F468874

General Info

Members Datasets Scaffolds Average Seq Length
609 302 609 198

Family's Representative Sequence

Representative Sequence 3300026035|Ga0207703_10368809|Ga0207703_103688092
Length 212
Sequence MAKYTTAAVQPPLRKRRQIRQDPRPERPLVYERLSDPILVKRAKDGDAKALAALVERHAPRAERLAAHVLADPEDARDAAQEALAKLCVRLRQFRGDSQFATWFHRLVVNTCLDVGDRQRGRRCEPLHEDERVAPDGDPTREMALSELRHELAAELAELSDEQASVVVLKDALGFSFAEISERSGMPVGTAKCYAHRARAGLRARLTDEHAA

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
88 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
89 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
108 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
162 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
163 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
164 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
165 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
166 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
167 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
168 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
169 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
170 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
171 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
172 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
173 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
174 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
175 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
176 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
177 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
178 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
179 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
180 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
181 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
182 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
183 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
184 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
185 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
186 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
187 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
188 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
189 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
190 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
191 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
192 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
193 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
194 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
195 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
196 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
197 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
198 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
199 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
200 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
201 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
202 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
203 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
204 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
205 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
206 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
207 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
208 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
209 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
210 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
211 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
212 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
213 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
214 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
215 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
216 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
217 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
218 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
219 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
220 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
221 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
222 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
223 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
224 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
225 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
226 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
227 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
228 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
229 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
230 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
231 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
232 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
233 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
234 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
235 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
236 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
237 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
238 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
239 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
240 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
241 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
242 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
243 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
244 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
245 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
246 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
247 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
248 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
249 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
250 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
251 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
252 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
253 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
254 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
255 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
256 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
257 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
258 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
259 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
260 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
261 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
262 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
263 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
264 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
265 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
266 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
267 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
268 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
269 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
270 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
271 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
276 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
280 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
281 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
282 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
283 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
284 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
285 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
286 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
287 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
288 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
289 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
290 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
291 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
292 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
293 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
294 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
295 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
296 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
297 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
298 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
299 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
300 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
301 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
302 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.85
Metatranscriptomes 1.15
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 11.99
Rhizosphere 87.03
Stem 0
Stem Tuber 0
Unclassified 0.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10005299 3300005327 Bacteria 10469
2 Ga0070676_10081876 3300005328 Bacteria 1960
3 Ga0070676_10334144 3300005328 Unclassified 1037
4 Ga0070683_100138930 3300005329 Bacteria 2301
5 Ga0070683_100343345 3300005329 Bacteria 1422
6 Ga0070690_100209833 3300005330 Unclassified 1359
7 Ga0070680_100017431 3300005336 Bacteria 5664
8 Ga0070680_100070859 3300005336 Bacteria 2864
9 Ga0070680_100225641 3300005336 Bacteria 1581
10 Ga0070682_100095236 3300005337 Bacteria 1955
11 Ga0070682_100195563 3300005337 Bacteria 1423
12 Ga0070682_100278148 3300005337 Bacteria 1219
13 Ga0070682_100500317 3300005337 Bacteria 941
14 Ga0068868_100021788 3300005338 Bacteria 4828
15 Ga0068868_100167146 3300005338 Bacteria 1820
16 Ga0070660_100002486 3300005339 Bacteria 12647
17 Ga0070660_100031245 3300005339 Bacteria 3998
