Unclassified 926
235 Ga0105249_13150424 3300009553 Bacteria 530
236 Ga0105249_13368626 3300009553 Unclassified 514
237 Ga0099796_10091027 3300010159 Unclassified 1134
238 Ga0099796_10142282 3300010159 Unclassified 938
239 Ga0099796_10282840 3300010159 Unclassified 698
240 Ga0105239_10012012 3300010375 Bacteria 9657
241 Ga0105239_10082436 3300010375 Bacteria 3542
242 Ga0105239_10115727 3300010375 Unclassified 2975
243 Ga0105239_10413795 3300010375 Bacteria 1527
244 Ga0105239_11868604 3300010375 Unclassified 696
245 Ga0105239_12424988 3300010375 Bacteria 611
246 Ga0105246_10612286 3300011119 Bacteria 943
247 Ga0105246_11469724 3300011119 Unclassified 639
248 Ga0105246_11980337 3300011119 Unclassified 561
249 Ga0105246_12517096 3300011119 Bacteria 507
250 Ga0157373_10032674 3300013100 Bacteria 3745
251 Ga0157370_10119841 3300013104 Bacteria 2457
252 Ga0157369_10008874 3300013105 Bacteria 11517
253 Ga0157369_11793261 3300013105 Unclassified 623
254 Ga0157374_10108758 3300013296 Bacteria 2665
255 Ga0157378_10000185 3300013297 Bacteria 59863
256 Ga0157378_10468101 3300013297 Bacteria 1254
257 Ga0157378_10962918 3300013297 Bacteria 886
258 Ga0163162_10005281 3300013306 Bacteria 12464
259 Ga0163162_10024158 3300013306 Bacteria 5998
260 Ga0163162_11740584 3300013306 Bacteria 712
261 Ga0163162_11951614 3300013306 Unclassified 672
262 Ga0157372_10009715 3300013307 Bacteria 10231
263 Ga0157372_10128756 3300013307 Unclassified 2911
264 Ga0157372_11693659 3300013307 Unclassified 727
265 Ga0157372_11986590 3300013307 Unclassified 668
266 Ga0157375_10404946 3300013308 Bacteria 1531
267 Ga0157375_12874836 3300013308 Unclassified 575
268 Ga0163163_10018915 3300014325 Bacteria 6462
269 Ga0163163_10481664 3300014325 Unclassified 1302
270 Ga0163163_10565885 3300014325 Bacteria 1199
271 Ga0163163_11079938 3300014325 Bacteria 866
272 Ga0157380_10389989 3300014326 Bacteria 1317
273 Ga0157380_10618256 3300014326 Bacteria 1075
274 Ga0157377_10026235 3300014745 Bacteria 3116
275 Ga0157377_10398796 3300014745 Unclassified 936
276 Ga0157379_10219183 3300014968 Bacteria 1724
277 Ga0157379_10511829 3300014968 Unclassified 1113
278 Ga0157379_10960857 3300014968 Bacteria 813
279 Ga0157376_10123068 3300014969 Bacteria 2302
280 Ga0157376_10879038 3300014969 Unclassified 913
281 Ga0157376_12127974 3300014969 Bacteria 599
282 Ga0157376_12591463 3300014969 Unclassified 547
283 Ga0182005_1206618 3300015265 Bacteria 592
284 Ga0163161_10093744 3300017792 Bacteria 2225
285 Ga0197907_10112572 3300020069 Unclassified 556
286 Ga0206356_11546949 3300020070 Unclassified 878
287 Ga0206349_1447815 3300020075 Bacteria 659
288 Ga0206352_10155209 3300020078 Unclassified 557
289 Ga0206352_11013089 3300020078 Unclassified 1839
290 Ga0213876_10520575 3300021384 Unclassified 633
291 Ga0213876_10733762 3300021384 Unclassified 525
292 Ga0207697_10000518 3300025315 Bacteria 21729
293 Ga0207656_10117860 3300025321 Unclassified 1233
294 Ga0207682_10018953 3300025893 Bacteria 2692
295 Ga0207692_10953786 3300025898 Unclassified 565
296 Ga0207642_10004682 3300025899 Bacteria 4420
297 Ga0207642_10163481 3300025899 Bacteria 1198
298 Ga0207642_10763334 3300025899 Unclassified 613
299 Ga0207688_10017554 3300025901 Bacteria 3890
300 Ga0207680_10197707 3300025903 Bacteria 1368
301 Ga0207647_10026399 3300025904 Bacteria 3801
302 Ga0207685_10035766 3300025905 Bacteria 1815
303 Ga0207685_10621967 3300025905 Unclassified 581
304 Ga0207685_10704095 3300025905 Unclassified 550
305 Ga0207685_10813302 3300025905 Bacteria 515
306 Ga0207699_10001019 3300025906 Bacteria 13262
307 Ga0207699_10355094 3300025906 Unclassified 1035
308 Ga0207699_10527595 3300025906 Unclassified 854
309 Ga0207699_11045604 3300025906 Unclassified 604
310 Ga0207699_11351708 3300025906 Bacteria 527
311 Ga0207645_10000351 3300025907 Bacteria 38347
312 Ga0207643_10001192 3300025908 Bacteria 15359
313 Ga0207705_10020482 3300025909 Bacteria 4724
314 Ga0207705_10046957 3300025909 Bacteria 3104
315 Ga0207684_10207295 3300025910 Unclassified 1691
316 Ga0207654_10139362 3300025911 Bacteria 1545
317 Ga0207707_10298100 3300025912 Bacteria 1394
318 Ga0207671_10001259 3300025914 Bacteria 29868
319 Ga0207671_10446370 3300025914 Unclassified 1030
320 Ga0207693_10032697 3300025915 Bacteria 4105
321 Ga0207693_10069928 3300025915 Bacteria 2747
322 Ga0207693_10128538 3300025915 Unclassified 1992
323 Ga0207663_10004898 3300025916 Bacteria 6701
324 Ga0207663_10437974 3300025916 Bacteria 1006
325 Ga0207660_10023409 3300025917 Bacteria 4171
326 Ga0207660_10560942 3300025917 Unclassified 929
327 Ga0207662_10048072 3300025918 Bacteria 2527
328 Ga0207657_10004756 3300025919 Bacteria 14337
329 Ga0207649_10000928 3300025920 Bacteria 18426
330 Ga0207649_10293879 3300025920 Bacteria 1186
331 Ga0207652_10003090 3300025921 Bacteria 13894
332 Ga0207652_10014841 3300025921 Bacteria 6316
333 Ga0207652_11109570 3300025921 Unclassified 692
334 Ga0207646_10000472 3300025922 Bacteria 53714
335 Ga0207646_10012427 3300025922 Bacteria 8184
336 Ga0207646_10062627 3300025922 Bacteria 3321
337 Ga0207646_10515249 3300025922 Bacteria 1077
338 Ga0207646_10583534 3300025922 Unclassified 1004
339 Ga0207681_10053608 3300025923 Bacteria 2738
340 Ga0207694_10067452 3300025924 Bacteria 2793
341 Ga0207694_10872371 3300025924 Unclassified 761
342 Ga0207650_10000059 3300025925 Bacteria 151427
343 Ga0207659_10243074 3300025926 Unclassified 1457
344 Ga0207687_10640601 3300025927 Bacteria 898
345 Ga0207700_10068779 3300025928 Bacteria 2715
346 Ga0207700_10071786 3300025928 Unclassified 2667
347 Ga0207700_10101556 3300025928 Bacteria 2295
348 Ga0207700_10210369 3300025928 Unclassified 1644
349 Ga0207700_10220130 3300025928 Unclassified 1609
350 Ga0207700_10320247 3300025928 Bacteria 1344
351 Ga0207700_10401344 3300025928 Bacteria 1201
352 Ga0207700_11797651 3300025928 Bacteria 539
353 Ga0207700_11928959 3300025928 Bacteria 517
354 Ga0207664_10133959 3300025929 Bacteria 2089
355 Ga0207664_10140748 3300025929 Unclassified 2041
356 Ga0207664_10178774 3300025929 Bacteria 1820
357 Ga0207664_10274962 3300025929 Unclassified 1476
358 Ga0207664_10772203 3300025929 Unclassified 864
359 Ga0207664_11917702 3300025929 Unclassified 515
360 Ga0207644_10001085 3300025931 Bacteria 17449
361 Ga0207644_10007479 3300025931 Bacteria 7125
362 Ga0207690_10038534 3300025932 Bacteria 3111
363 Ga0207690_11054981 3300025932 Bacteria 677
364 Ga0207706_10006275 3300025933 Bacteria 11049
365 Ga0207706_10926317 3300025933 Unclassified 735
366 Ga0207686_10158528 3300025934 Bacteria 1584
367 Ga0207686_10177888 3300025934 Bacteria 1506
368 Ga0207686_10486985 3300025934 Unclassified 955
369 Ga0207709_10694792 3300025935 Bacteria 813
370 Ga0207670_10000002 3300025936 Bacteria 783058
371 Ga0207670_10133977 3300025936 Bacteria 1819
372 Ga0207670_10150983 3300025936 Bacteria 1724