18 Ga0070660_100050719 3300005339 Bacteria 3193
19 Ga0070689_100358758 3300005340 Bacteria 1224
20 Ga0070689_100507162 3300005340 Bacteria 1034
21 Ga0070691_10074907 3300005341 Bacteria 1648
22 Ga0070691_10135809 3300005341 Bacteria 1250
23 Ga0070687_100146084 3300005343 Bacteria 1383
24 Ga0070661_100037444 3300005344 Bacteria 3529
25 Ga0070661_100065602 3300005344 Bacteria 2667
26 Ga0070668_100122738 3300005347 Bacteria 2078
27 Ga0070669_100064010 3300005353 Bacteria 2708
28 Ga0070671_100167077 3300005355 Bacteria 1860
29 Ga0070671_100440162 3300005355 Bacteria 1117
30 Ga0070674_100027862 3300005356 Bacteria 3705
31 Ga0070673_100032982 3300005364 Bacteria 3905
32 Ga0070673_100184980 3300005364 Bacteria 1785
33 Ga0070673_100917615 3300005364 Bacteria 813
34 Ga0070688_100406136 3300005365 Bacteria 1009
35 Ga0070659_100269334 3300005366 Bacteria 1415
36 Ga0070709_10042427 3300005434 Bacteria 2809
37 Ga0070714_100039267 3300005435 Bacteria 3984
38 Ga0070714_100063619 3300005435 Bacteria 3173
39 Ga0070714_101436720 3300005435 Bacteria 674
40 Ga0070713_100056744 3300005436 Bacteria 3258
41 Ga0070713_100153409 3300005436 Bacteria 2051
42 Ga0070710_10009817 3300005437 Bacteria 4690
43 Ga0070710_10547484 3300005437 Bacteria 799
44 Ga0070701_10031548 3300005438 Bacteria 2630
45 Ga0070705_100285209 3300005440 Bacteria 1176
46 Ga0070705_100420745 3300005440 Bacteria 994
47 Ga0070705_100550972 3300005440 Unclassified 884
48 Ga0070700_100034234 3300005441 Bacteria 3066
49 Ga0070694_100214358 3300005444 Bacteria 1441
50 Ga0070708_100058064 3300005445 Bacteria 3447
51 Ga0070663_100036411 3300005455 Bacteria 3419
52 Ga0070678_100015402 3300005456 Bacteria 4860
53 Ga0070678_100231851 3300005456 Bacteria 1540
54 Ga0070678_100544970 3300005456 Bacteria 1029
55 Ga0070662_100137253 3300005457 Bacteria 1892
56 Ga0070662_100286800 3300005457 Bacteria 1334
57 Ga0070681_10045952 3300005458 Bacteria 4367
58 Ga0070681_10058852 3300005458 Bacteria 3822
59 Ga0070681_10078347 3300005458 Bacteria 3261
60 Ga0070681_10137226 3300005458 Bacteria 2376
61 Ga0070681_10186674 3300005458 Bacteria 1993
62 Ga0068867_100077554 3300005459 Bacteria 2497
63 Ga0070706_100009785 3300005467 Bacteria 8910
64 Ga0070707_100005169 3300005468 Bacteria 12229
65 Ga0070698_100447382 3300005471 Bacteria 1227
66 Ga0070699_100014180 3300005518 Bacteria 6858
67 Ga0070699_100026603 3300005518 Bacteria 4988
68 Ga0070699_100041248 3300005518 Bacteria 3996
69 Ga0070679_100002705 3300005530 Bacteria 16140
70 Ga0070679_100021643 3300005530 Bacteria 6278
71 Ga0070679_100054903 3300005530 Bacteria 3967
72 Ga0070679_100125949 3300005530 Bacteria 2544
73 Ga0070679_100294779 3300005530 Bacteria 1573
74 Ga0070679_100795398 3300005530 Bacteria 889
75 Ga0070679_101139264 3300005530 Unclassified 725
76 Ga0070684_100002119 3300005535 Bacteria 14629
77 Ga0070684_100216044 3300005535 Unclassified 1748
78 Ga0070684_100496266 3300005535 Bacteria 1130
79 Ga0070697_100090377 3300005536 Bacteria 2530
80 Ga0068853_100338326 3300005539 Bacteria 1398
81 Ga0068853_100390264 3300005539 Bacteria 1301
82 Ga0068853_100616433 3300005539 Bacteria 1031
83 Ga0070672_100155796 3300005543 Unclassified 1892
84 Ga0070686_100065670 3300005544 Bacteria 2358
85 Ga0070686_100491057 3300005544 Bacteria 951
86 Ga0070686_100564851 3300005544 Bacteria 892
87 Ga0070695_100291237 3300005545 Bacteria 1203
88 Ga0070695_100311010 3300005545 Bacteria 1168
89 Ga0070696_100250219 3300005546 Bacteria 1340
90 Ga0070696_100531487 3300005546 Bacteria 940
91 Ga0070696_100579213 3300005546 Bacteria 902
92 Ga0070693_100004865 3300005547 Bacteria 6410
93 Ga0070693_100085983 3300005547 Bacteria 1886
94 Ga0070693_100613029 3300005547 Bacteria 787
95 Ga0068855_100023892 3300005563 Bacteria 7320
96 Ga0068855_100112283 3300005563 Bacteria 3127
97 Ga0068855_100547653 3300005563 Bacteria 1253
98 Ga0070664_100575210 3300005564 Bacteria 1043
99 Ga0070664_100581060 3300005564 Bacteria 1038
100 Ga0068857_100613880 3300005577 Bacteria 1029
101 Ga0068854_100028313 3300005578 Bacteria 3870
102 Ga0068856_100020613 3300005614 Bacteria 6405
103 Ga0068856_100089066 3300005614 Bacteria 3069
104 Ga0070702_100082577 3300005615 Bacteria 1928
105 Ga0070702_100087311 3300005615 Bacteria 1883
106 Ga0068852_100022416 3300005616 Bacteria 5065
107 Ga0068852_100049174 3300005616 Bacteria 3606
108 Ga0068852_100697629 3300005616 Unclassified 1025
109 Ga0068852_100766007 3300005616 Bacteria 978
110 Ga0068859_100468278 3300005617 Unclassified 1356
111 Ga0068864_100290358 3300005618 Bacteria 1529
112 Ga0068866_10154946 3300005718 Bacteria 1331
113 Ga0068861_100018180 3300005719 Bacteria 5002
114 Ga0068860_100549176 3300005843 Bacteria 1157
115 Ga0068862_100355280 3300005844 Bacteria 1360
116 Ga0081455_10006302 3300005937 Bacteria 12750
117 Ga0081455_10042893 3300005937 Bacteria 3963
118 Ga0081540_1004699 3300005983 Bacteria 10333
119 Ga0081540_1127358 3300005983 Bacteria 1046
120 Ga0070717_10050252 3300006028 Bacteria 3426
121 Ga0075432_10024425 3300006058 Bacteria 2071
122 Ga0070715_10000654 3300006163 Bacteria 9243
123 Ga0070716_100323424 3300006173 Bacteria 1081
124 Ga0070712_100024130 3300006175 Bacteria 4026
125 Ga0070712_100041410 3300006175 Bacteria 3163
126 Ga0070712_100220949 3300006175 Unclassified 1500
127 Ga0097621_100059539 3300006237 Bacteria 3127
128 Ga0068871_100040460 3300006358 Bacteria 3733
129 Ga0075431_100132704 3300006847 Bacteria 2568
130 Ga0075434_100005449 3300006871 Bacteria 11591
131 Ga0075434_100158526 3300006871 Bacteria 2283
132 Ga0075434_100347216 3300006871 Bacteria 1505
133 Ga0075429_100157336 3300006880 Bacteria 1990
134 Ga0075436_100009431 3300006914 Bacteria 6672
135 Ga0075436_100134418 3300006914 Bacteria 1736
136 Ga0097620_100468302 3300006931 Unclassified 1356
137 Ga0075435_100048479 3300007076 Bacteria 3413
138 Ga0075435_100253739 3300007076 Bacteria 1497
139 Ga0075435_100374301 3300007076 Bacteria 1223
140 Ga0105250_10074374 3300009092 Bacteria 1374
141 Ga0105240_10102672 3300009093 Bacteria 3474
142 Ga0105240_10178584 3300009093 Bacteria 2507
143 Ga0105240_10407390 3300009093 Bacteria 1530
144 Ga0105240_10908980 3300009093 Bacteria 946
145 Ga0105245_10041452 3300009098 Bacteria 4104
146 Ga0105245_10151137 3300009098 Bacteria 2196
147 Ga0105245_10286766 3300009098 Bacteria 1611
148 Ga0105245_11932870 3300009098 Unclassified 643
149 Ga0114129_10069365 3300009147 Bacteria 4913
150 Ga0105243_10058320 3300009148 Bacteria 3077
151 Ga0105243_10278002 3300009148 Bacteria 1507
152 Ga0105241_10444981 3300009174 Bacteria 1145
153 Ga0105242_10025311 3300009176 Bacteria 4696
154 Ga0105242_10042260 3300009176 Bacteria 3680
155 Ga0105248_10069119 3300009177 Bacteria 3965
156 Ga0105248_10497426 3300009177 Bacteria 1374
157 Ga0105237_10285356 3300009545 Bacteria 1653
158 Ga0105249_10026375 3300009553 Bacteria 5235
159 Ga0105249_10078383 3300009553 Bacteria 3066
160 Ga0105249_10478008 3300009553 Bacteria 1288
161 Ga0105249_10907855 3300009553 Bacteria 948
162 Ga0105239_10093744 3300010375 Bacteria 3316
163 Ga0105239_10154711 3300010375 Bacteria 2560
164 Ga0105246_10473270 3300011119 Bacteria 1058
165 Ga0157320_1000895 3300012481 Bacteria 1361
166 Ga0157319_1005770 3300012497 Unclassified 864
167 Ga0157313_1002734 3300012503 Unclassified 1083
168 Ga0157373_10107747 3300013100 Bacteria 1959
169 Ga0157373_10329802 3300013100 Bacteria 1086
170 Ga0157371_10028105 3300013102 Bacteria 4074
171 Ga0157370_10002516 3300013104 Bacteria 22041
172 Ga0157370_10091664 3300013104 Bacteria 2853
173 Ga0157370_10227802 3300013104 Bacteria 1725
174 Ga0157374_10180541 3300013296 Bacteria 2061
175 Ga0157378_10163855 3300013297 Bacteria 2081
176 Ga0157378_10185453 3300013297 Bacteria 1959
177 Ga0157378_10521890 3300013297 Bacteria 1189
178 Ga0163162_10060678 3300013306 Bacteria 3818
179 Ga0157372_10194191 3300013307 Bacteria 2351
180 Ga0157372_10334821 3300013307 Bacteria 1763
181 Ga0157372_10383170 3300013307 Bacteria 1638
182 Ga0157372_10584061 3300013307 Bacteria 1302
183 Ga0157372_11085571 3300013307 Bacteria 926
184 Ga0157372_11203384 3300013307 Bacteria 875
185 Ga0157375_10019167 3300013308 Bacteria 6215
186 Ga0157375_10020987 3300013308 Bacteria 5979
187 Ga0163163_10835227 3300014325 Bacteria 985
188 Ga0157380_10015939 3300014326 Bacteria 5532
189 Ga0157376_10070667 3300014969 Bacteria 2964
190 Ga0157376_10617688 3300014969 Bacteria 1081
191 Ga0182006_1179944 3300015261 Bacteria 705
192 Ga0163161_10031916 3300017792 Bacteria 3757
193 Ga0197907_11086716 3300020069 Bacteria 3553
194 Ga0206356_11697997 3300020070 Bacteria 1167
195 Ga0206354_11233273 3300020081 Bacteria 1155
196 Ga0206354_11310183 3300020081 Bacteria 1073
197 Ga0206353_10811714 3300020082 Bacteria 1020
198 Ga0206353_10911104 3300020082 Bacteria 1885
199 Ga0206353_10982834 3300020082 Bacteria 1218
200 Ga0213876_10070533 3300021384 Bacteria 1846
201 Ga0207692_10015566 3300025898 Bacteria 3349
202 Ga0207692_10285335 3300025898 Bacteria 1000
203 Ga0207642_10096720 3300025899 Bacteria 1472
204 Ga0207642_10256181 3300025899 Bacteria 995
205 Ga0207685_10106386 3300025905 Bacteria 1209
206 Ga0207645_10054317 3300025907 Bacteria 2558
207 Ga0207645_10300121 3300025907 Unclassified 1069
208 Ga0207705_10114239 3300025909 Bacteria 1997
209 Ga0207684_10103980 3300025910 Bacteria 2428
210 Ga0207654_10047591 3300025911 Bacteria 2451
211 Ga0207707_10024618 3300025912 Bacteria 5269
212 Ga0207707_10039759 3300025912 Bacteria 4111
213 Ga0207707_10057124 3300025912 Bacteria 3397