373 Ga0207670_11236123 3300025936 Unclassified 633
374 Ga0207669_10154690 3300025937 Bacteria 1611
375 Ga0207665_10001016 3300025939 Bacteria 18939
376 Ga0207665_10016213 3300025939 Unclassified 4892
377 Ga0207665_10070674 3300025939 Bacteria 2382
378 Ga0207665_10432421 3300025939 Unclassified 1007
379 Ga0207691_11215116 3300025940 Unclassified 625
380 Ga0207711_10185744 3300025941 Bacteria 1892
381 Ga0207711_11130779 3300025941 Bacteria 724
382 Ga0207711_11650589 3300025941 Unclassified 584
383 Ga0207689_10174160 3300025942 Bacteria 1774
384 Ga0207689_11196538 3300025942 Bacteria 640
385 Ga0207661_10000352 3300025944 Bacteria 29636
386 Ga0207661_10601931 3300025944 Bacteria 1009
387 Ga0207679_10000039 3300025945 Bacteria 127661
388 Ga0207679_10017715 3300025945 Bacteria 4757
389 Ga0207679_10037556 3300025945 Bacteria 3443
390 Ga0207667_10128298 3300025949 Bacteria 2612
391 Ga0207667_10222582 3300025949 Bacteria 1933
392 Ga0207667_10491161 3300025949 Bacteria 1246
393 Ga0207651_10003379 3300025960 Bacteria 7836
394 Ga0207651_10712060 3300025960 Bacteria 885
395 Ga0207712_10127027 3300025961 Bacteria 1937
396 Ga0207712_10798208 3300025961 Unclassified 830
397 Ga0207712_11189374 3300025961 Bacteria 680
398 Ga0207668_10115880 3300025972 Bacteria 2019
399 Ga0207668_11473891 3300025972 Bacteria 614
400 Ga0207640_10171684 3300025981 Bacteria 1616
401 Ga0207640_10913750 3300025981 Bacteria 767
402 Ga0207658_10003811 3300025986 Bacteria 10616
403 Ga0207677_10015370 3300026023 Bacteria 4501
404 Ga0207677_10088616 3300026023 Bacteria 2244
405 Ga0207703_10073189 3300026035 Bacteria 2834
406 Ga0207703_10228835 3300026035 Bacteria 1666
407 Ga0207703_10450601 3300026035 Bacteria 1202
408 Ga0207703_11207706 3300026035 Unclassified 727
409 Ga0207639_10033545 3300026041 Bacteria 3788
410 Ga0207702_10303853 3300026078 Unclassified 1515
411 Ga0207702_10323491 3300026078 Unclassified 1469
412 Ga0207702_10894410 3300026078 Unclassified 880
413 Ga0207641_10000025 3300026088 Bacteria 247727
414 Ga0207641_10222687 3300026088 Bacteria 1750
415 Ga0207641_10242871 3300026088 Bacteria 1679
416 Ga0207641_10277866 3300026088 Bacteria 1574
417 Ga0207648_10000420 3300026089 Bacteria 46606
418 Ga0207648_10451979 3300026089 Bacteria 1170
419 Ga0207676_10000104 3300026095 Bacteria 74872
420 Ga0207676_10620146 3300026095 Bacteria 1041
421 Ga0207676_10873200 3300026095 Bacteria 881
422 Ga0207676_11031572 3300026095 Bacteria 811
423 Ga0207674_10000604 3300026116 Bacteria 47244
424 Ga0207674_10055162 3300026116 Bacteria 4042
425 Ga0207674_10073650 3300026116 Unclassified 3428
426 Ga0207674_10299159 3300026116 Bacteria 1558
427 Ga0207674_10414924 3300026116 Unclassified 1301
428 Ga0207675_100658481 3300026118 Bacteria 1054
429 Ga0207675_101751709 3300026118 Unclassified 641
430 Ga0207683_10000726 3300026121 Bacteria 29917
431 Ga0207683_11183224 3300026121 Bacteria 709
432 Ga0207698_10491622 3300026142 Bacteria 1192
433 Ga0209179_1005202 3300027512 Unclassified 2020
434 Ga0209179_1010011 3300027512 Unclassified 1641
435 Ga0209588_1031914 3300027671 Unclassified 1686
436 Ga0209588_1114198 3300027671 Unclassified 866
437 Ga0268266_10004403 3300028379 Bacteria 13498
438 Ga0268266_11426750 3300028379 Bacteria 668
439 Ga0268265_10007199 3300028380 Bacteria 7519
440 Ga0268264_10084179 3300028381 Bacteria 2726
441 Ga0268264_10177350 3300028381 Bacteria 1932
442 Ga0268264_10855655 3300028381 Bacteria 911
443 Ga0268264_11156099 3300028381 Bacteria 783
444 Ga0265337_1099747 3300028556 Unclassified 791
445 Ga0265326_10073639 3300028558 Bacteria 966
446 Ga0265318_10000442 3300028577 Bacteria 31287
447 Ga0265338_10023680 3300028800 Bacteria 6300
448 Ga0265775_102738 3300030762 Unclassified 925
449 Ga0265760_10029199 3300031090 Unclassified 1621
450 Ga0265760_10342146 3300031090 Unclassified 534
451 Ga0265332_10369644 3300031238 Unclassified 592
452 Ga0265320_10008116 3300031240 Bacteria 6452
453 Ga0265325_10027884 3300031241 Bacteria 3049
454 Ga0265329_10001439 3300031242 Bacteria 11465
455 Ga0265340_10017289 3300031247 Bacteria 3728
456 Ga0265339_10003070 3300031249 Bacteria 11753
457 Ga0265331_10000360 3300031250 Bacteria 47793
458 Ga0265327_10000008 3300031251 Bacteria 658870
459 Ga0265327_10003326 3300031251 Bacteria 15541
460 Ga0265327_10188426 3300031251 Unclassified 940
461 Ga0265316_10004633 3300031344 Bacteria 13638
462 Ga0265313_10018793 3300031595 Bacteria 3869
463 Ga0265342_10000649 3300031712 Bacteria 36485
464 Ga0373926_0363201 3300035083 Unclassified 569
465 Ga0373934_0000393 3300035086 Bacteria 15250
466 Ga0373934_0001662 3300035086 Bacteria 8160
467 Ga0373934_0036970 3300035086 Bacteria 1923
468 Ga0373923_0048157 3300035111 Bacteria 1779
469 Ga0373953_0002652 3300035117 Bacteria 5423
470 Ga0373953_0104701 3300035117 Bacteria 1193
471 Ga0373954_0002072 3300035118 Bacteria 8328
472 Ga0373956_0003602 3300035119 Bacteria 6251
473 Ga0373956_0006130 3300035119 Bacteria 4808
474 Ga0373956_0595010 3300035119 Unclassified 528
475 Ga0373957_0039484 3300035120 Unclassified 1770
476 Ga0373946_0550702 3300035171 Bacteria 595
477 Ga0373955_0000064 3300035172 Bacteria 41989
478 Ga0373955_0008806 3300035172 Bacteria 4703
479 Ga0373955_0151360 3300035172 Unclassified 1366
480 Ga0373924_0205936 3300035410 Bacteria 868
481 Ga0373924_0486823 3300035410 Bacteria 554
482 Ga0373935_0067686 3300035692 Unclassified 2297
483 Ga0373935_0438003 3300035692 Unclassified 943
484 Ga0373927_0365131 3300035695 Bacteria 952
485 Ga0373933_0001374 3300035724 Bacteria 14330
486 Ga0373933_0047005 3300035724 Bacteria 2565
487 Ga0373933_0122456 3300035724 Bacteria 1630
488 Ga0373933_0871632 3300035724 Unclassified 593
489 Ga0373937_0000192 3300036401 Bacteria 60004
490 Ga0373937_0019024 3300036401 Bacteria 6144
491 Ga0373937_0025277 3300036401 Bacteria 5362
492 Ga0373937_0140427 3300036401 Bacteria 2260
493 Ga0373937_0546118 3300036401 Bacteria 1101
494 Ga0373937_0804676 3300036401 Bacteria 888
495 Ga0373937_1936651 3300036401 Unclassified 535
496 Ga0265778_024805 3300036457 Unclassified 754
497 Ga0373925_0411329 3300037068 Unclassified 1104
498 Ga0373925_0471525 3300037068 Unclassified 1029
499 Ga0395905_0148928 3300037471 Bacteria 2202
500 Ga0242420_145848 3300038996 Unclassified 529
501 Ga0436365_0020432 3300039437 Unclassified 634
502 Ga0436365_0582251 3300039437 Bacteria 5743
503 Ga0436365_0967462 3300039437 Unclassified 773
504 Ga0436363_0235155 3300039450 Bacteria 1380
505 Ga0436363_0571601 3300039450 Unclassified 1092
506 Ga0436363_1308970 3300039450 Unclassified 569
507 Ga0451807_0995951 3300041486 Unclassified 773
508 Ga0451853_1121466 3300041512 Bacteria 1121
509 Ga0439459_0236406 3300042438 Bacteria 511
510 Ga0439464_0162436 3300042439 Unclassified 702
511 Ga0439460_0272550 3300042461 Unclassified 588
512 Ga0451577_0000082 3300042876 Bacteria 214418