214 Ga0207695_10283121 3300025913 Bacteria 1551
215 Ga0207671_10162484 3300025914 Bacteria 1730
216 Ga0207671_10321125 3300025914 Bacteria 1225
217 Ga0207693_10015144 3300025915 Bacteria 6190
218 Ga0207693_10020189 3300025915 Bacteria 5300
219 Ga0207693_10048916 3300025915 Bacteria 3320
220 Ga0207693_10061804 3300025915 Bacteria 2934
221 Ga0207663_10047610 3300025916 Bacteria 2648
222 Ga0207663_10358158 3300025916 Bacteria 1106
223 Ga0207663_10504598 3300025916 Unclassified 940
224 Ga0207663_10603310 3300025916 Unclassified 863
225 Ga0207660_10021857 3300025917 Bacteria 4305
226 Ga0207660_10043606 3300025917 Bacteria 3152
227 Ga0207660_10194054 3300025917 Bacteria 1583
228 Ga0207660_10297483 3300025917 Bacteria 1284
229 Ga0207660_10385880 3300025917 Bacteria 1126
230 Ga0207662_10029471 3300025918 Bacteria 3180
231 Ga0207657_10001654 3300025919 Bacteria 24052
232 Ga0207657_10011840 3300025919 Bacteria 8635
233 Ga0207657_10088477 3300025919 Bacteria 2588
234 Ga0207657_10295785 3300025919 Bacteria 1283
235 Ga0207649_10022809 3300025920 Bacteria 3617
236 Ga0207649_10488575 3300025920 Bacteria 935
237 Ga0207652_10199998 3300025921 Bacteria 1798
238 Ga0207652_10204831 3300025921 Unclassified 1775
239 Ga0207652_10251952 3300025921 Bacteria 1592
240 Ga0207652_10408552 3300025921 Bacteria 1225
241 Ga0207652_10457273 3300025921 Unclassified 1151
242 Ga0207646_10012659 3300025922 Bacteria 8097
243 Ga0207694_11223807 3300025924 Bacteria 635
244 Ga0207687_10054987 3300025927 Bacteria 2787
245 Ga0207687_10068145 3300025927 Bacteria 2534
246 Ga0207687_10117288 3300025927 Bacteria 1985
247 Ga0207700_10082707 3300025928 Bacteria 2511
248 Ga0207700_10835038 3300025928 Bacteria 824
249 Ga0207664_10030555 3300025929 Bacteria 4115
250 Ga0207664_10285601 3300025929 Bacteria 1449
251 Ga0207664_10328858 3300025929 Bacteria 1350
252 Ga0207664_10397419 3300025929 Bacteria 1225
253 Ga0207664_10540347 3300025929 Bacteria 1045
254 Ga0207644_10258428 3300025931 Bacteria 1392
255 Ga0207690_10268125 3300025932 Bacteria 1325
256 Ga0207706_10010417 3300025933 Bacteria 8493
257 Ga0207706_10018314 3300025933 Bacteria 6302
258 Ga0207686_10297157 3300025934 Bacteria 1198
259 Ga0207686_10391558 3300025934 Unclassified 1056
260 Ga0207709_10558095 3300025935 Unclassified 902
261 Ga0207670_10877269 3300025936 Unclassified 750
262 Ga0207704_10553467 3300025938 Unclassified 935
263 Ga0207665_10009442 3300025939 Bacteria 6402
264 Ga0207665_10180960 3300025939 Bacteria 1527
265 Ga0207691_10540370 3300025940 Bacteria 988
266 Ga0207711_10205634 3300025941 Bacteria 1798
267 Ga0207711_10376897 3300025941 Bacteria 1316
268 Ga0207689_10633434 3300025942 Bacteria 900
269 Ga0207661_10220513 3300025944 Bacteria 1676
270 Ga0207679_10460926 3300025945 Unclassified 1129
271 Ga0207679_10501653 3300025945 Bacteria 1083
272 Ga0207679_10534569 3300025945 Bacteria 1050
273 Ga0207667_10433592 3300025949 Bacteria 1337
274 Ga0207667_10546700 3300025949 Unclassified 1172
275 Ga0207667_10651785 3300025949 Unclassified 1058
276 Ga0207651_10122907 3300025960 Bacteria 1972
277 Ga0207651_10531756 3300025960 Bacteria 1020
278 Ga0207712_10188107 3300025961 Bacteria 1628
279 Ga0207712_10258512 3300025961 Bacteria 1411
280 Ga0207712_10454711 3300025961 Bacteria 1086
281 Ga0207668_10045440 3300025972 Bacteria 2995
282 Ga0207640_10099870 3300025981 Bacteria 2032
283 Ga0207640_10139815 3300025981 Bacteria 1763
284 Ga0207677_10142366 3300026023 Bacteria 1838
285 Ga0207677_10290017 3300026023 Bacteria 1347
286 Ga0207703_10368809 3300026035 Bacteria 1326
287 Ga0207639_10245967 3300026041 Bacteria 1558
288 Ga0207678_10021000 3300026067 Bacteria 5723
289 Ga0207678_11022182 3300026067 Bacteria 732
290 Ga0207708_10011806 3300026075 Bacteria 6505
291 Ga0207702_10091714 3300026078 Bacteria 2661
292 Ga0207702_10388214 3300026078 Bacteria 1344
293 Ga0207702_10498718 3300026078 Bacteria 1187
294 Ga0207648_10020652 3300026089 Bacteria 5929
295 Ga0207676_10433586 3300026095 Bacteria 1235
296 Ga0207674_10029332 3300026116 Bacteria 5792
297 Ga0207675_100008428 3300026118 Bacteria 9717
298 Ga0207675_100356731 3300026118 Bacteria 1434
299 Ga0207683_10031994 3300026121 Bacteria 4568
300 Ga0207683_10077408 3300026121 Bacteria 2946
301 Ga0207683_10611532 3300026121 Bacteria 1009
302 Ga0207698_10120346 3300026142 Bacteria 2220
303 Ga0268264_10968010 3300028381 Bacteria 857
304 Ga0265326_10047912 3300028558 Bacteria 1212
305 Ga0265319_1072983 3300028563 Bacteria 1098
306 Ga0265318_10045496 3300028577 Bacteria 1659
307 Ga0265322_10010830 3300028654 Bacteria 2648
308 Ga0265338_10022159 3300028800 Bacteria 6591
309 Ga0265328_10137782 3300031239 Bacteria 915
310 Ga0265325_10063380 3300031241 Bacteria 1870
311 Ga0265340_10036305 3300031247 Bacteria 2443
312 Ga0265339_10040690 3300031249 Bacteria 2583
313 Ga0265316_10017339 3300031344 Bacteria 6230
314 Ga0265313_10017169 3300031595 Bacteria 4125
315 Ga0265314_10003467 3300031711 Bacteria 15234
316 Ga0265342_10041734 3300031712 Bacteria 2775
317 Ga0307405_10194749 3300031731 Bacteria 1467
318 Ga0307409_100068664 3300031995 Bacteria 2804
319 Ga0307416_100919909 3300032002 Bacteria 975
320 Ga0373959_0004948 3300034820 Bacteria 2172
321 Ga0373928_0031219 3300035084 Bacteria 1182
322 Ga0373944_0010639 3300035089 Bacteria 2510
323 Ga0373939_0017153 3300035114 Bacteria 1920
324 Ga0373945_0024109 3300035116 Bacteria 2106
325 Ga0373954_0165640 3300035118 Bacteria 1082
326 Ga0373960_0136084 3300035121 Bacteria 828
327 Ga0373943_0072897 3300035170 Bacteria 1743
328 Ga0373955_0024629 3300035172 Bacteria 3080
329 Ga0373962_0020228 3300035242 Bacteria 1747
330 Ga0373962_0057048 3300035242 Bacteria 1139
331 Ga0373931_0435745 3300035691 Bacteria 836
332 Ga0373931_0673050 3300035691 Bacteria 681
333 Ga0373947_0000664 3300035725 Bacteria 20398
334 Ga0373947_0306441 3300035725 Unclassified 1060
335 Ga0373925_0020960 3300037068 Bacteria 4763
336 Ga0373925_0277634 3300037068 Bacteria 1349
337 Ga0373925_0866123 3300037068 Bacteria 745
338 Ga0395899_0008449 3300037312 Bacteria 7931
339 Ga0395899_0009866 3300037312 Bacteria 7323
340 Ga0395899_0021787 3300037312 Bacteria 4860
341 Ga0395899_0035920 3300037312 Bacteria 3719
342 Ga0395899_0057931 3300037312 Bacteria 2858
343 Ga0395899_0211076 3300037312 Bacteria 1349
344 Ga0395900_0001009 3300037418 Bacteria 36426
345 Ga0395900_0003572 3300037418 Bacteria 16711
346 Ga0395900_0008866 3300037418 Bacteria 10326
347 Ga0395900_0010139 3300037418 Bacteria 9635
348 Ga0395900_0034348 3300037418 Bacteria 5221
349 Ga0395900_0099566 3300037418 Bacteria 2986
350 Ga0395900_0646074 3300037418 Bacteria 995
351 Ga0395900_0861180 3300037418 Bacteria 831
352 Ga0395898_0001088 3300037466 Bacteria 41937
353 Ga0395898_0005269 3300037466 Bacteria 13980
354 Ga0395898_0009019 3300037466 Bacteria 10499
355 Ga0395898_0020640 3300037466 Bacteria 6691
356 Ga0395898_0066891 3300037466 Bacteria 3480
357 Ga0395898_0081040 3300037466 Bacteria 3130
358 Ga0395898_0193798 3300037466 Bacteria 1941
359 Ga0395898_0313393 3300037466 Bacteria 1497
360 Ga0395898_0480294 3300037466 Bacteria 1182
361 Ga0395905_0001033 3300037471 Bacteria 35408
362 Ga0395905_0001800 3300037471 Bacteria 24833
363 Ga0395905_0011027 3300037471 Bacteria 8745
364 Ga0395905_0016912 3300037471 Bacteria 6928
365 Ga0395905_0080585 3300037471 Bacteria 3051
366 Ga0395905_0210352 3300037471 Bacteria 1822
367 Ga0395905_0260395 3300037471 Unclassified 1619
368 Ga0395905_0493651 3300037471 Bacteria 1124
369 Ga0436364_0069329 3300037853 Bacteria 1072
370 Ga0395901_0002285 3300038443 Bacteria 19538
371 Ga0395901_0006248 3300038443 Bacteria 12075
372 Ga0395901_0012090 3300038443 Bacteria 8757
373 Ga0395901_0012202 3300038443 Bacteria 8720
374 Ga0395901_0012213 3300038443 Bacteria 8716
375 Ga0395901_0014628 3300038443 Bacteria 7973
376 Ga0395901_0147824 3300038443 Bacteria 2469
377 Ga0395901_0225294 3300038443 Bacteria 1959
378 Ga0395901_0237416 3300038443 Bacteria 1902
379 Ga0395901_0348433 3300038443 Bacteria 1529
380 Ga0395901_1267495 3300038443 Unclassified 700
381 Ga0395901_1352235 3300038443 Bacteria 672
382 Ga0436365_0415531 3300039437 Bacteria 4308
383 Ga0436365_1056826 3300039437 Unclassified 2022
384 Ga0436363_1254646 3300039450 Bacteria 1218
385 Ga0436363_1633358 3300039450 Bacteria 2287
386 Ga0439448_0120022 3300042005 Bacteria 902
387 Ga0439460_0053297 3300042461 Bacteria 1218
388 Ga0466972_0161118 3300044658 Bacteria 1054
389 Ga0466966_0192281 3300044684 Bacteria 1236
390 Ga0466963_0007165 3300044694 Bacteria 6647
391 Ga0466963_0043897 3300044694 Bacteria 2941
392 Ga0466963_0148678 3300044694 Bacteria 1626
393 Ga0466963_0711046 3300044694 Bacteria 709
394 Ga0466964_0000345 3300044706 Bacteria 13898
395 Ga0466964_0019450 3300044706 Bacteria 2609
396 Ga0466964_0111307 3300044706 Bacteria 1221
397 Ga0466964_0391408 3300044706 Bacteria 724
398 Ga0466964_0415677 3300044706 Unclassified 706
399 Ga0466971_0014266 3300044719 Bacteria 3494
400 Ga0466971_0017308 3300044719 Bacteria 3187
401 Ga0466971_0268785 3300044719 Unclassified 815
402 Ga0466957_0017401 3300044842 Bacteria 4209
403 Ga0466957_0357522 3300044842 Bacteria 992
404 Ga0466957_0523014 3300044842 Unclassified 824
405 Ga0466960_0142140 3300044901 Unclassified 1276
406 Ga0466959_0016325 3300045049 Bacteria 5424
407 Ga0451576_0009107 3300045051 Bacteria 11549
408 Ga0451576_0156682 3300045051 Bacteria 2376
409 Ga0451576_1062406 3300045051 Bacteria 848
410 Ga0466958_0006066 3300045836 Bacteria 6552
411 Ga0466958_0187391 3300045836 Bacteria 1314
412 Ga0466967_0020487 3300045976 Bacteria 5347
413 Ga0466967_0029561 3300045976 Bacteria 4588
414 Ga0466967_0030293 3300045976 Bacteria 4539
415 Ga0466967_0062473 3300045976 Bacteria 3306
416 Ga0466967_0076320 3300045976 Bacteria 3014
417 Ga0466967_0079196 3300045976 Bacteria 2962
418 Ga0466967_0169328 3300045976 Bacteria 2054
419 Ga0466967_0231957 3300045976 Bacteria 1758
420 Ga0466967_0255654 3300045976 Bacteria 1675
421 Ga0495592_0024442 3300046454 Bacteria 4593
422 Ga0495603_0000219 3300046455 Bacteria 29709
423 Ga0495629_0141110 3300046459 Bacteria 1676
424 Ga0495629_0730225 3300046459 Unclassified 656
425 Ga0495641_0000516 3300046461 Bacteria 32427
426 Ga0495651_0015286 3300046462 Bacteria 5934
427 Ga0495651_0048767 3300046462 Bacteria 3270
428 Ga0495651_0167727 3300046462 Bacteria 1567
429 Ga0495653_0205608 3300046463 Bacteria 1333
430 Ga0495580_0105068 3300046472 Bacteria 1962
431 Ga0495582_0027449 3300046473 Bacteria 3121
432 Ga0495582_0130634 3300046473 Bacteria 1419
433 Ga0495662_0322933 3300046476 Bacteria 759
434 Ga0495664_0092676 3300046477 Bacteria 1817
435 Ga0495584_0263386 3300046491 Bacteria 876
436 Ga0495594_0009038 3300046499 Bacteria 5142
437 Ga0495583_0294309 3300046506 Unclassified 646
438 Ga0495608_0016498 3300046511 Bacteria 5111
439 Ga0495608_0119771 3300046511 Bacteria 1688
440 Ga0495608_0332784 3300046511 Bacteria 936
441 Ga0495618_0255354 3300046514 Bacteria 1099
442 Ga0495628_0273353 3300046516 Bacteria 1256
443 Ga0495630_0050663 3300046517 Bacteria 3107
444 Ga0495644_0175579 3300046523 Bacteria 823
445 Ga0495652_0130019 3300046529 Bacteria 1995
446 Ga0495652_0446532 3300046529 Bacteria 906
447 Ga0495640_0058566 3300046533 Bacteria 2627
448 Ga0495640_0079781 3300046533 Bacteria 2178
449 Ga0495586_0114377 3300046535 Bacteria 1504
450 Ga0495586_0126264 3300046535 Bacteria 1431
451 Ga0495587_0093090 3300046536 Bacteria 1740
452 Ga0495587_0181541 3300046536 Unclassified 1193
453 Ga0495645_0322815 3300046543 Bacteria 1002
454 Ga0495622_0020433 3300046557 Bacteria 3084
455 Ga0495667_0001711 3300046559 Bacteria 14566
456 Ga0495667_0064032 3300046559 Bacteria 2405
457 Ga0495656_0033437 3300046615 Bacteria 2099
458 Ga0495634_0014753 3300046642 Bacteria 5622
459 Ga0495634_0042253 3300046642 Bacteria 3093
460 Ga0495635_0092078 3300046663 Bacteria 2073
461 Ga0495635_0143391 3300046663 Bacteria 1627
462 Ga0495588_0000660 3300046674 Bacteria 15991
463 Ga0495657_0222989 3300046675 Bacteria 1142
464 Ga0495657_0289626 3300046675 Bacteria 978
465 Ga0495599_0019441 3300046678 Bacteria 4234
466 Ga0495599_0070717 3300046678 Bacteria 2178
467 Ga0495613_0049721 3300046689 Bacteria 3093
468 Ga0495613_0233188 3300046689 Bacteria 1289
469 Ga0495613_0339148 3300046689 Bacteria 1034
470 Ga0495624_0216125 3300046690 Unclassified 1163
471 Ga0495624_0401169 3300046690 Unclassified 823
472 Ga0495671_0183687 3300046692 Bacteria 1016
473 Ga0495589_0234076 3300046794 Unclassified 861
474 Ga0495600_0019857 3300046809 Bacteria 4295
475 Ga0495600_0218671 3300046809 Bacteria 1219
476 Ga0495581_0068795 3300047315 Bacteria 2047
477 Ga0495581_0136840 3300047315 Bacteria 1428
478 Ga0495604_0028425 3300047317 Bacteria 4449
479 Ga0495604_0066588 3300047317 Bacteria 2739
480 Ga0495604_0124051 3300047317 Bacteria 1865
481 Ga0495604_0178739 3300047317 Bacteria 1486
482 Ga0495674_0002208 3300047319 Bacteria 19139
483 Ga0495674_0018930 3300047319 Bacteria 6404
484 Ga0495676_0000977 3300047321 Bacteria 23953
485 Ga0495680_0004620 3300047322 Bacteria 13121
486 Ga0495680_0030276 3300047322 Bacteria 4421
487 Ga0495675_0049456 3300047444 Bacteria 2673
488 Ga0495684_0013231 3300047471 Bacteria 6368
489 Ga0495684_0092468 3300047471 Bacteria 2291
490 Ga0495684_0203110 3300047471 Bacteria 1460
491 Ga0495602_0116437 3300048088 Bacteria 2159
492 Ga0495602_0278220 3300048088 Bacteria 1234
493 Ga0495602_0742064 3300048088 Bacteria 663
494 Ga0496100_0021461 3300048903 Bacteria 3889
495 Ga0496101_0000424 3300048904 Bacteria 27117
496 Ga0496101_0005214 3300048904 Bacteria 8267
497 Ga0496101_0128510 3300048904 Bacteria 1922
498 Ga0496101_0206284 3300048904 Bacteria 1521
499 Ga0496101_0321385 3300048904 Bacteria 1214
500 Ga0496102_0003088 3300048905 Bacteria 14109
501 Ga0496102_0009838 3300048905 Bacteria 8222
502 Ga0496102_0037456 3300048905 Bacteria 4375
503 Ga0496102_0059615 3300048905 Bacteria 3490
504 Ga0496102_0269614 3300048905 Bacteria 1605
505 Ga0496102_0276539 3300048905 Bacteria 1583
506 Ga0496102_0365850 3300048905 Bacteria 1357
507 Ga0496102_0433250 3300048905 Bacteria 1234
508 Ga0496103_0022233 3300048906 Bacteria 3817
509 Ga0496103_0164634 3300048906 Bacteria 1423
510 Ga0496104_0002376 3300048907 Bacteria 16220
511 Ga0496104_0006585 3300048907 Bacteria 10215
512 Ga0496104_0007994 3300048907 Bacteria 9378
513 Ga0496104_0019246 3300048907 Bacteria 6243
514 Ga0496104_0080285 3300048907 Bacteria 3110
515 Ga0496104_0481301 3300048907 Bacteria 1152
516 Ga0496104_0555635 3300048907 Bacteria 1059
517 Ga0496105_0000597 3300048908 Bacteria 24061
518 Ga0496105_0048656 3300048908 Bacteria 3499
519 Ga0496105_0082467 3300048908 Bacteria 2656
520 Ga0496106_0007641 3300048909 Bacteria 7996
521 Ga0496106_0014004 3300048909 Bacteria 5929
522 Ga0496106_0088709 3300048909 Bacteria 2384
523 Ga0496106_0142310 3300048909 Bacteria 1887
524 Ga0496106_0521087 3300048909 Bacteria 954
525 Ga0496107_0020310 3300048910 Bacteria 4690
526 Ga0496107_0023106 3300048910 Bacteria 4395
527 Ga0496107_0041489 3300048910 Bacteria 3304
528 Ga0496107_0117226 3300048910 Bacteria 1960
529 Ga0496107_0308008 3300048910 Bacteria 1179
530 Ga0496108_0001639 3300048911 Bacteria 17745
531 Ga0496108_0002438 3300048911 Bacteria 14862
532 Ga0496108_0010971 3300048911 Bacteria 7358
533 Ga0496108_0012650 3300048911 Bacteria 6876
534 Ga0496109_0035209 3300048912 Bacteria 4514
535 Ga0496109_0050646 3300048912 Bacteria 3781
536 Ga0496109_0051487 3300048912 Bacteria 3750
537 Ga0496109_0118069 3300048912 Bacteria 2469
538 Ga0496110_0002351 3300048913 Bacteria 14159
539 Ga0496110_0004851 3300048913 Bacteria 10487
540 Ga0496110_0006795 3300048913 Bacteria 9099
541 Ga0496110_0140385 3300048913 Bacteria 2184
542 Ga0496110_0524644 3300048913 Bacteria 1077
543 Ga0496111_0003363 3300048914 Bacteria 9885
544 Ga0496111_0005204 3300048914 Bacteria 8296
545 Ga0496111_0068769 3300048914 Bacteria 2574
546 Ga0496112_0024000 3300048915 Bacteria 5834
547 Ga0496112_0080709 3300048915 Bacteria 3216
548 Ga0496112_0244298 3300048915 Bacteria 1747
549 Ga0496112_1296133 3300048915 Bacteria 644
550 Ga0496113_0000612 3300048916 Bacteria 17857
551 Ga0496113_0004409 3300048916 Bacteria 8642
552 Ga0496113_0022210 3300048916 Bacteria 4484
553 Ga0496113_0338321 3300048916 Bacteria 1207
554 Ga0496113_0499214 3300048916 Bacteria 977
555 Ga0496114_0000392 3300048917 Bacteria 32304
556 Ga0496114_0002716 3300048917 Bacteria 13516
557 Ga0496114_0029440 3300048917 Bacteria 4514
558 Ga0496114_0159050 3300048917 Bacteria 1963
559 Ga0496114_0167288 3300048917 Bacteria 1915
560 Ga0496114_0361573 3300048917 Bacteria 1284
561 Ga0496115_0001999 3300048918 Bacteria 14573
562 Ga0496115_0003805 3300048918 Bacteria 10865
563 Ga0496115_0017651 3300048918 Bacteria 5463
564 Ga0496115_0020748 3300048918 Bacteria 5069
565 Ga0496115_0191751 3300048918 Bacteria 1688
566 Ga0496115_0222990 3300048918 Bacteria 1556
567 Ga0501036_0027279 3300049572 Bacteria 4825
568 Ga0501037_0030682 3300049573 Bacteria 3972
569 Ga0501038_0058938 3300049574 Bacteria 3290
570 Ga0501041_0024997 3300049577 Bacteria 3588
571 Ga0501042_0033857 3300049578 Bacteria 3622
572 Ga0501043_0288724 3300049579 Bacteria 1256
573 Ga0501046_0084140 3300049580 Bacteria 2454
574 Ga0501047_0020349 3300049581 Bacteria 6373
575 Ga0501067_0001274 3300049583 Bacteria 13704
576 Ga0501069_0005847 3300049585 Bacteria 6406
577 Ga0501070_0099001 3300049586 Bacteria 2412
578 Ga0501070_0212554 3300049586 Bacteria 1587
579 Ga0501071_0114923 3300049587 Unclassified 1991
580 Ga0501072_0022091 3300049588 Bacteria 4935
581 Ga0501074_0147796 3300049590 Bacteria 1681
582 Ga0501076_0019639 3300049592 Bacteria 5166
583 Ga0501079_0723274 3300049741 Bacteria 783
584 Ga0501080_0575119 3300049742 Bacteria 1002
585 Ga0501081_0005825 3300049743 Bacteria 7977
586 Ga0501081_0130715 3300049743 Bacteria 1794
587 Ga0501083_0431536 3300049744 Unclassified 857
588 Ga0501045_0029191 3300049824 Bacteria 3984
589 nmdc:mga09592_256991_c1 3300050508 Bacteria 1514
590 nmdc:mga06r32_595847_c1 3300050510 Bacteria 1076
591 nmdc:mga08y16_908261_c1 3300050511 Unclassified 866
592 nmdc:mga08y16_99563_c1 3300050511 Bacteria 3027
593 nmdc:mga0n895_81357_c1 3300050512 Bacteria 3228
594 nmdc:mga0rr50_13606_c1 3300050513 Bacteria 5305
595 nmdc:mga0rr50_458260_c1 3300050513 Bacteria 1081
596 nmdc:mga0rr50_82854_c1 3300050513 Bacteria 2478
597 nmdc:mga0a205_100150_c1 3300050515 Bacteria 2797
598 nmdc:mga0a205_622364_c1 3300050515 Unclassified 932
599 nmdc:mga0a205_703827_c1 3300050515 Bacteria 860
600 Ga0495601_0026769 3300053077 Bacteria 3563
601 Ga0495601_0253166 3300053077 Bacteria 1150
602 Ga0495612_0058974 3300053078 Bacteria 1587
603 Ga0495619_0012550 3300053085 Bacteria 5336
604 Ga0495619_0012949 3300053085 Bacteria 5254
605 Ga0495619_0080638 3300053085 Bacteria 2190
606 Ga0495619_0207186 3300053085 Bacteria 1358
607 Ga0501084_0054541 3300054114 Bacteria 3344
608 Ga0501082_0016025 3300060353 Bacteria 6447
609 Ga0530510_0022085 3300061734 Bacteria 4531