513 Ga0451577_0004854 3300042876 Bacteria 14026
514 Ga0451577_0072471 3300042876 Bacteria 3073
515 Ga0451577_1887681 3300042876 Unclassified 523
516 Ga0453683_0063687 3300044673 Bacteria 2305
517 Ga0453684_0001652 3300044712 Bacteria 60494
518 Ga0453684_0030371 3300044712 Bacteria 7635
519 Ga0453684_1558730 3300044712 Bacteria 679
520 Ga0451576_0994484 3300045051 Bacteria 879
521 Ga0495592_0342858 3300046454 Bacteria 960
522 Ga0495651_0152299 3300046462 Bacteria 1665
523 Ga0495651_0163775 3300046462 Unclassified 1591
524 Ga0495664_0395503 3300046477 Unclassified 830
525 Ga0495664_0884174 3300046477 Bacteria 523
526 Ga0495594_0022843 3300046499 Bacteria 3349
527 Ga0495608_0041262 3300046511 Unclassified 3089
528 Ga0495618_0248377 3300046514 Bacteria 1117
529 Ga0495628_0124228 3300046516 Bacteria 1978
530 Ga0495642_0282888 3300046528 Unclassified 726
531 Ga0495652_0057328 3300046529 Unclassified 3304
532 Ga0495640_0398345 3300046533 Bacteria 845
533 Ga0495586_0049939 3300046535 Bacteria 2262
534 Ga0495586_0062695 3300046535 Bacteria 2024
535 Ga0495587_0002611 3300046536 Bacteria 12038
536 Ga0495645_0242198 3300046543 Bacteria 1203
537 Ga0495634_0036138 3300046642 Bacteria 3380
538 Ga0495635_0124258 3300046663 Unclassified 1760
539 Ga0495635_0413554 3300046663 Bacteria 895
540 Ga0495635_0493887 3300046663 Bacteria 806
541 Ga0495599_0068632 3300046678 Bacteria 2213
542 Ga0495623_0018612 3300046679 Unclassified 4485
543 Ga0495623_0422217 3300046679 Unclassified 714
544 Ga0495646_0427607 3300046680 Unclassified 686
545 Ga0495646_0488585 3300046680 Bacteria 633
546 Ga0495658_0281546 3300046683 Bacteria 1049
547 Ga0495669_0391046 3300046684 Unclassified 673
548 Ga0495613_0201033 3300046689 Bacteria 1405
549 Ga0495624_0200484 3300046690 Bacteria 1212
550 Ga0495600_0677132 3300046809 Unclassified 622
551 Ga0495604_0000524 3300047317 Bacteria 33845
552 Ga0495636_0166217 3300047318 Bacteria 996
553 Ga0495674_0071803 3300047319 Bacteria 2987
554 Ga0495674_0658903 3300047319 Bacteria 825
555 Ga0495674_0700268 3300047319 Unclassified 795
556 Ga0495680_0081659 3300047322 Bacteria 2440
557 Ga0495680_0984067 3300047322 Unclassified 540
558 Ga0495684_0036844 3300047471 Unclassified 3750
559 Ga0495684_0632016 3300047471 Unclassified 718
560 Ga0495602_0006680 3300048088 Bacteria 12088
561 Ga0495602_0263802 3300048088 Bacteria 1276
562 Ga0496100_0367154 3300048903 Bacteria 1090
563 Ga0496100_1220194 3300048903 Unclassified 593
564 Ga0496102_0015347 3300048905 Bacteria 6671
565 Ga0496102_0063793 3300048905 Bacteria 3374
566 Ga0496102_0184083 3300048905 Bacteria 1968
567 Ga0496103_0089197 3300048906 Bacteria 1945
568 Ga0496104_0140304 3300048907 Bacteria 2322
569 Ga0496104_0230714 3300048907 Bacteria 1763
570 Ga0496104_1875733 3300048907 Unclassified 501
571 Ga0496105_0175126 3300048908 Bacteria 1758
572 Ga0496106_0027732 3300048909 Bacteria 4219
573 Ga0496106_1400236 3300048909 Unclassified 540
574 Ga0496108_0000539 3300048911 Bacteria 29583
575 Ga0496109_0000099 3300048912 Bacteria 89901
576 Ga0496110_0003615 3300048913 Bacteria 11898
577 Ga0496112_0000043 3300048915 Bacteria 87684
578 Ga0496112_0769740 3300048915 Bacteria 888
579 Ga0496112_1264568 3300048915 Bacteria 654
580 Ga0496113_0000107 3300048916 Bacteria 35660
581 Ga0496115_0103742 3300048918 Bacteria 2333
582 Ga0496115_0721648 3300048918 Unclassified 782
583 Ga0496115_1345453 3300048918 Unclassified 530
584 nmdc:mga06r32_137806_c1 3300050510 Bacteria 2415
585 nmdc:mga06r32_5055_c1 3300050510 Bacteria 11878
586 nmdc:mga06r32_600752_c1 3300050510 Bacteria 1071
587 nmdc:mga0n895_19616_c1 3300050512 Bacteria 6287
588 nmdc:mga0rr50_182967_c1 3300050513 Bacteria 1714
589 nmdc:mga0a205_1010873_c1 3300050515 Bacteria 678
590 nmdc:mga0a205_218599_c1 3300050515 Bacteria 1792
591 Ga0495601_0012321 3300053077 Bacteria 5129
592 Ga0495612_0443315 3300053078 Unclassified 593
593 Ga0495619_0020280 3300053085 Bacteria 4232
594 Ga0495619_0242953 3300053085 Unclassified 1247
595 Ga0500595_022033 3300053119 Bacteria 2264
596 Ga0500595_049142 3300053119 Bacteria 1315
597 Ga0500564_060547 3300053138 Unclassified 1718
598 Ga0500568_0000329 3300053139 Bacteria 37308
599 Ga0587084_101856 3300059477 Bacteria 583
600 Ga0587093_035150 3300059478 Bacteria 738
601 Ga0587066_055940 3300059490 Unclassified 791
602 Ga0587073_0040966 3300059492 Unclassified 1009
603 Ga0587073_0055836 3300059492 Unclassified 910
604 Ga0587077_240189 3300059493 Unclassified 519
605 Ga0587080_035738 3300059503 Unclassified 886
606 Ga0587082_185425 3300059504 Unclassified 512
607 Ga0587072_188475 3300059643 Unclassified 518
608 Ga0587107_039077 3300059652 Unclassified 759
609 Ga0587107_122548 3300059652 Unclassified 538

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005289 Ga0065704_10200846 Ga0065704_102008462 48
2 3300020069 Ga0197907_10112572 Ga0197907_101125721 48
3 3300028556 Ga0265337_1099747 Ga0265337_10997471 48
4 3300028558 Ga0265326_10073639 Ga0265326_100736391 48
5 3300031251 Ga0265327_10000008 Ga0265327_10000008637 48
6 3300035086 Ga0373934_0036970 Ga0373934_0036970_1539_1685 48
7 3300035119 Ga0373956_0595010 Ga0373956_0595010_236_382 48
8 3300035724 Ga0373933_0122456 Ga0373933_0122456_968_1114 48
9 3300036401 Ga0373937_0025277 Ga0373937_0025277_789_935 48
10 3300042438 Ga0439459_0236406 Ga0439459_0236406_37_204 48
11 3300042439 Ga0439464_0162436 Ga0439464_0162436_310_477 48
12 3300042461 Ga0439460_0272550 Ga0439460_0272550_204_350 48
13 3300046690 Ga0495624_0200484 Ga0495624_0200484_419_565 48
14 3300053077 Ga0495601_0012321 Ga0495601_0012321_811_957 48
15 3300003162 Ga0006778J45830_1022949 Ga0006778J45830_10229496 49
16 3300003323 rootH1_10193375 rootH1_101933754 49
17 3300003577 Ga0007416J51690_1087992 Ga0007416J51690_10879923 49
18 3300003579 Ga0007429J51699_1057182 Ga0007429J51699_10571824 49
19 3300003693 Ga0032354_1015450 Ga0032354_10154506 49
20 3300004799 Ga0058863_11746886 Ga0058863_117468861 49
21 3300004800 Ga0058861_11998395 Ga0058861_119983953 49
22 3300004801 Ga0058860_12203405 Ga0058860_122034051 49
23 3300004803 Ga0058862_10124568 Ga0058862_101245683 49
24 3300004803 Ga0058862_12853411 Ga0058862_128534111 49
25 3300005295 Ga0065707_10321536 Ga0065707_103215362 49
26 3300005327 Ga0070658_10000422 Ga0070658_100004227 49
27 3300005331 Ga0070670_101942561 Ga0070670_1019425611 49
28 3300005334 Ga0068869_101549438 Ga0068869_1015494382 49
29 3300005335 Ga0070666_10886131 Ga0070666_108861312 49
30 3300005335 Ga0070666_11327217 Ga0070666_113272172 49
31 3300005336 Ga0070680_100027238 Ga0070680_1000272381 49
32 3300005336 Ga0070680_100288828 Ga0070680_1002888281 49
33 3300005336 Ga0070680_100949136 Ga0070680_1009491361 49
34 3300005337 Ga0070682_100073854 Ga0070682_1000738542 49
35 3300005338 Ga0068868_101144972 Ga0068868_1011449722 49
36 3300005340 Ga0070689_100000001 Ga0070689_100000001759 49
37 3300005343 Ga0070687_101177081 Ga0070687_1011770811 49
38 3300005344 Ga0070661_100601151 Ga0070661_1006011512 49
39 3300005347 Ga0070668_102117890 Ga0070668_1021178902 49
40 3300005354 Ga0070675_101979192 Ga0070675_1019791921 49
41 3300005364 Ga0070673_101466180 Ga0070673_1014661802 49
42 3300005365 Ga0070688_100106766 Ga0070688_1001067662 49
43 3300005366 Ga0070659_100048039 Ga0070659_1000480394 49
44 3300005366 Ga0070659_101343974 Ga0070659_1013439741 49
45 3300005367 Ga0070667_100883897 Ga0070667_1008838971 49
46 3300005406 Ga0070703_10289867 Ga0070703_102898672 49
47 3300005434 Ga0070709_10001806 Ga0070709_100018068 49
48 3300005434 Ga0070709_10050343 Ga0070709_100503433 49
49 3300005434 Ga0070709_10401362 Ga0070709_104013622 49
50 3300005434 Ga0070709_10409784 Ga0070709_104097842 49
51 3300005434 Ga0070709_11287388 Ga0070709_112873881 49
52 3300005435 Ga0070714_100156776 Ga0070714_1001567763 49
53 3300005435 Ga0070714_100178922 Ga0070714_1001789224 49
54 3300005435 Ga0070714_100179166 Ga0070714_1001791664 49
55 3300005435 Ga0070714_100207979 Ga0070714_1002079792 49
56 3300005435 Ga0070714_100426082 Ga0070714_1004260822 49
57 3300005435 Ga0070714_100896536 Ga0070714_1008965362 49
58 3300005435 Ga0070714_101426698 Ga0070714_1014266982 49
59 3300005435 Ga0070714_102419691 Ga0070714_1024196911 49
60 3300005436 Ga0070713_100058587 Ga0070713_1000585872 49
61 3300005436 Ga0070713_100089141 Ga0070713_1000891413 49
62 3300005436 Ga0070713_100130529 Ga0070713_1001305293 49
63 3300005436 Ga0070713_100358287 Ga0070713_1003582871 49
64 3300005437 Ga0070710_10350674 Ga0070710_103506743 49
65 3300005437 Ga0070710_10429847 Ga0070710_104298472 49
66 3300005437 Ga0070710_11347163 Ga0070710_113471632 49
67 3300005439 Ga0070711_100130218 Ga0070711_1001302182 49
68 3300005439 Ga0070711_100725570 Ga0070711_1007255702 49
69 3300005444 Ga0070694_101359848 Ga0070694_1013598482 49
70 3300005445 Ga0070708_100139421 Ga0070708_1001394213 49
71 3300005445 Ga0070708_100310572 Ga0070708_1003105722 49
72 3300005455 Ga0070663_101594605 Ga0070663_1015946052 49
73 3300005457 Ga0070662_101400633 Ga0070662_1014006332 49
74 3300005458 Ga0070681_10154669 Ga0070681_101546697 49
75 3300005459 Ga0068867_101544608 Ga0068867_1015446081 49
76 3300005467 Ga0070706_100251395 Ga0070706_1002513952 49
77 3300005467 Ga0070706_100494345 Ga0070706_1004943452 49
78 3300005468 Ga0070707_100634481 Ga0070707_1006344811 49
79 3300005471 Ga0070698_100000537 Ga0070698_10000053727 49
80 3300005471 Ga0070698_100047112 Ga0070698_1000471123 49
81 3300005471 Ga0070698_101914252 Ga0070698_1019142522 49
82 3300005518 Ga0070699_100020703 Ga0070699_1000207032 49
83 3300005518 Ga0070699_100030623 Ga0070699_1000306232 49
84 3300005518 Ga0070699_100180594 Ga0070699_1001805942 49
85 3300005518 Ga0070699_100519064 Ga0070699_1005190641 49
86 3300005518 Ga0070699_101705039 Ga0070699_1017050392 49
87 3300005530 Ga0070679_100005155 Ga0070679_1000051551 49
88 3300005530 Ga0070679_100042805 Ga0070679_1000428055 49
89 3300005530 Ga0070679_101679494 Ga0070679_1016794942 49
90 3300005536 Ga0070697_100000703 Ga0070697_10000070322 49
91 3300005536 Ga0070697_100976644 Ga0070697_1009766441 49
92 3300005543 Ga0070672_101558164 Ga0070672_1015581642 49
93 3300005544 Ga0070686_100210148 Ga0070686_1002101482 49
94 3300005545 Ga0070695_100033595 Ga0070695_1000335952 49
95 3300005545 Ga0070695_101543060 Ga0070695_1015430602 49
96 3300005547 Ga0070693_100088834 Ga0070693_1000888343 49
97 3300005547 Ga0070693_100135900 Ga0070693_1001359002 49
98 3300005549 Ga0070704_100302399 Ga0070704_1003023992 49
99 3300005549 Ga0070704_100329321 Ga0070704_1003293211 49
100 3300005563 Ga0068855_100091697 Ga0068855_1000916977 49
101 3300005563 Ga0068855_100399985 Ga0068855_1003999853 49
102 3300005577 Ga0068857_100110263 Ga0068857_1001102632 49
103 3300005614 Ga0068856_100200443 Ga0068856_1002004434 49
104 3300005614 Ga0068856_102212243 Ga0068856_1022122431 49
105 3300005617 Ga0068859_100440382 Ga0068859_1004403822 49
106 3300005617 Ga0068859_100460732 Ga0068859_1004607323 49
107 3300005617 Ga0068859_101959880 Ga0068859_1019598801 49
108 3300005618 Ga0068864_100335584 Ga0068864_1003355843 49
109 3300005618 Ga0068864_100658043 Ga0068864_1006580432 49
110 3300005718 Ga0068866_10172642 Ga0068866_101726423 49
111 3300005718 Ga0068866_10499885 Ga0068866_104998852 49
112 3300005841 Ga0068863_100102378 Ga0068863_1001023785 49
113 3300005842 Ga0068858_100712144 Ga0068858_1007121442 49
114 3300005842 Ga0068858_101303019 Ga0068858_1013030192 49
115 3300005843 Ga0068860_100010295 Ga0068860_1000102953 49
116 3300005843 Ga0068860_101966690 Ga0068860_1019666902 49
117 3300005844 Ga0068862_102047744 Ga0068862_1020477442 49
118 3300006028 Ga0070717_10561192 Ga0070717_105611922 49
119 3300006028 Ga0070717_11103282 Ga0070717_111032822 49
120 3300006028 Ga0070717_11943290 Ga0070717_119432902 49
121 3300006163 Ga0070715_10146549 Ga0070715_101465492 49
122 3300006163 Ga0070715_10148187 Ga0070715_101481873 49
123 3300006163 Ga0070715_10217762 Ga0070715_102177622 49
124 3300006163 Ga0070715_10279765 Ga0070715_102797652 49
125 3300006163 Ga0070715_11042564 Ga0070715_110425642 49
126 3300006163 Ga0070715_11044936 Ga0070715_110449362 49
127 3300006173 Ga0070716_100018670 Ga0070716_1000186705 49
128 3300006173 Ga0070716_100089826 Ga0070716_1000898262 49
129 3300006173 Ga0070716_100268738 Ga0070716_1002687381 49
130 3300006173 Ga0070716_100390950 Ga0070716_1003909502 49
131 3300006173 Ga0070716_100832497 Ga0070716_1008324971 49
132 3300006173 Ga0070716_100896508 Ga0070716_1008965082 49
133 3300006173 Ga0070716_101051491 Ga0070716_1010514911 49
134 3300006173 Ga0070716_101511068 Ga0070716_1015110682 49
135 3300006175 Ga0070712_100020416 Ga0070712_1000204165 49
136 3300006175 Ga0070712_100212006 Ga0070712_1002120062 49
137 3300006237 Ga0097621_100403549 Ga0097621_1004035492 49
138 3300006237 Ga0097621_100684051 Ga0097621_1006840513 49
139 3300006358 Ga0068871_100570910 Ga0068871_1005709102 49
140 3300006358 Ga0068871_101701341 Ga0068871_1017013412 49
141 3300006844 Ga0075428_100045670 Ga0075428_1000456705 49
142 3300006844 Ga0075428_100836555 Ga0075428_1008365552 49
143 3300006847 Ga0075431_100008554 Ga0075431_10000855413 49
144 3300006847 Ga0075431_100076057 Ga0075431_1000760574 49
145 3300006852 Ga0075433_11479347 Ga0075433_114793472 49
146 3300006880 Ga0075429_101974225 Ga0075429_1019742252 49
147 3300006881 Ga0068865_100863932 Ga0068865_1008639322 49
148 3300006931 Ga0097620_100440369 Ga0097620_1004403693 49
149 3300006931 Ga0097620_100460688 Ga0097620_1004606883 49
150 3300006931 Ga0097620_101960007 Ga0097620_1019600071 49
151 3300007265 Ga0099794_10009736 Ga0099794_100097363 49
152 3300007265 Ga0099794_10028192 Ga0099794_100281924 49
153 3300007265 Ga0099794_10043797 Ga0099794_100437975 49