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035118 Ga0373954_0165640 Ga0373954_0165640_306_890 169
2 3300035172 Ga0373955_0024629 Ga0373955_0024629_641_1225 169
3 3300046511 Ga0495608_0119771 Ga0495608_0119771_95_679 169
4 3300046514 Ga0495618_0255354 Ga0495618_0255354_222_806 169
5 3300046536 Ga0495587_0093090 Ga0495587_0093090_924_1508 169
6 3300046543 Ga0495645_0322815 Ga0495645_0322815_139_723 169
7 3300046559 Ga0495667_0064032 Ga0495667_0064032_224_808 169
8 3300046678 Ga0495599_0070717 Ga0495599_0070717_587_1171 169
9 3300046689 Ga0495613_0233188 Ga0495613_0233188_544_1128 169
10 3300046690 Ga0495624_0216125 Ga0495624_0216125_315_899 169
11 3300047317 Ga0495604_0124051 Ga0495604_0124051_213_797 169
12 3300047444 Ga0495675_0049456 Ga0495675_0049456_253_837 169
13 3300047471 Ga0495684_0203110 Ga0495684_0203110_448_1032 169
14 3300048088 Ga0495602_0116437 Ga0495602_0116437_801_1385 169
15 3300049572 Ga0501036_0027279 Ga0501036_0027279_780_1292 169
16 3300049573 Ga0501037_0030682 Ga0501037_0030682_756_1268 169
17 3300049574 Ga0501038_0058938 Ga0501038_0058938_708_1220 169
18 3300049577 Ga0501041_0024997 Ga0501041_0024997_1123_1635 169
19 3300049578 Ga0501042_0033857 Ga0501042_0033857_1939_2451 169
20 3300049579 Ga0501043_0288724 Ga0501043_0288724_493_1005 169
21 3300049587 Ga0501071_0114923 Ga0501071_0114923_282_794 169
22 3300049588 Ga0501072_0022091 Ga0501072_0022091_2235_2747 169
23 3300049592 Ga0501076_0019639 Ga0501076_0019639_2015_2527 169
24 3300049741 Ga0501079_0723274 Ga0501079_0723274_210_722 169
25 3300049742 Ga0501080_0575119 Ga0501080_0575119_202_714 169
26 3300049743 Ga0501081_0005825 Ga0501081_0005825_3083_3595 169
27 3300049824 Ga0501045_0029191 Ga0501045_0029191_887_1399 169
28 3300053085 Ga0495619_0012949 Ga0495619_0012949_4447_5031 169
29 3300054114 Ga0501084_0054541 Ga0501084_0054541_62_574 169
30 3300060353 Ga0501082_0016025 Ga0501082_0016025_1151_1663 169
31 3300037312 Ga0395899_0057931 Ga0395899_0057931_1872_2408 173
32 3300037418 Ga0395900_0001009 Ga0395900_0001009_14996_15532 173
33 3300037466 Ga0395898_0066891 Ga0395898_0066891_1003_1539 173
34 3300037471 Ga0395905_0001033 Ga0395905_0001033_21345_21881 173
35 3300038443 Ga0395901_0012090 Ga0395901_0012090_1410_1946 173
36 3300037068 Ga0373925_0866123 Ga0373925_0866123_140_712 174
37 3300005937 Ga0081455_10042893 Ga0081455_100428932 177
38 3300009093 Ga0105240_10102672 Ga0105240_101026723 179
39 3300009545 Ga0105237_10285356 Ga0105237_102853563 179
40 3300013100 Ga0157373_10107747 Ga0157373_101077472 179
41 3300013104 Ga0157370_10091664 Ga0157370_100916643 179
42 3300013307 Ga0157372_10334821 Ga0157372_103348211 179
43 3300020081 Ga0206354_11310183 Ga0206354_113101832 179
44 3300044694 Ga0466963_0148678 Ga0466963_0148678_584_1150 179
45 3300045976 Ga0466967_0020487 Ga0466967_0020487_2922_3488 179
46 3300048915 Ga0496112_1296133 Ga0496112_1296133_59_604 179
47 3300048916 Ga0496113_0499214 Ga0496113_0499214_223_768 179
48 3300035084 Ga0373928_0031219 Ga0373928_0031219_514_1128 182
49 3300037312 Ga0395899_0035920 Ga0395899_0035920_1416_2027 182
50 3300037418 Ga0395900_0034348 Ga0395900_0034348_723_1334 182
51 3300037466 Ga0395898_0020640 Ga0395898_0020640_3905_4516 182
52 3300037471 Ga0395905_0210352 Ga0395905_0210352_111_722 182
53 3300038443 Ga0395901_0012202 Ga0395901_0012202_5510_6121 182
54 3300005337 Ga0070682_100095236 Ga0070682_1000952363 183
55 3300005364 Ga0070673_100184980 Ga0070673_1001849803 183
56 3300005434 Ga0070709_10042427 Ga0070709_100424273 183
57 3300005435 Ga0070714_100039267 Ga0070714_1000392673 183
58 3300005436 Ga0070713_100153409 Ga0070713_1001534091 183
59 3300005437 Ga0070710_10009817 Ga0070710_100098173 183
60 3300005440 Ga0070705_100285209 Ga0070705_1002852092 183
61 3300005455 Ga0070663_100036411 Ga0070663_1000364113 183
62 3300005518 Ga0070699_100041248 Ga0070699_1000412483 183
63 3300005544 Ga0070686_100564851 Ga0070686_1005648511 183
64 3300005546 Ga0070696_100531487 Ga0070696_1005314871 183
65 3300005614 Ga0068856_100020613 Ga0068856_1000206134 183
66 3300006163 Ga0070715_10000654 Ga0070715_100006548 183
67 3300006175 Ga0070712_100041410 Ga0070712_1000414102 183
68 3300006237 Ga0097621_100059539 Ga0097621_1000595393 183
69 3300006358 Ga0068871_100040460 Ga0068871_1000404604 183
70 3300006871 Ga0075434_100347216 Ga0075434_1003472162 183
71 3300006914 Ga0075436_100134418 Ga0075436_1001344183 183
72 3300007076 Ga0075435_100048479 Ga0075435_1000484792 183
73 3300011119 Ga0105246_10473270 Ga0105246_104732702 183
74 3300013100 Ga0157373_10329802 Ga0157373_103298022 183
75 3300013297 Ga0157378_10521890 Ga0157378_105218902 183
76 3300014969 Ga0157376_10070667 Ga0157376_100706672 183
77 3300025898 Ga0207692_10015566 Ga0207692_100155663 183
78 3300025898 Ga0207692_10285335 Ga0207692_102853351 183
79 3300025905 Ga0207685_10106386 Ga0207685_101063862 183
80 3300025911 Ga0207654_10047591 Ga0207654_100475913 183
81 3300025915 Ga0207693_10015144 Ga0207693_100151446 183
82 3300025915 Ga0207693_10020189 Ga0207693_100201893 183
83 3300025916 Ga0207663_10047610 Ga0207663_100476104 183
84 3300025921 Ga0207652_10408552 Ga0207652_104085522 183
85 3300025928 Ga0207700_10082707 Ga0207700_100827073 183
86 3300025928 Ga0207700_10835038 Ga0207700_108350382 183
87 3300025929 Ga0207664_10540347 Ga0207664_105403472 183
88 3300025939 Ga0207665_10009442 Ga0207665_100094425 183
89 3300025939 Ga0207665_10180960 Ga0207665_101809602 183
90 3300026067 Ga0207678_10021000 Ga0207678_100210003 183
91 3300026078 Ga0207702_10091714 Ga0207702_100917144 183
92 3300034820 Ga0373959_0004948 Ga0373959_0004948_881_1495 183
93 3300035242 Ga0373962_0057048 Ga0373962_0057048_336_950 183
94 3300035691 Ga0373931_0673050 Ga0373931_0673050_54_668 183
95 3300048905 Ga0496102_0276539 Ga0496102_0276539_360_974 183
96 3300048906 Ga0496103_0022233 Ga0496103_0022233_298_912 183
97 3300048907 Ga0496104_0481301 Ga0496104_0481301_354_968 183
98 3300048909 Ga0496106_0521087 Ga0496106_0521087_246_860 183
99 3300048910 Ga0496107_0117226 Ga0496107_0117226_761_1375 183
100 3300048913 Ga0496110_0140385 Ga0496110_0140385_1220_1828 183
101 3300048913 Ga0496110_0524644 Ga0496110_0524644_317_931 183
102 3300048915 Ga0496112_0244298 Ga0496112_0244298_586_1200 183
103 3300048916 Ga0496113_0338321 Ga0496113_0338321_464_1078 183
104 3300048917 Ga0496114_0159050 Ga0496114_0159050_894_1508 183
105 3300048918 Ga0496115_0017651 Ga0496115_0017651_4623_5237 183
106 3300048918 Ga0496115_0191751 Ga0496115_0191751_489_1103 183
107 3300050513 nmdc:mga0rr50_82854_c1 nmdc:mga0rr50_82854_c1_1220_1834 183
108 3300005435 Ga0070714_101436720 Ga0070714_1014367201 184
109 3300044706 Ga0466964_0415677 Ga0466964_0415677_100_675 184
110 3300045976 Ga0466967_0076320 Ga0466967_0076320_1799_2374 184
111 3300045976 Ga0466967_0079196 Ga0466967_0079196_2353_2913 184
112 3300046462 Ga0495651_0048767 Ga0495651_0048767_34_594 184
113 3300046511 Ga0495608_0016498 Ga0495608_0016498_51_611 184
114 3300046529 Ga0495652_0130019 Ga0495652_0130019_438_998 184
115 3300046675 Ga0495657_0289626 Ga0495657_0289626_116_676 184
116 3300047317 Ga0495604_0178739 Ga0495604_0178739_253_813 184
117 3300047319 Ga0495674_0018930 Ga0495674_0018930_2223_2783 184
118 3300053077 Ga0495601_0253166 Ga0495601_0253166_426_986 184
119 3300053078 Ga0495612_0058974 Ga0495612_0058974_103_663 184
120 3300053085 Ga0495619_0207186 Ga0495619_0207186_58_618 184
121 3300005564 Ga0070664_100581060 Ga0070664_1005810602 185
122 3300025945 Ga0207679_10534569 Ga0207679_105345692 185
123 3300035170 Ga0373943_0072897 Ga0373943_0072897_933_1541 186
124 3300035725 Ga0373947_0306441 Ga0373947_0306441_80_688 186
125 3300044706 Ga0466964_0391408 Ga0466964_0391408_65_631 186
126 3300045976 Ga0466967_0169328 Ga0466967_0169328_1263_1829 186
127 3300048905 Ga0496102_0269614 Ga0496102_0269614_998_1564 186
128 3300049580 Ga0501046_0084140 Ga0501046_0084140_97_705 186
129 3300049581 Ga0501047_0020349 Ga0501047_0020349_4233_4841 186
130 3300049586 Ga0501070_0212554 Ga0501070_0212554_321_929 186
131 3300049744 Ga0501083_0431536 Ga0501083_0431536_156_764 186
132 3300005616 Ga0068852_100766007 Ga0068852_1007660072 187
133 3300015261 Ga0182006_1179944 Ga0182006_11799441 187
134 3300044694 Ga0466963_0007165 Ga0466963_0007165_5830_6399 187
135 3300005341 Ga0070691_10135809 Ga0070691_101358092 188
136 3300005435 Ga0070714_100063619 Ga0070714_1000636192 188
137 3300005440 Ga0070705_100550972 Ga0070705_1005509721 188
138 3300005456 Ga0070678_100231851 Ga0070678_1002318513 188
139 3300005458 Ga0070681_10058852 Ga0070681_100588522 188
140 3300005530 Ga0070679_101139264 Ga0070679_1011392641 188
141 3300005535 Ga0070684_100216044 Ga0070684_1002160443 188
142 3300005545 Ga0070695_100311010 Ga0070695_1003110102 188
143 3300005546 Ga0070696_100250219 Ga0070696_1002502192 188
144 3300005547 Ga0070693_100004865 Ga0070693_1000048656 188
145 3300005563 Ga0068855_100023892 Ga0068855_1000238924 188
146 3300005614 Ga0068856_100089066 Ga0068856_1000890663 188
147 3300005615 Ga0070702_100087311 Ga0070702_1000873112 188
148 3300009174 Ga0105241_10444981 Ga0105241_104449812 188
149 3300020070 Ga0206356_11697997 Ga0206356_116979971 188
150 3300020082 Ga0206353_10811714 Ga0206353_108117142 188
151 3300025912 Ga0207707_10057124 Ga0207707_100571243 188
152 3300025914 Ga0207671_10321125 Ga0207671_103211253 188
153 3300025917 Ga0207660_10385880 Ga0207660_103858802 188