154 3300007788 Ga0099795_10002146 Ga0099795_100021465 49
155 3300009093 Ga0105240_10005890 Ga0105240_100058905 49
156 3300009093 Ga0105240_10190974 Ga0105240_101909743 49
157 3300009093 Ga0105240_12127758 Ga0105240_121277582 49
158 3300009098 Ga0105245_10644121 Ga0105245_106441212 49
159 3300009098 Ga0105245_12093725 Ga0105245_120937252 49
160 3300009101 Ga0105247_10429959 Ga0105247_104299592 49
161 3300009176 Ga0105242_10067596 Ga0105242_100675962 49
162 3300009176 Ga0105242_13162552 Ga0105242_131625521 49
163 3300009177 Ga0105248_10088095 Ga0105248_100880956 49
164 3300009545 Ga0105237_10000151 Ga0105237_1000015166 49
165 3300009553 Ga0105249_10953292 Ga0105249_109532923 49
166 3300010159 Ga0099796_10091027 Ga0099796_100910273 49
167 3300010159 Ga0099796_10142282 Ga0099796_101422822 49
168 3300010159 Ga0099796_10282840 Ga0099796_102828402 49
169 3300010375 Ga0105239_10082436 Ga0105239_100824364 49
170 3300010375 Ga0105239_10115727 Ga0105239_101157271 49
171 3300010375 Ga0105239_10413795 Ga0105239_104137952 49
172 3300010375 Ga0105239_11868604 Ga0105239_118686042 49
173 3300011119 Ga0105246_11469724 Ga0105246_114697242 49
174 3300011119 Ga0105246_11980337 Ga0105246_119803371 49
175 3300013104 Ga0157370_10119841 Ga0157370_101198414 49
176 3300013105 Ga0157369_11793261 Ga0157369_117932611 49
177 3300013297 Ga0157378_10000185 Ga0157378_1000018528 49
178 3300013297 Ga0157378_10468101 Ga0157378_104681012 49
179 3300013306 Ga0163162_10005281 Ga0163162_100052815 49
180 3300013306 Ga0163162_11740584 Ga0163162_117405842 49
181 3300013306 Ga0163162_11951614 Ga0163162_119516142 49
182 3300013307 Ga0157372_10128756 Ga0157372_101287563 49
183 3300013307 Ga0157372_11693659 Ga0157372_116936592 49
184 3300013307 Ga0157372_11986590 Ga0157372_119865902 49
185 3300013308 Ga0157375_10404946 Ga0157375_104049463 49
186 3300013308 Ga0157375_12874836 Ga0157375_128748361 49
187 3300014325 Ga0163163_10481664 Ga0163163_104816643 49
188 3300014325 Ga0163163_11079938 Ga0163163_110799382 49
189 3300014326 Ga0157380_10618256 Ga0157380_106182562 49
190 3300014745 Ga0157377_10398796 Ga0157377_103987963 49
191 3300014968 Ga0157379_10219183 Ga0157379_102191833 49
192 3300014968 Ga0157379_10511829 Ga0157379_105118293 49
193 3300014968 Ga0157379_10960857 Ga0157379_109608572 49
194 3300014969 Ga0157376_10879038 Ga0157376_108790381 49
195 3300015265 Ga0182005_1206618 Ga0182005_12066181 49
196 3300020070 Ga0206356_11546949 Ga0206356_115469493 49
197 3300020075 Ga0206349_1447815 Ga0206349_14478153 49
198 3300020078 Ga0206352_10155209 Ga0206352_101552091 49
199 3300020078 Ga0206352_11013089 Ga0206352_110130895 49
200 3300021384 Ga0213876_10520575 Ga0213876_105205752 49
201 3300021384 Ga0213876_10733762 Ga0213876_107337621 49
202 3300025898 Ga0207692_10953786 Ga0207692_109537862 49
203 3300025899 Ga0207642_10163481 Ga0207642_101634813 49
204 3300025899 Ga0207642_10763334 Ga0207642_107633342 49
205 3300025905 Ga0207685_10035766 Ga0207685_100357662 49
206 3300025905 Ga0207685_10621967 Ga0207685_106219671 49
207 3300025905 Ga0207685_10704095 Ga0207685_107040952 49
208 3300025905 Ga0207685_10813302 Ga0207685_108133022 49
209 3300025906 Ga0207699_10001019 Ga0207699_1000101913 49
210 3300025906 Ga0207699_10355094 Ga0207699_103550943 49
211 3300025906 Ga0207699_10527595 Ga0207699_105275952 49
212 3300025906 Ga0207699_11351708 Ga0207699_113517081 49
213 3300025909 Ga0207705_10046957 Ga0207705_100469573 49
214 3300025910 Ga0207684_10207295 Ga0207684_102072953 49
215 3300025912 Ga0207707_10298100 Ga0207707_102981001 49
216 3300025914 Ga0207671_10001259 Ga0207671_1000125912 49
217 3300025914 Ga0207671_10446370 Ga0207671_104463702 49
218 3300025915 Ga0207693_10032697 Ga0207693_100326974 49
219 3300025915 Ga0207693_10069928 Ga0207693_100699283 49
220 3300025915 Ga0207693_10128538 Ga0207693_101285381 49
221 3300025916 Ga0207663_10437974 Ga0207663_104379742 49
222 3300025917 Ga0207660_10023409 Ga0207660_100234091 49
223 3300025921 Ga0207652_10003090 Ga0207652_100030905 49
224 3300025921 Ga0207652_10014841 Ga0207652_100148417 49
225 3300025922 Ga0207646_10000472 Ga0207646_1000047227 49
226 3300025922 Ga0207646_10012427 Ga0207646_100124275 49
227 3300025922 Ga0207646_10062627 Ga0207646_100626272 49
228 3300025922 Ga0207646_10515249 Ga0207646_105152492 49
229 3300025922 Ga0207646_10583534 Ga0207646_105835342 49
230 3300025924 Ga0207694_10872371 Ga0207694_108723711 49
231 3300025927 Ga0207687_10640601 Ga0207687_106406011 49
232 3300025928 Ga0207700_10068779 Ga0207700_100687794 49
233 3300025928 Ga0207700_10071786 Ga0207700_100717863 49
234 3300025928 Ga0207700_10101556 Ga0207700_101015561 49
235 3300025928 Ga0207700_10210369 Ga0207700_102103692 49
236 3300025928 Ga0207700_10320247 Ga0207700_103202472 49
237 3300025928 Ga0207700_10401344 Ga0207700_104013441 49
238 3300025928 Ga0207700_11797651 Ga0207700_117976512 49
239 3300025928 Ga0207700_11928959 Ga0207700_119289591 49
240 3300025929 Ga0207664_10133959 Ga0207664_101339592 49
241 3300025929 Ga0207664_10140748 Ga0207664_101407484 49
242 3300025929 Ga0207664_10178774 Ga0207664_101787741 49
243 3300025929 Ga0207664_10274962 Ga0207664_102749622 49
244 3300025929 Ga0207664_11917702 Ga0207664_119177021 49
245 3300025932 Ga0207690_11054981 Ga0207690_110549812 49
246 3300025933 Ga0207706_10926317 Ga0207706_109263172 49
247 3300025934 Ga0207686_10158528 Ga0207686_101585282 49
248 3300025934 Ga0207686_10486985 Ga0207686_104869852 49
249 3300025936 Ga0207670_10000002 Ga0207670_10000002655 49
250 3300025936 Ga0207670_11236123 Ga0207670_112361232 49
251 3300025939 Ga0207665_10001016 Ga0207665_1000101610 49
252 3300025939 Ga0207665_10016213 Ga0207665_100162138 49
253 3300025939 Ga0207665_10070674 Ga0207665_100706742 49
254 3300025939 Ga0207665_10432421 Ga0207665_104324212 49
255 3300025940 Ga0207691_11215116 Ga0207691_112151162 49
256 3300025941 Ga0207711_11130779 Ga0207711_111307792 49
257 3300025941 Ga0207711_11650589 Ga0207711_116505891 49
258 3300025942 Ga0207689_11196538 Ga0207689_111965382 49
259 3300025949 Ga0207667_10128298 Ga0207667_101282984 49
260 3300025949 Ga0207667_10491161 Ga0207667_104911612 49
261 3300025960 Ga0207651_10712060 Ga0207651_107120602 49
262 3300025972 Ga0207668_11473891 Ga0207668_114738912 49
263 3300025981 Ga0207640_10913750 Ga0207640_109137502 49
264 3300026035 Ga0207703_10228835 Ga0207703_102288352 49
265 3300026035 Ga0207703_10450601 Ga0207703_104506011 49
266 3300026035 Ga0207703_11207706 Ga0207703_112077062 49
267 3300026078 Ga0207702_10303853 Ga0207702_103038533 49
268 3300026078 Ga0207702_10894410 Ga0207702_108944103 49
269 3300026088 Ga0207641_10242871 Ga0207641_102428713 49
270 3300026089 Ga0207648_10451979 Ga0207648_104519792 49
271 3300026095 Ga0207676_10620146 Ga0207676_106201462 49
272 3300026095 Ga0207676_10873200 Ga0207676_108732002 49
273 3300026116 Ga0207674_10055162 Ga0207674_100551628 49
274 3300026116 Ga0207674_10073650 Ga0207674_100736502 49
275 3300026116 Ga0207674_10299159 Ga0207674_102991592 49
276 3300026118 Ga0207675_101751709 Ga0207675_1017517092 49
277 3300026121 Ga0207683_11183224 Ga0207683_111832242 49
278 3300027512 Ga0209179_1005202 Ga0209179_10052022 49
279 3300027512 Ga0209179_1010011 Ga0209179_10100113 49
280 3300027671 Ga0209588_1031914 Ga0209588_10319144 49
281 3300027671 Ga0209588_1114198 Ga0209588_11141984 49
282 3300028381 Ga0268264_10084179 Ga0268264_100841793 49
283 3300028381 Ga0268264_10855655 Ga0268264_108556552 49
284 3300028381 Ga0268264_11156099 Ga0268264_111560992 49
285 3300030762 Ga0265775_102738 Ga0265775_1027382 49
286 3300031251 Ga0265327_10003326 Ga0265327_100033269 49
287 3300031251 Ga0265327_10188426 Ga0265327_101884262 49
288 3300035083 Ga0373926_0363201 Ga0373926_0363201_264_419 49
289 3300035086 Ga0373934_0000393 Ga0373934_0000393_13158_13307 49
290 3300035111 Ga0373923_0048157 Ga0373923_0048157_889_1038 49
291 3300035117 Ga0373953_0104701 Ga0373953_0104701_759_908 49
292 3300035119 Ga0373956_0006130 Ga0373956_0006130_1376_1525 49
293 3300035171 Ga0373946_0550702 Ga0373946_0550702_33_182 49
294 3300035172 Ga0373955_0008806 Ga0373955_0008806_4161_4310 49
295 3300035172 Ga0373955_0151360 Ga0373955_0151360_1020_1169 49
296 3300035410 Ga0373924_0205936 Ga0373924_0205936_436_585 49
297 3300035410 Ga0373924_0486823 Ga0373924_0486823_51_200 49
298 3300035692 Ga0373935_0067686 Ga0373935_0067686_1932_2081 49
299 3300035692 Ga0373935_0438003 Ga0373935_0438003_781_930 49
300 3300035695 Ga0373927_0365131 Ga0373927_0365131_105_254 49
301 3300035724 Ga0373933_0047005 Ga0373933_0047005_598_747 49
302 3300035724 Ga0373933_0871632 Ga0373933_0871632_282_431 49
303 3300036401 Ga0373937_0000192 Ga0373937_0000192_6543_6692 49
304 3300036401 Ga0373937_0140427 Ga0373937_0140427_1651_1800 49
305 3300036401 Ga0373937_0804676 Ga0373937_0804676_436_585 49
306 3300036457 Ga0265778_024805 Ga0265778_024805_62_217 49
307 3300037068 Ga0373925_0411329 Ga0373925_0411329_870_1019 49
308 3300037068 Ga0373925_0471525 Ga0373925_0471525_621_776 49
309 3300037471 Ga0395905_0148928 Ga0395905_0148928_1847_1996 49
310 3300039437 Ga0436365_0020432 Ga0436365_0020432_262_417 49
311 3300039437 Ga0436365_0582251 Ga0436365_0582251_2936_3091 49
312 3300039437 Ga0436365_0967462 Ga0436365_0967462_74_229 49
313 3300039450 Ga0436363_1308970 Ga0436363_1308970_220_369 49
314 3300041486 Ga0451807_0995951 Ga0451807_0995951_236_385 49
315 3300041512 Ga0451853_1121466 Ga0451853_1121466_763_912 49
316 3300042876 Ga0451577_0000082 Ga0451577_0000082_138889_139038 49
317 3300042876 Ga0451577_0004854 Ga0451577_0004854_9915_10064 49
318 3300042876 Ga0451577_0072471 Ga0451577_0072471_654_803 49
319 3300042876 Ga0451577_1887681 Ga0451577_1887681_96_245 49
320 3300044673 Ga0453683_0063687 Ga0453683_0063687_169_318 49
321 3300044712 Ga0453684_0001652 Ga0453684_0001652_25396_25545 49
322 3300044712 Ga0453684_0030371 Ga0453684_0030371_3346_3495 49
323 3300044712 Ga0453684_1558730 Ga0453684_1558730_387_536 49
324 3300045051 Ga0451576_0994484 Ga0451576_0994484_302_457 49
325 3300046454 Ga0495592_0342858 Ga0495592_0342858_408_557 49
326 3300046462 Ga0495651_0152299 Ga0495651_0152299_915_1064 49
327 3300046477 Ga0495664_0395503 Ga0495664_0395503_466_621 49
328 3300046514 Ga0495618_0248377 Ga0495618_0248377_624_773 49
329 3300046516 Ga0495628_0124228 Ga0495628_0124228_779_928 49
330 3300046535 Ga0495586_0049939 Ga0495586_0049939_1732_1881 49
331 3300046543 Ga0495645_0242198 Ga0495645_0242198_884_1033 49
332 3300046663 Ga0495635_0413554 Ga0495635_0413554_62_211 49
333 3300046678 Ga0495599_0068632 Ga0495599_0068632_52_201 49
334 3300046679 Ga0495623_0422217 Ga0495623_0422217_252_407 49
335 3300046680 Ga0495646_0427607 Ga0495646_0427607_363_518 49
336 3300046680 Ga0495646_0488585 Ga0495646_0488585_348_497 49
337 3300046809 Ga0495600_0677132 Ga0495600_0677132_173_322 49
338 3300047319 Ga0495674_0071803 Ga0495674_0071803_15_164 49
339 3300047322 Ga0495680_0081659 Ga0495680_0081659_2008_2157 49
340 3300047471 Ga0495684_0632016 Ga0495684_0632016_316_471 49
341 3300048088 Ga0495602_0263802 Ga0495602_0263802_999_1154 49
342 3300048903 Ga0496100_1220194 Ga0496100_1220194_62_217 49
343 3300048905 Ga0496102_0015347 Ga0496102_0015347_6339_6494 49
344 3300048906 Ga0496103_0089197 Ga0496103_0089197_1002_1157 49
345 3300048907 Ga0496104_0140304 Ga0496104_0140304_1683_1838 49
346 3300048907 Ga0496104_0230714 Ga0496104_0230714_735_884 49
347 3300048907 Ga0496104_1875733 Ga0496104_1875733_335_484 49
348 3300048909 Ga0496106_0027732 Ga0496106_0027732_571_726 49
349 3300048915 Ga0496112_1264568 Ga0496112_1264568_95_250 49
350 3300048918 Ga0496115_0721648 Ga0496115_0721648_585_740 49
351 3300048918 Ga0496115_1345453 Ga0496115_1345453_180_329 49
352 3300050510 nmdc:mga06r32_137806_c1 nmdc:mga06r32_137806_c1_1675_1824 49
353 3300050510 nmdc:mga06r32_5055_c1 nmdc:mga06r32_5055_c1_9243_9392 49
354 3300050510 nmdc:mga06r32_600752_c1 nmdc:mga06r32_600752_c1_338_487 49
355 3300050515 nmdc:mga0a205_1010873_c1 nmdc:mga0a205_1010873_c1_364_519 49
356 3300053078 Ga0495612_0443315 Ga0495612_0443315_17_166 49
357 3300053085 Ga0495619_0020280 Ga0495619_0020280_2226_2381 49
358 3300053119 Ga0500595_022033 Ga0500595_022033_1224_1373 49
359 3300053119 Ga0500595_049142 Ga0500595_049142_433_582 49
360 3300053138 Ga0500564_060547 Ga0500564_060547_53_202 49
361 3300053139 Ga0500568_0000329 Ga0500568_0000329_7679_7828 49
362 3300059490 Ga0587066_055940 Ga0587066_055940_547_702 49
363 3300059492 Ga0587073_0040966 Ga0587073_0040966_680_835 49
364 3300059492 Ga0587073_0055836 Ga0587073_0055836_246_401 49
365 3300059493 Ga0587077_240189 Ga0587077_240189_256_411 49
366 3300059503 Ga0587080_035738 Ga0587080_035738_557_712 49
367 3300059504 Ga0587082_185425 Ga0587082_185425_279_434 49
368 3300059643 Ga0587072_188475 Ga0587072_188475_186_341 49
369 3300059652 Ga0587107_039077 Ga0587107_039077_48_203 49
370 3300059652 Ga0587107_122548 Ga0587107_122548_92_247 49
371 3300001976 JGI24752J21851_1003164 JGI24752J21851_10031642 50
372 3300001991 JGI24743J22301_10005886 JGI24743J22301_100058863 50
373 3300002073 JGI24745J21846_1016410 JGI24745J21846_10164101 50
374 3300002074 JGI24748J21848_1011022 JGI24748J21848_10110222 50
375 3300002239 JGI24034J26672_10045692 JGI24034J26672_100456922 50
376 3300002459 JGI24751J29686_10001680 JGI24751J29686_100016803 50
377 3300005290 Ga0065712_10370906 Ga0065712_103709062 50
378 3300005295 Ga0065707_10320550 Ga0065707_103205502 50
379 3300005329 Ga0070683_100007493 Ga0070683_1000074938 50
380 3300005329 Ga0070683_100735285 Ga0070683_1007352852 50
381 3300005330 Ga0070690_100600720 Ga0070690_1006007202 50
382 3300005334 Ga0068869_100155933 Ga0068869_1001559332 50