154 3300025921 Ga0207652_10251952 Ga0207652_102519522 188
155 3300025921 Ga0207652_10457273 Ga0207652_104572733 188
156 3300025924 Ga0207694_11223807 Ga0207694_112238071 188
157 3300025929 Ga0207664_10030555 Ga0207664_100305554 188
158 3300025981 Ga0207640_10099870 Ga0207640_100998703 188
159 3300026078 Ga0207702_10498718 Ga0207702_104987182 188
160 3300026121 Ga0207683_10077408 Ga0207683_100774083 188
161 3300037418 Ga0395900_0099566 Ga0395900_0099566_508_1116 188
162 3300038443 Ga0395901_1267495 Ga0395901_1267495_13_621 188
163 3300048905 Ga0496102_0365850 Ga0496102_0365850_365_1003 188
164 3300005547 Ga0070693_100613029 Ga0070693_1006130291 189
165 3300009093 Ga0105240_10908980 Ga0105240_109089802 189
166 3300013307 Ga0157372_11085571 Ga0157372_110855712 189
167 3300013307 Ga0157372_11203384 Ga0157372_112033842 189
168 3300025916 Ga0207663_10504598 Ga0207663_105045982 189
169 3300025929 Ga0207664_10285601 Ga0207664_102856013 189
170 3300037418 Ga0395900_0646074 Ga0395900_0646074_366_956 189
171 3300037466 Ga0395898_0480294 Ga0395898_0480294_568_1158 189
172 3300038443 Ga0395901_0225294 Ga0395901_0225294_601_1191 189
173 3300038443 Ga0395901_0348433 Ga0395901_0348433_618_1193 189
174 3300044694 Ga0466963_0711046 Ga0466963_0711046_37_612 189
175 3300044706 Ga0466964_0111307 Ga0466964_0111307_312_926 189
176 3300044719 Ga0466971_0268785 Ga0466971_0268785_194_769 189
177 3300044842 Ga0466957_0357522 Ga0466957_0357522_30_605 189
178 3300045976 Ga0466967_0231957 Ga0466967_0231957_872_1447 189
179 3300046459 Ga0495629_0141110 Ga0495629_0141110_1060_1635 189
180 3300046459 Ga0495629_0730225 Ga0495629_0730225_71_646 189
181 3300047315 Ga0495581_0136840 Ga0495581_0136840_152_727 189
182 3300048088 Ga0495602_0742064 Ga0495602_0742064_32_607 189
183 3300048907 Ga0496104_0080285 Ga0496104_0080285_2230_2805 189
184 3300048917 Ga0496114_0002716 Ga0496114_0002716_6544_7119 189
185 3300048918 Ga0496115_0003805 Ga0496115_0003805_6762_7337 189
186 3300021384 Ga0213876_10070533 Ga0213876_100705332 190
187 3300037853 Ga0436364_0069329 Ga0436364_0069329_209_787 190
188 3300039437 Ga0436365_0415531 Ga0436365_0415531_3225_3803 190
189 3300039437 Ga0436365_1056826 Ga0436365_1056826_540_1118 190
190 3300039450 Ga0436363_1633358 Ga0436363_1633358_1036_1614 190
191 3300045976 Ga0466967_0062473 Ga0466967_0062473_763_1341 190
192 3300046462 Ga0495651_0167727 Ga0495651_0167727_933_1541 190
193 3300005437 Ga0070710_10547484 Ga0070710_105474841 191
194 3300005983 Ga0081540_1127358 Ga0081540_11273582 192
195 3300006175 Ga0070712_100024130 Ga0070712_1000241303 192
196 3300013296 Ga0157374_10180541 Ga0157374_101805413 192
197 3300025915 Ga0207693_10061804 Ga0207693_100618043 192
198 3300025916 Ga0207663_10603310 Ga0207663_106033101 192
199 3300035691 Ga0373931_0435745 Ga0373931_0435745_30_617 192
200 3300044694 Ga0466963_0043897 Ga0466963_0043897_1029_1625 192
201 3300045976 Ga0466967_0255654 Ga0466967_0255654_323_919 192
202 3300048904 Ga0496101_0206284 Ga0496101_0206284_234_821 192
203 3300048906 Ga0496103_0164634 Ga0496103_0164634_200_787 192
204 3300048907 Ga0496104_0019246 Ga0496104_0019246_1248_1835 192
205 3300048910 Ga0496107_0041489 Ga0496107_0041489_2201_2788 192
206 3300048911 Ga0496108_0001639 Ga0496108_0001639_15163_15750 192
207 3300048912 Ga0496109_0035209 Ga0496109_0035209_1277_1864 192
208 3300048913 Ga0496110_0002351 Ga0496110_0002351_7312_7899 192
209 3300048914 Ga0496111_0068769 Ga0496111_0068769_255_842 192
210 3300048916 Ga0496113_0004409 Ga0496113_0004409_3678_4265 192
211 3300010375 Ga0105239_10154711 Ga0105239_101547113 193
212 3300025933 Ga0207706_10010417 Ga0207706_100104175 193
213 3300046491 Ga0495584_0263386 Ga0495584_0263386_90_728 193
214 3300046523 Ga0495644_0175579 Ga0495644_0175579_81_719 193
215 3300044719 Ga0466971_0014266 Ga0466971_0014266_2269_2880 194
216 3300044842 Ga0466957_0523014 Ga0466957_0523014_82_693 194
217 3300045836 Ga0466958_0187391 Ga0466958_0187391_183_794 194
218 3300045976 Ga0466967_0029561 Ga0466967_0029561_707_1318 194
219 3300005337 Ga0070682_100500317 Ga0070682_1005003171 195
220 3300005339 Ga0070660_100050719 Ga0070660_1000507193 195
221 3300005344 Ga0070661_100065602 Ga0070661_1000656023 195
222 3300005458 Ga0070681_10078347 Ga0070681_100783474 195
223 3300005458 Ga0070681_10186674 Ga0070681_101866743 195
224 3300005530 Ga0070679_100021643 Ga0070679_1000216436 195
225 3300005530 Ga0070679_100054903 Ga0070679_1000549034 195
226 3300005530 Ga0070679_100294779 Ga0070679_1002947792 195
227 3300005539 Ga0068853_100390264 Ga0068853_1003902642 195
228 3300005577 Ga0068857_100613880 Ga0068857_1006138802 195
229 3300009093 Ga0105240_10407390 Ga0105240_104073901 195
230 3300013307 Ga0157372_10194191 Ga0157372_101941913 195
231 3300013308 Ga0157375_10019167 Ga0157375_100191676 195
232 3300025912 Ga0207707_10039759 Ga0207707_100397594 195
233 3300025917 Ga0207660_10021857 Ga0207660_100218573 195
234 3300025919 Ga0207657_10088477 Ga0207657_100884773 195
235 3300025919 Ga0207657_10295785 Ga0207657_102957852 195
236 3300025921 Ga0207652_10204831 Ga0207652_102048311 195
237 3300026041 Ga0207639_10245967 Ga0207639_102459671 195
238 3300026067 Ga0207678_11022182 Ga0207678_110221821 195
239 3300026116 Ga0207674_10029332 Ga0207674_100293326 195
240 3300037068 Ga0373925_0277634 Ga0373925_0277634_546_1148 195
241 3300042005 Ga0439448_0120022 Ga0439448_0120022_299_892 195
242 3300046473 Ga0495582_0130634 Ga0495582_0130634_640_1242 195
243 3300046506 Ga0495583_0294309 Ga0495583_0294309_12_614 195
244 3300046615 Ga0495656_0033437 Ga0495656_0033437_594_1196 195
245 3300046690 Ga0495624_0401169 Ga0495624_0401169_60_662 195
246 3300046692 Ga0495671_0183687 Ga0495671_0183687_140_742 195
247 3300048904 Ga0496101_0128510 Ga0496101_0128510_350_952 195
248 3300048907 Ga0496104_0007994 Ga0496104_0007994_7321_7923 195
249 3300048908 Ga0496105_0048656 Ga0496105_0048656_560_1162 195
250 3300048911 Ga0496108_0012650 Ga0496108_0012650_5736_6338 195
251 3300048912 Ga0496109_0118069 Ga0496109_0118069_1122_1724 195
252 3300048913 Ga0496110_0004851 Ga0496110_0004851_3774_4376 195
253 3300048914 Ga0496111_0005204 Ga0496111_0005204_5194_5796 195
254 3300048915 Ga0496112_0080709 Ga0496112_0080709_1493_2095 195
255 3300048916 Ga0496113_0000612 Ga0496113_0000612_2193_2795 195
256 3300048917 Ga0496114_0029440 Ga0496114_0029440_2143_2745 195
257 3300048918 Ga0496115_0020748 Ga0496115_0020748_1375_1977 195
258 3300049583 Ga0501067_0001274 Ga0501067_0001274_8844_9437 195
259 3300049585 Ga0501069_0005847 Ga0501069_0005847_717_1310 195
260 3300049586 Ga0501070_0099001 Ga0501070_0099001_1135_1728 195
261 3300049743 Ga0501081_0130715 Ga0501081_0130715_80_673 195
262 3300061734 Ga0530510_0022085 Ga0530510_0022085_3687_4280 195
263 3300009093 Ga0105240_10178584 Ga0105240_101785841 196
264 3300013104 Ga0157370_10002516 Ga0157370_1000251614 196
265 3300013307 Ga0157372_10584061 Ga0157372_105840612 196
266 3300005328 Ga0070676_10081876 Ga0070676_100818762 199
267 3300005328 Ga0070676_10334144 Ga0070676_103341442 199
268 3300005329 Ga0070683_100138930 Ga0070683_1001389303 199
269 3300005329 Ga0070683_100343345 Ga0070683_1003433452 199
270 3300005330 Ga0070690_100209833 Ga0070690_1002098332 199
271 3300005336 Ga0070680_100070859 Ga0070680_1000708592 199
272 3300005338 Ga0068868_100021788 Ga0068868_1000217884 199
273 3300005338 Ga0068868_100167146 Ga0068868_1001671462 199
274 3300005339 Ga0070660_100031245 Ga0070660_1000312454 199
275 3300005340 Ga0070689_100358758 Ga0070689_1003587582 199
276 3300005340 Ga0070689_100507162 Ga0070689_1005071622 199
277 3300005341 Ga0070691_10074907 Ga0070691_100749072 199
278 3300005343 Ga0070687_100146084 Ga0070687_1001460842 199
279 3300005347 Ga0070668_100122738 Ga0070668_1001227383 199
280 3300005353 Ga0070669_100064010 Ga0070669_1000640103 199
281 3300005355 Ga0070671_100167077 Ga0070671_1001670772 199
282 3300005356 Ga0070674_100027862 Ga0070674_1000278622 199
283 3300005364 Ga0070673_100032982 Ga0070673_1000329823 199
284 3300005364 Ga0070673_100917615 Ga0070673_1009176151 199
285 3300005365 Ga0070688_100406136 Ga0070688_1004061362 199
286 3300005366 Ga0070659_100269334 Ga0070659_1002693342 199
287 3300005436 Ga0070713_100056744 Ga0070713_1000567444 199
288 3300005438 Ga0070701_10031548 Ga0070701_100315483 199
289 3300005440 Ga0070705_100420745 Ga0070705_1004207452 199
290 3300005441 Ga0070700_100034234 Ga0070700_1000342344 199
291 3300005444 Ga0070694_100214358 Ga0070694_1002143583 199
292 3300005445 Ga0070708_100058064 Ga0070708_1000580643 199
293 3300005456 Ga0070678_100015402 Ga0070678_1000154023 199
294 3300005456 Ga0070678_100544970 Ga0070678_1005449702 199
295 3300005457 Ga0070662_100137253 Ga0070662_1001372532 199
296 3300005457 Ga0070662_100286800 Ga0070662_1002868002 199
297 3300005459 Ga0068867_100077554 Ga0068867_1000775543 199
298 3300005467 Ga0070706_100009785 Ga0070706_1000097856 199
299 3300005468 Ga0070707_100005169 Ga0070707_1000051694 199
300 3300005471 Ga0070698_100447382 Ga0070698_1004473822 199
301 3300005518 Ga0070699_100014180 Ga0070699_1000141803 199
302 3300005518 Ga0070699_100026603 Ga0070699_1000266034 199
303 3300005530 Ga0070679_100795398 Ga0070679_1007953981 199
304 3300005535 Ga0070684_100496266 Ga0070684_1004962662 199
305 3300005536 Ga0070697_100090377 Ga0070697_1000903772 199
306 3300005539 Ga0068853_100616433 Ga0068853_1006164332 199
307 3300005543 Ga0070672_100155796 Ga0070672_1001557962 199