383 3300005337 Ga0070682_100038123 Ga0070682_1000381233 50
384 3300005338 Ga0068868_100012529 Ga0068868_1000125293 50
385 3300005338 Ga0068868_100013166 Ga0068868_1000131664 50
386 3300005339 Ga0070660_100059277 Ga0070660_1000592772 50
387 3300005339 Ga0070660_100517788 Ga0070660_1005177882 50
388 3300005340 Ga0070689_100053569 Ga0070689_1000535693 50
389 3300005340 Ga0070689_100302276 Ga0070689_1003022763 50
390 3300005344 Ga0070661_100003544 Ga0070661_1000035443 50
391 3300005344 Ga0070661_100856807 Ga0070661_1008568072 50
392 3300005353 Ga0070669_100644003 Ga0070669_1006440032 50
393 3300005356 Ga0070674_100001002 Ga0070674_1000010028 50
394 3300005364 Ga0070673_100371481 Ga0070673_1003714811 50
395 3300005365 Ga0070688_100405382 Ga0070688_1004053823 50
396 3300005366 Ga0070659_100012377 Ga0070659_1000123771 50
397 3300005367 Ga0070667_100059176 Ga0070667_1000591762 50
398 3300005434 Ga0070709_11239556 Ga0070709_112395562 50
399 3300005435 Ga0070714_100684197 Ga0070714_1006841973 50
400 3300005436 Ga0070713_100031741 Ga0070713_1000317414 50
401 3300005437 Ga0070710_10388641 Ga0070710_103886411 50
402 3300005439 Ga0070711_100025034 Ga0070711_1000250345 50
403 3300005444 Ga0070694_101201610 Ga0070694_1012016101 50
404 3300005457 Ga0070662_100021878 Ga0070662_1000218786 50
405 3300005466 Ga0070685_10004460 Ga0070685_100044603 50
406 3300005471 Ga0070698_100052145 Ga0070698_1000521452 50
407 3300005535 Ga0070684_101107426 Ga0070684_1011074262 50
408 3300005539 Ga0068853_100022607 Ga0068853_1000226073 50
409 3300005543 Ga0070672_100127165 Ga0070672_1001271653 50
410 3300005544 Ga0070686_101784613 Ga0070686_1017846132 50
411 3300005547 Ga0070693_100563738 Ga0070693_1005637381 50
412 3300005548 Ga0070665_101399567 Ga0070665_1013995671 50
413 3300005548 Ga0070665_101834399 Ga0070665_1018343991 50
414 3300005549 Ga0070704_101902433 Ga0070704_1019024332 50
415 3300005563 Ga0068855_100190636 Ga0068855_1001906361 50
416 3300005564 Ga0070664_100047275 Ga0070664_1000472752 50
417 3300005564 Ga0070664_100064395 Ga0070664_1000643952 50
418 3300005577 Ga0068857_100004945 Ga0068857_10000494511 50
419 3300005578 Ga0068854_100189527 Ga0068854_1001895273 50
420 3300005614 Ga0068856_100006884 Ga0068856_10000688410 50
421 3300005615 Ga0070702_100042825 Ga0070702_1000428252 50
422 3300005616 Ga0068852_100033192 Ga0068852_1000331922 50
423 3300005618 Ga0068864_100019656 Ga0068864_1000196567 50
424 3300005618 Ga0068864_100218377 Ga0068864_1002183773 50
425 3300005718 Ga0068866_10008281 Ga0068866_100082812 50
426 3300005719 Ga0068861_100597042 Ga0068861_1005970422 50
427 3300005719 Ga0068861_101631807 Ga0068861_1016318071 50
428 3300005834 Ga0068851_10001293 Ga0068851_100012933 50
429 3300005840 Ga0068870_10003151 Ga0068870_100031516 50
430 3300005841 Ga0068863_100042710 Ga0068863_1000427101 50
431 3300005841 Ga0068863_100190082 Ga0068863_1001900823 50
432 3300005842 Ga0068858_100067306 Ga0068858_1000673063 50
433 3300005843 Ga0068860_100028673 Ga0068860_1000286733 50
434 3300005844 Ga0068862_100019961 Ga0068862_1000199612 50
435 3300006028 Ga0070717_10209605 Ga0070717_102096053 50
436 3300006163 Ga0070715_10904658 Ga0070715_109046582 50
437 3300006175 Ga0070712_100399485 Ga0070712_1003994853 50
438 3300006237 Ga0097621_100206182 Ga0097621_1002061821 50
439 3300006881 Ga0068865_100162324 Ga0068865_1001623241 50
440 3300006881 Ga0068865_100448212 Ga0068865_1004482122 50
441 3300009011 Ga0105251_10036448 Ga0105251_100364483 50
442 3300009094 Ga0111539_10792091 Ga0111539_107920912 50
443 3300009098 Ga0105245_10040249 Ga0105245_100402492 50
444 3300009101 Ga0105247_10002094 Ga0105247_100020943 50
445 3300009148 Ga0105243_10929491 Ga0105243_109294911 50
446 3300009174 Ga0105241_10009943 Ga0105241_100099432 50
447 3300009176 Ga0105242_10137668 Ga0105242_101376683 50
448 3300009545 Ga0105237_10804750 Ga0105237_108047501 50
449 3300009545 Ga0105237_11840103 Ga0105237_118401031 50
450 3300009551 Ga0105238_10105703 Ga0105238_101057032 50
451 3300009551 Ga0105238_13072471 Ga0105238_130724711 50
452 3300009553 Ga0105249_10140893 Ga0105249_101408933 50
453 3300009553 Ga0105249_13150424 Ga0105249_131504242 50
454 3300009553 Ga0105249_13368626 Ga0105249_133686262 50
455 3300010375 Ga0105239_10012012 Ga0105239_100120121 50
456 3300010375 Ga0105239_12424988 Ga0105239_124249881 50
457 3300011119 Ga0105246_10612286 Ga0105246_106122862 50
458 3300011119 Ga0105246_12517096 Ga0105246_125170962 50
459 3300013100 Ga0157373_10032674 Ga0157373_100326741 50
460 3300013105 Ga0157369_10008874 Ga0157369_100088743 50
461 3300013296 Ga0157374_10108758 Ga0157374_101087582 50
462 3300013297 Ga0157378_10962918 Ga0157378_109629181 50
463 3300013306 Ga0163162_10024158 Ga0163162_100241583 50
464 3300013307 Ga0157372_10009715 Ga0157372_100097158 50
465 3300014325 Ga0163163_10018915 Ga0163163_100189157 50
466 3300014325 Ga0163163_10565885 Ga0163163_105658852 50
467 3300014326 Ga0157380_10389989 Ga0157380_103899891 50
468 3300014745 Ga0157377_10026235 Ga0157377_100262352 50
469 3300014969 Ga0157376_10123068 Ga0157376_101230683 50
470 3300014969 Ga0157376_12127974 Ga0157376_121279741 50
471 3300014969 Ga0157376_12591463 Ga0157376_125914631 50
472 3300017792 Ga0163161_10093744 Ga0163161_100937442 50
473 3300025315 Ga0207697_10000518 Ga0207697_100005186 50
474 3300025321 Ga0207656_10117860 Ga0207656_101178602 50
475 3300025893 Ga0207682_10018953 Ga0207682_100189533 50
476 3300025899 Ga0207642_10004682 Ga0207642_100046826 50
477 3300025901 Ga0207688_10017554 Ga0207688_100175543 50
478 3300025903 Ga0207680_10197707 Ga0207680_101977072 50
479 3300025904 Ga0207647_10026399 Ga0207647_100263993 50
480 3300025906 Ga0207699_11045604 Ga0207699_110456041 50
481 3300025907 Ga0207645_10000351 Ga0207645_1000035115 50
482 3300025908 Ga0207643_10001192 Ga0207643_100011925 50
483 3300025909 Ga0207705_10020482 Ga0207705_100204822 50
484 3300025911 Ga0207654_10139362 Ga0207654_101393622 50
485 3300025916 Ga0207663_10004898 Ga0207663_100048988 50
486 3300025917 Ga0207660_10560942 Ga0207660_105609421 50
487 3300025918 Ga0207662_10048072 Ga0207662_100480723 50
488 3300025919 Ga0207657_10004756 Ga0207657_100047567 50
489 3300025920 Ga0207649_10000928 Ga0207649_100009285 50
490 3300025920 Ga0207649_10293879 Ga0207649_102938792 50
491 3300025921 Ga0207652_11109570 Ga0207652_111095702 50
492 3300025923 Ga0207681_10053608 Ga0207681_100536081 50
493 3300025924 Ga0207694_10067452 Ga0207694_100674522 50
494 3300025925 Ga0207650_10000059 Ga0207650_10000059104 50
495 3300025926 Ga0207659_10243074 Ga0207659_102430742 50
496 3300025928 Ga0207700_10220130 Ga0207700_102201303 50
497 3300025929 Ga0207664_10772203 Ga0207664_107722033 50
498 3300025931 Ga0207644_10001085 Ga0207644_100010856 50
499 3300025931 Ga0207644_10007479 Ga0207644_100074794 50
500 3300025932 Ga0207690_10038534 Ga0207690_100385343 50
501 3300025933 Ga0207706_10006275 Ga0207706_100062751 50
502 3300025934 Ga0207686_10177888 Ga0207686_101778882 50
503 3300025935 Ga0207709_10694792 Ga0207709_106947921 50
504 3300025936 Ga0207670_10133977 Ga0207670_101339772 50
505 3300025936 Ga0207670_10150983 Ga0207670_101509832 50
506 3300025937 Ga0207669_10154690 Ga0207669_101546901 50
507 3300025941 Ga0207711_10185744 Ga0207711_101857442 50
508 3300025942 Ga0207689_10174160 Ga0207689_101741602 50
509 3300025944 Ga0207661_10000352 Ga0207661_1000035213 50
510 3300025944 Ga0207661_10601931 Ga0207661_106019312 50
511 3300025945 Ga0207679_10000039 Ga0207679_1000003947 50
512 3300025945 Ga0207679_10017715 Ga0207679_100177156 50
513 3300025945 Ga0207679_10037556 Ga0207679_100375562 50
514 3300025949 Ga0207667_10222582 Ga0207667_102225823 50
515 3300025960 Ga0207651_10003379 Ga0207651_100033795 50
516 3300025961 Ga0207712_10127027 Ga0207712_101270272 50
517 3300025961 Ga0207712_10798208 Ga0207712_107982084 50
518 3300025961 Ga0207712_11189374 Ga0207712_111893741 50
519 3300025972 Ga0207668_10115880 Ga0207668_101158802 50
520 3300025981 Ga0207640_10171684 Ga0207640_101716841 50
521 3300025986 Ga0207658_10003811 Ga0207658_1000381110 50
522 3300026023 Ga0207677_10015370 Ga0207677_100153705 50
523 3300026023 Ga0207677_10088616 Ga0207677_100886163 50
524 3300026035 Ga0207703_10073189 Ga0207703_100731893 50
525 3300026041 Ga0207639_10033545 Ga0207639_100335455 50
526 3300026078 Ga0207702_10323491 Ga0207702_103234912 50
527 3300026088 Ga0207641_10000025 Ga0207641_10000025106 50
528 3300026088 Ga0207641_10222687 Ga0207641_102226872 50
529 3300026088 Ga0207641_10277866 Ga0207641_102778662 50
530 3300026089 Ga0207648_10000420 Ga0207648_1000042017 50
531 3300026095 Ga0207676_10000104 Ga0207676_1000010414 50
532 3300026095 Ga0207676_11031572 Ga0207676_110315722 50
533 3300026116 Ga0207674_10000604 Ga0207674_1000060416 50
534 3300026116 Ga0207674_10414924 Ga0207674_104149242 50
535 3300026118 Ga0207675_100658481 Ga0207675_1006584812 50
536 3300026121 Ga0207683_10000726 Ga0207683_1000072614 50
537 3300026142 Ga0207698_10491622 Ga0207698_104916222 50
538 3300028379 Ga0268266_10004403 Ga0268266_1000440311 50
539 3300028379 Ga0268266_11426750 Ga0268266_114267501 50
540 3300028380 Ga0268265_10007199 Ga0268265_100071997 50
541 3300028381 Ga0268264_10177350 Ga0268264_101773503 50
542 3300028577 Ga0265318_10000442 Ga0265318_100004424 50
543 3300028800 Ga0265338_10023680 Ga0265338_100236807 50
544 3300031090 Ga0265760_10029199 Ga0265760_100291992 50
545 3300031090 Ga0265760_10342146 Ga0265760_103421461 50
546 3300031238 Ga0265332_10369644 Ga0265332_103696441 50
547 3300031240 Ga0265320_10008116 Ga0265320_100081164 50
548 3300031241 Ga0265325_10027884 Ga0265325_100278845 50
549 3300031242 Ga0265329_10001439 Ga0265329_100014392 50
550 3300031247 Ga0265340_10017289 Ga0265340_100172893 50
551 3300031249 Ga0265339_10003070 Ga0265339_1000307018 50
552 3300031250 Ga0265331_10000360 Ga0265331_1000036015 50
553 3300031344 Ga0265316_10004633 Ga0265316_100046334 50
554 3300031595 Ga0265313_10018793 Ga0265313_100187931 50
555 3300031712 Ga0265342_10000649 Ga0265342_1000064919 50
556 3300035086 Ga0373934_0001662 Ga0373934_0001662_7675_7833 50
557 3300035117 Ga0373953_0002652 Ga0373953_0002652_1803_1961 50
558 3300035118 Ga0373954_0002072 Ga0373954_0002072_2081_2239 50
559 3300035119 Ga0373956_0003602 Ga0373956_0003602_3041_3199 50
560 3300035120 Ga0373957_0039484 Ga0373957_0039484_1582_1740 50
561 3300035172 Ga0373955_0000064 Ga0373955_0000064_12786_12944 50
562 3300035724 Ga0373933_0001374 Ga0373933_0001374_4103_4261 50
563 3300036401 Ga0373937_0019024 Ga0373937_0019024_1470_1628 50
564 3300036401 Ga0373937_0546118 Ga0373937_0546118_468_620 50
565 3300036401 Ga0373937_1936651 Ga0373937_1936651_20_178 50
566 3300038996 Ga0242420_145848 Ga0242420_145848_292_444 50
567 3300039450 Ga0436363_0235155 Ga0436363_0235155_1201_1359 50
568 3300039450 Ga0436363_0571601 Ga0436363_0571601_65_217 50
569 3300046462 Ga0495651_0163775 Ga0495651_0163775_715_873 50
570 3300046477 Ga0495664_0884174 Ga0495664_0884174_342_494 50
571 3300046499 Ga0495594_0022843 Ga0495594_0022843_775_927 50
572 3300046511 Ga0495608_0041262 Ga0495608_0041262_2544_2702 50
573 3300046528 Ga0495642_0282888 Ga0495642_0282888_152_304 50
574 3300046529 Ga0495652_0057328 Ga0495652_0057328_2717_2875 50
575 3300046533 Ga0495640_0398345 Ga0495640_0398345_656_808 50
576 3300046535 Ga0495586_0062695 Ga0495586_0062695_463_615 50
577 3300046536 Ga0495587_0002611 Ga0495587_0002611_2137_2295 50
578 3300046642 Ga0495634_0036138 Ga0495634_0036138_23_175 50
579 3300046663 Ga0495635_0124258 Ga0495635_0124258_1003_1161 50
580 3300046663 Ga0495635_0493887 Ga0495635_0493887_525_677 50
581 3300046679 Ga0495623_0018612 Ga0495623_0018612_4050_4208 50
582 3300046683 Ga0495658_0281546 Ga0495658_0281546_44_196 50
583 3300046684 Ga0495669_0391046 Ga0495669_0391046_131_283 50
584 3300046689 Ga0495613_0201033 Ga0495613_0201033_496_648 50
585 3300047317 Ga0495604_0000524 Ga0495604_0000524_10624_10782 50
586 3300047318 Ga0495636_0166217 Ga0495636_0166217_320_472 50
587 3300047319 Ga0495674_0658903 Ga0495674_0658903_15_167 50
588 3300047319 Ga0495674_0700268 Ga0495674_0700268_399_551 50
589 3300047322 Ga0495680_0984067 Ga0495680_0984067_93_245 50
590 3300047471 Ga0495684_0036844 Ga0495684_0036844_72_230 50
591 3300048088 Ga0495602_0006680 Ga0495602_0006680_3384_3542 50
592 3300048903 Ga0496100_0367154 Ga0496100_0367154_737_889 50
593 3300048905 Ga0496102_0063793 Ga0496102_0063793_1694_1846 50
594 3300048905 Ga0496102_0184083 Ga0496102_0184083_1502_1654 50
595 3300048908 Ga0496105_0175126 Ga0496105_0175126_1555_1707 50
596 3300048909 Ga0496106_1400236 Ga0496106_1400236_107_259 50
597 3300048911 Ga0496108_0000539 Ga0496108_0000539_25818_25970 50
598 3300048912 Ga0496109_0000099 Ga0496109_0000099_75204_75356 50
599 3300048913 Ga0496110_0003615 Ga0496110_0003615_1853_2005 50
600 3300048915 Ga0496112_0000043 Ga0496112_0000043_37685_37837 50
601 3300048915 Ga0496112_0769740 Ga0496112_0769740_313_465 50
602 3300048916 Ga0496113_0000107 Ga0496113_0000107_6604_6756 50
603 3300048918 Ga0496115_0103742 Ga0496115_0103742_2041_2193 50
604 3300050512 nmdc:mga0n895_19616_c1 nmdc:mga0n895_19616_c1_4765_4917 50
605 3300050513 nmdc:mga0rr50_182967_c1 nmdc:mga0rr50_182967_c1_770_922 50
606 3300050515 nmdc:mga0a205_218599_c1 nmdc:mga0a205_218599_c1_688_840 50
607 3300053085 Ga0495619_0242953 Ga0495619_0242953_884_1042 50
608 3300059477 Ga0587084_101856 Ga0587084_101856_415_567 50
609 3300059478 Ga0587093_035150 Ga0587093_035150_168_320 50

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18919

DUF5670

Family of unknown function (DUF5670)

10

53

0.96

Feature Viewer

pLDDT pTM Quality
86.7 0.43 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map