308 3300005544 Ga0070686_100065670 Ga0070686_1000656703 199
309 3300005544 Ga0070686_100491057 Ga0070686_1004910571 199
310 3300005545 Ga0070695_100291237 Ga0070695_1002912371 199
311 3300005546 Ga0070696_100579213 Ga0070696_1005792132 199
312 3300005547 Ga0070693_100085983 Ga0070693_1000859832 199
313 3300005563 Ga0068855_100112283 Ga0068855_1001122832 199
314 3300005564 Ga0070664_100575210 Ga0070664_1005752102 199
315 3300005578 Ga0068854_100028313 Ga0068854_1000283133 199
316 3300005615 Ga0070702_100082577 Ga0070702_1000825772 199
317 3300005616 Ga0068852_100697629 Ga0068852_1006976292 199
318 3300005617 Ga0068859_100468278 Ga0068859_1004682783 199
319 3300005618 Ga0068864_100290358 Ga0068864_1002903582 199
320 3300005718 Ga0068866_10154946 Ga0068866_101549462 199
321 3300005719 Ga0068861_100018180 Ga0068861_1000181806 199
322 3300005843 Ga0068860_100549176 Ga0068860_1005491761 199
323 3300005844 Ga0068862_100355280 Ga0068862_1003552802 199
324 3300005937 Ga0081455_10006302 Ga0081455_100063023 199
325 3300005983 Ga0081540_1004699 Ga0081540_10046992 199
326 3300006028 Ga0070717_10050252 Ga0070717_100502524 199
327 3300006058 Ga0075432_10024425 Ga0075432_100244253 199
328 3300006173 Ga0070716_100323424 Ga0070716_1003234242 199
329 3300006847 Ga0075431_100132704 Ga0075431_1001327042 199
330 3300006871 Ga0075434_100158526 Ga0075434_1001585263 199
331 3300006880 Ga0075429_100157336 Ga0075429_1001573362 199
332 3300006914 Ga0075436_100009431 Ga0075436_1000094312 199
333 3300006931 Ga0097620_100468302 Ga0097620_1004683021 199
334 3300007076 Ga0075435_100374301 Ga0075435_1003743012 199
335 3300009092 Ga0105250_10074374 Ga0105250_100743742 199
336 3300009098 Ga0105245_10041452 Ga0105245_100414523 199
337 3300009098 Ga0105245_10151137 Ga0105245_101511373 199
338 3300009098 Ga0105245_10286766 Ga0105245_102867663 199
339 3300009098 Ga0105245_11932870 Ga0105245_119328701 199
340 3300009147 Ga0114129_10069365 Ga0114129_100693654 199
341 3300009148 Ga0105243_10058320 Ga0105243_100583203 199
342 3300009148 Ga0105243_10278002 Ga0105243_102780023 199
343 3300009176 Ga0105242_10025311 Ga0105242_100253112 199
344 3300009177 Ga0105248_10069119 Ga0105248_100691195 199
345 3300009177 Ga0105248_10497426 Ga0105248_104974262 199
346 3300009553 Ga0105249_10026375 Ga0105249_100263753 199
347 3300009553 Ga0105249_10078383 Ga0105249_100783833 199
348 3300009553 Ga0105249_10478008 Ga0105249_104780082 199
349 3300009553 Ga0105249_10907855 Ga0105249_109078551 199
350 3300010375 Ga0105239_10093744 Ga0105239_100937441 199
351 3300012481 Ga0157320_1000895 Ga0157320_10008952 199
352 3300012497 Ga0157319_1005770 Ga0157319_10057701 199
353 3300012503 Ga0157313_1002734 Ga0157313_10027341 199
354 3300013102 Ga0157371_10028105 Ga0157371_100281053 199
355 3300013297 Ga0157378_10185453 Ga0157378_101854533 199
356 3300013306 Ga0163162_10060678 Ga0163162_100606783 199
357 3300013307 Ga0157372_10383170 Ga0157372_103831702 199
358 3300013308 Ga0157375_10020987 Ga0157375_100209875 199
359 3300014325 Ga0163163_10835227 Ga0163163_108352272 199
360 3300014326 Ga0157380_10015939 Ga0157380_100159393 199
361 3300014969 Ga0157376_10617688 Ga0157376_106176882 199
362 3300017792 Ga0163161_10031916 Ga0163161_100319163 199
363 3300025899 Ga0207642_10096720 Ga0207642_100967202 199
364 3300025899 Ga0207642_10256181 Ga0207642_102561812 199
365 3300025907 Ga0207645_10054317 Ga0207645_100543173 199
366 3300025907 Ga0207645_10300121 Ga0207645_103001212 199
367 3300025910 Ga0207684_10103980 Ga0207684_101039803 199
368 3300025914 Ga0207671_10162484 Ga0207671_101624842 199
369 3300025915 Ga0207693_10048916 Ga0207693_100489164 199
370 3300025916 Ga0207663_10358158 Ga0207663_103581581 199
371 3300025917 Ga0207660_10194054 Ga0207660_101940543 199
372 3300025918 Ga0207662_10029471 Ga0207662_100294712 199
373 3300025919 Ga0207657_10011840 Ga0207657_100118408 199
374 3300025920 Ga0207649_10488575 Ga0207649_104885752 199
375 3300025922 Ga0207646_10012659 Ga0207646_100126596 199
376 3300025927 Ga0207687_10054987 Ga0207687_100549872 199
377 3300025927 Ga0207687_10068145 Ga0207687_100681453 199
378 3300025927 Ga0207687_10117288 Ga0207687_101172882 199
379 3300025932 Ga0207690_10268125 Ga0207690_102681252 199
380 3300025933 Ga0207706_10018314 Ga0207706_100183148 199
381 3300025934 Ga0207686_10297157 Ga0207686_102971572 199
382 3300025934 Ga0207686_10391558 Ga0207686_103915581 199
383 3300025935 Ga0207709_10558095 Ga0207709_105580952 199
384 3300025936 Ga0207670_10877269 Ga0207670_108772691 199
385 3300025938 Ga0207704_10553467 Ga0207704_105534672 199
386 3300025940 Ga0207691_10540370 Ga0207691_105403701 199
387 3300025941 Ga0207711_10205634 Ga0207711_102056343 199
388 3300025941 Ga0207711_10376897 Ga0207711_103768972 199
389 3300025942 Ga0207689_10633434 Ga0207689_106334342 199
390 3300025944 Ga0207661_10220513 Ga0207661_102205132 199
391 3300025945 Ga0207679_10460926 Ga0207679_104609262 199
392 3300025945 Ga0207679_10501653 Ga0207679_105016532 199
393 3300025949 Ga0207667_10546700 Ga0207667_105467002 199
394 3300025949 Ga0207667_10651785 Ga0207667_106517852 199
395 3300025960 Ga0207651_10122907 Ga0207651_101229072 199
396 3300025960 Ga0207651_10531756 Ga0207651_105317562 199
397 3300025961 Ga0207712_10188107 Ga0207712_101881072 199
398 3300025961 Ga0207712_10258512 Ga0207712_102585123 199
399 3300025961 Ga0207712_10454711 Ga0207712_104547112 199
400 3300025972 Ga0207668_10045440 Ga0207668_100454403 199
401 3300025981 Ga0207640_10139815 Ga0207640_101398153 199
402 3300026023 Ga0207677_10142366 Ga0207677_101423663 199
403 3300026023 Ga0207677_10290017 Ga0207677_102900172 199
404 3300026035 Ga0207703_10368809 Ga0207703_103688092 199
405 3300026075 Ga0207708_10011806 Ga0207708_100118063 199
406 3300026078 Ga0207702_10388214 Ga0207702_103882142 199
407 3300026089 Ga0207648_10020652 Ga0207648_100206525 199
408 3300026095 Ga0207676_10433586 Ga0207676_104335863 199
409 3300026118 Ga0207675_100008428 Ga0207675_10000842811 199
410 3300026118 Ga0207675_100356731 Ga0207675_1003567312 199
411 3300026121 Ga0207683_10031994 Ga0207683_100319944 199
412 3300026121 Ga0207683_10611532 Ga0207683_106115322 199
413 3300028381 Ga0268264_10968010 Ga0268264_109680102 199
414 3300031731 Ga0307405_10194749 Ga0307405_101947492 199
415 3300031995 Ga0307409_100068664 Ga0307409_1000686642 199
416 3300032002 Ga0307416_100919909 Ga0307416_1009199092 199
417 3300035089 Ga0373944_0010639 Ga0373944_0010639_1127_1765 199
418 3300035114 Ga0373939_0017153 Ga0373939_0017153_434_1048 199
419 3300035116 Ga0373945_0024109 Ga0373945_0024109_1414_2052 199
420 3300035121 Ga0373960_0136084 Ga0373960_0136084_47_661 199
421 3300035242 Ga0373962_0020228 Ga0373962_0020228_346_960 199
422 3300035725 Ga0373947_0000664 Ga0373947_0000664_9576_10214 199
423 3300037068 Ga0373925_0020960 Ga0373925_0020960_851_1489 199
424 3300037312 Ga0395899_0008449 Ga0395899_0008449_250_888 199
425 3300037312 Ga0395899_0009866 Ga0395899_0009866_1856_2470 199
426 3300037312 Ga0395899_0021787 Ga0395899_0021787_1638_2252 199
427 3300037312 Ga0395899_0211076 Ga0395899_0211076_373_981 199
428 3300037418 Ga0395900_0003572 Ga0395900_0003572_142_750 199
429 3300037418 Ga0395900_0008866 Ga0395900_0008866_7944_8558 199
430 3300037418 Ga0395900_0010139 Ga0395900_0010139_7277_7915 199
431 3300037418 Ga0395900_0861180 Ga0395900_0861180_197_811 199
432 3300037466 Ga0395898_0001088 Ga0395898_0001088_27458_28072 199
433 3300037466 Ga0395898_0005269 Ga0395898_0005269_9440_10048 199
434 3300037466 Ga0395898_0009019 Ga0395898_0009019_8641_9255 199
435 3300037466 Ga0395898_0081040 Ga0395898_0081040_2476_3090 199
436 3300037466 Ga0395898_0193798 Ga0395898_0193798_926_1564 199
437 3300037466 Ga0395898_0313393 Ga0395898_0313393_471_1085 199
438 3300037471 Ga0395905_0001800 Ga0395905_0001800_3868_4482 199
439 3300037471 Ga0395905_0011027 Ga0395905_0011027_5728_6336 199
440 3300037471 Ga0395905_0016912 Ga0395905_0016912_2383_3021 199
441 3300037471 Ga0395905_0080585 Ga0395905_0080585_129_743 199
442 3300037471 Ga0395905_0260395 Ga0395905_0260395_822_1436 199
443 3300038443 Ga0395901_0002285 Ga0395901_0002285_17001_17615 199
444 3300038443 Ga0395901_0006248 Ga0395901_0006248_10440_11054 199
445 3300038443 Ga0395901_0014628 Ga0395901_0014628_2081_2719 199
446 3300038443 Ga0395901_0147824 Ga0395901_0147824_257_865 199
447 3300038443 Ga0395901_0237416 Ga0395901_0237416_657_1271 199
448 3300038443 Ga0395901_1352235 Ga0395901_1352235_11_622 199
449 3300039450 Ga0436363_1254646 Ga0436363_1254646_371_973 199
450 3300042461 Ga0439460_0053297 Ga0439460_0053297_523_1137 199
451 3300045051 Ga0451576_0009107 Ga0451576_0009107_10903_11511 199
452 3300045051 Ga0451576_0156682 Ga0451576_0156682_1653_2291 199
453 3300045051 Ga0451576_1062406 Ga0451576_1062406_113_727 199
454 3300046455 Ga0495603_0000219 Ga0495603_0000219_19455_20093 199
455 3300046461 Ga0495641_0000516 Ga0495641_0000516_11031_11669 199
456 3300046472 Ga0495580_0105068 Ga0495580_0105068_276_914 199
457 3300046473 Ga0495582_0027449 Ga0495582_0027449_548_1162 199
458 3300046499 Ga0495594_0009038 Ga0495594_0009038_1181_1819 199
459 3300046557 Ga0495622_0020433 Ga0495622_0020433_1918_2556 199
460 3300046674 Ga0495588_0000660 Ga0495588_0000660_4065_4703 199
461 3300046794 Ga0495589_0234076 Ga0495589_0234076_108_746 199
462 3300047321 Ga0495676_0000977 Ga0495676_0000977_11074_11712 199
463 3300048904 Ga0496101_0321385 Ga0496101_0321385_40_648 199
464 3300048905 Ga0496102_0037456 Ga0496102_0037456_1208_1822 199
465 3300048905 Ga0496102_0059615 Ga0496102_0059615_2616_3224 199
466 3300048905 Ga0496102_0433250 Ga0496102_0433250_303_917 199
467 3300048907 Ga0496104_0002376 Ga0496104_0002376_9422_10036 199
468 3300048908 Ga0496105_0082467 Ga0496105_0082467_942_1556 199
469 3300048909 Ga0496106_0088709 Ga0496106_0088709_793_1407 199
470 3300048909 Ga0496106_0142310 Ga0496106_0142310_827_1435 199
471 3300048910 Ga0496107_0023106 Ga0496107_0023106_3725_4339 199
472 3300048910 Ga0496107_0308008 Ga0496107_0308008_243_857 199
473 3300048911 Ga0496108_0002438 Ga0496108_0002438_13432_14046 199
474 3300048912 Ga0496109_0051487 Ga0496109_0051487_1309_1923 199
475 3300048914 Ga0496111_0003363 Ga0496111_0003363_2619_3233 199
476 3300048915 Ga0496112_0024000 Ga0496112_0024000_1367_1981 199
477 3300048916 Ga0496113_0022210 Ga0496113_0022210_3491_4105 199
478 3300048917 Ga0496114_0167288 Ga0496114_0167288_1100_1708 199
479 3300050508 nmdc:mga09592_256991_c1 nmdc:mga09592_256991_c1_403_1017 199
480 3300050510 nmdc:mga06r32_595847_c1 nmdc:mga06r32_595847_c1_42_656 199
481 3300050511 nmdc:mga08y16_908261_c1 nmdc:mga08y16_908261_c1_160_774 199
482 3300050511 nmdc:mga08y16_99563_c1 nmdc:mga08y16_99563_c1_340_954 199
483 3300050512 nmdc:mga0n895_81357_c1 nmdc:mga0n895_81357_c1_2214_2828 199
484 3300050513 nmdc:mga0rr50_13606_c1 nmdc:mga0rr50_13606_c1_1571_2185 199
485 3300050513 nmdc:mga0rr50_458260_c1 nmdc:mga0rr50_458260_c1_394_1008 199
486 3300050515 nmdc:mga0a205_100150_c1 nmdc:mga0a205_100150_c1_229_843 199
487 3300050515 nmdc:mga0a205_622364_c1 nmdc:mga0a205_622364_c1_169_783 199
488 3300050515 nmdc:mga0a205_703827_c1 nmdc:mga0a205_703827_c1_103_717 199
489 3300005327 Ga0070658_10005299 Ga0070658_100052998 200
490 3300005336 Ga0070680_100017431 Ga0070680_1000174313 200
491 3300005336 Ga0070680_100225641 Ga0070680_1002256412 200
492 3300005337 Ga0070682_100195563 Ga0070682_1001955632 200
493 3300005337 Ga0070682_100278148 Ga0070682_1002781481 200
494 3300005339 Ga0070660_100002486 Ga0070660_10000248614 200
495 3300005344 Ga0070661_100037444 Ga0070661_1000374444 200
496 3300005355 Ga0070671_100440162 Ga0070671_1004401622 200
497 3300005458 Ga0070681_10045952 Ga0070681_100459524 200
498 3300005458 Ga0070681_10137226 Ga0070681_101372261 200
499 3300005530 Ga0070679_100002705 Ga0070679_1000027059 200
500 3300005530 Ga0070679_100125949 Ga0070679_1001259493 200
501 3300005535 Ga0070684_100002119 Ga0070684_10000211912 200
502 3300005539 Ga0068853_100338326 Ga0068853_1003383262 200
503 3300005563 Ga0068855_100547653 Ga0068855_1005476532 200
504 3300005616 Ga0068852_100022416 Ga0068852_1000224163 200
505 3300005616 Ga0068852_100049174 Ga0068852_1000491743 200
506 3300006175 Ga0070712_100220949 Ga0070712_1002209493 200
507 3300006871 Ga0075434_100005449 Ga0075434_1000054499 200
508 3300007076 Ga0075435_100253739 Ga0075435_1002537392 200
509 3300009176 Ga0105242_10042260 Ga0105242_100422603 200
510 3300013104 Ga0157370_10227802 Ga0157370_102278021 200
511 3300013297 Ga0157378_10163855 Ga0157378_101638552 200
512 3300020069 Ga0197907_11086716 Ga0197907_110867165 200
513 3300020081 Ga0206354_11233273 Ga0206354_112332731 200
514 3300020082 Ga0206353_10911104 Ga0206353_109111043 200
515 3300020082 Ga0206353_10982834 Ga0206353_109828342 200
516 3300025909 Ga0207705_10114239 Ga0207705_101142393 200
517 3300025912 Ga0207707_10024618 Ga0207707_100246186 200
518 3300025913 Ga0207695_10283121 Ga0207695_102831212 200
519 3300025917 Ga0207660_10043606 Ga0207660_100436062 200
520 3300025917 Ga0207660_10297483 Ga0207660_102974832 200
521 3300025919 Ga0207657_10001654 Ga0207657_1000165417 200
522 3300025920 Ga0207649_10022809 Ga0207649_100228093 200
523 3300025921 Ga0207652_10199998 Ga0207652_101999982 200
524 3300025929 Ga0207664_10328858 Ga0207664_103288582 200
525 3300025929 Ga0207664_10397419 Ga0207664_103974192 200
526 3300025931 Ga0207644_10258428 Ga0207644_102584282 200
527 3300025949 Ga0207667_10433592 Ga0207667_104335922 200
528 3300026142 Ga0207698_10120346 Ga0207698_101203461 200
529 3300028558 Ga0265326_10047912 Ga0265326_100479121 200
530 3300028563 Ga0265319_1072983 Ga0265319_10729832 200
531 3300028577 Ga0265318_10045496 Ga0265318_100454962 200
532 3300028654 Ga0265322_10010830 Ga0265322_100108303 200
533 3300028800 Ga0265338_10022159 Ga0265338_100221596 200
534 3300031239 Ga0265328_10137782 Ga0265328_101377822 200
535 3300031241 Ga0265325_10063380 Ga0265325_100633801 200
536 3300031247 Ga0265340_10036305 Ga0265340_100363052 200
537 3300031249 Ga0265339_10040690 Ga0265339_100406904 200
538 3300031344 Ga0265316_10017339 Ga0265316_100173393 200
539 3300031595 Ga0265313_10017169 Ga0265313_100171693 200
540 3300031711 Ga0265314_10003467 Ga0265314_100034678 200
541 3300031712 Ga0265342_10041734 Ga0265342_100417341 200
542 3300037471 Ga0395905_0493651 Ga0395905_0493651_178_786 200
543 3300038443 Ga0395901_0012213 Ga0395901_0012213_5264_5872 200
544 3300044658 Ga0466972_0161118 Ga0466972_0161118_185_793 200
545 3300044684 Ga0466966_0192281 Ga0466966_0192281_212_823 200
546 3300044706 Ga0466964_0000345 Ga0466964_0000345_6460_7068 200
547 3300044706 Ga0466964_0019450 Ga0466964_0019450_1379_1987 200
548 3300044719 Ga0466971_0017308 Ga0466971_0017308_629_1237 200
549 3300044842 Ga0466957_0017401 Ga0466957_0017401_1053_1661 200
550 3300044901 Ga0466960_0142140 Ga0466960_0142140_542_1150 200
551 3300045049 Ga0466959_0016325 Ga0466959_0016325_4371_4979 200
552 3300045836 Ga0466958_0006066 Ga0466958_0006066_4871_5479 200
553 3300045976 Ga0466967_0030293 Ga0466967_0030293_330_938 200
554 3300046454 Ga0495592_0024442 Ga0495592_0024442_1559_2170 200
555 3300046462 Ga0495651_0015286 Ga0495651_0015286_2383_2994 200
556 3300046463 Ga0495653_0205608 Ga0495653_0205608_276_884 200
557 3300046476 Ga0495662_0322933 Ga0495662_0322933_37_645 200
558 3300046477 Ga0495664_0092676 Ga0495664_0092676_758_1366 200
559 3300046511 Ga0495608_0332784 Ga0495608_0332784_251_859 200
560 3300046516 Ga0495628_0273353 Ga0495628_0273353_347_958 200
561 3300046517 Ga0495630_0050663 Ga0495630_0050663_85_696 200
562 3300046529 Ga0495652_0446532 Ga0495652_0446532_143_751 200
563 3300046533 Ga0495640_0058566 Ga0495640_0058566_486_1097 200
564 3300046533 Ga0495640_0079781 Ga0495640_0079781_902_1510 200
565 3300046535 Ga0495586_0114377 Ga0495586_0114377_430_1038 200
566 3300046535 Ga0495586_0126264 Ga0495586_0126264_768_1379 200
567 3300046536 Ga0495587_0181541 Ga0495587_0181541_565_1173 200
568 3300046559 Ga0495667_0001711 Ga0495667_0001711_9588_10199 200
569 3300046642 Ga0495634_0014753 Ga0495634_0014753_3736_4344 200
570 3300046642 Ga0495634_0042253 Ga0495634_0042253_304_915 200
571 3300046663 Ga0495635_0092078 Ga0495635_0092078_1289_1897 200
572 3300046663 Ga0495635_0143391 Ga0495635_0143391_54_665 200
573 3300046675 Ga0495657_0222989 Ga0495657_0222989_32_640 200
574 3300046678 Ga0495599_0019441 Ga0495599_0019441_3356_3967 200
575 3300046689 Ga0495613_0049721 Ga0495613_0049721_66_677 200
576 3300046689 Ga0495613_0339148 Ga0495613_0339148_405_1013 200
577 3300046809 Ga0495600_0019857 Ga0495600_0019857_1578_2186 200
578 3300046809 Ga0495600_0218671 Ga0495600_0218671_206_814 200
579 3300047315 Ga0495581_0068795 Ga0495581_0068795_261_872 200
580 3300047317 Ga0495604_0028425 Ga0495604_0028425_3210_3818 200
581 3300047317 Ga0495604_0066588 Ga0495604_0066588_1634_2245 200
582 3300047319 Ga0495674_0002208 Ga0495674_0002208_10527_11138 200
583 3300047322 Ga0495680_0004620 Ga0495680_0004620_3426_4034 200
584 3300047322 Ga0495680_0030276 Ga0495680_0030276_261_872 200
585 3300047471 Ga0495684_0013231 Ga0495684_0013231_2608_3216 200
586 3300047471 Ga0495684_0092468 Ga0495684_0092468_1392_2003 200
587 3300048088 Ga0495602_0278220 Ga0495602_0278220_288_896 200
588 3300048903 Ga0496100_0021461 Ga0496100_0021461_1741_2349 200
589 3300048904 Ga0496101_0000424 Ga0496101_0000424_26236_26844 200
590 3300048904 Ga0496101_0005214 Ga0496101_0005214_752_1360 200
591 3300048905 Ga0496102_0003088 Ga0496102_0003088_11743_12351 200
592 3300048905 Ga0496102_0009838 Ga0496102_0009838_2148_2756 200
593 3300048907 Ga0496104_0006585 Ga0496104_0006585_5733_6341 200
594 3300048907 Ga0496104_0555635 Ga0496104_0555635_141_749 200
595 3300048908 Ga0496105_0000597 Ga0496105_0000597_8473_9081 200
596 3300048909 Ga0496106_0007641 Ga0496106_0007641_833_1441 200
597 3300048909 Ga0496106_0014004 Ga0496106_0014004_2061_2669 200
598 3300048910 Ga0496107_0020310 Ga0496107_0020310_634_1242 200
599 3300048911 Ga0496108_0010971 Ga0496108_0010971_5327_5935 200
600 3300048912 Ga0496109_0050646 Ga0496109_0050646_2186_2794 200
601 3300048913 Ga0496110_0006795 Ga0496110_0006795_2704_3312 200
602 3300048917 Ga0496114_0000392 Ga0496114_0000392_16716_17324 200
603 3300048917 Ga0496114_0361573 Ga0496114_0361573_23_697 200
604 3300048918 Ga0496115_0001999 Ga0496115_0001999_11743_12351 200
605 3300048918 Ga0496115_0222990 Ga0496115_0222990_545_1153 200
606 3300049590 Ga0501074_0147796 Ga0501074_0147796_689_1297 200
607 3300053077 Ga0495601_0026769 Ga0495601_0026769_2424_3035 200
608 3300053085 Ga0495619_0012550 Ga0495619_0012550_3241_3849 200
609 3300053085 Ga0495619_0080638 Ga0495619_0080638_981_1592 200

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08281

Sigma70_r4_2

Sigma-70, region 4

149

202

0.95

PF04542

Sigma70_r2

Sigma-70 region 2

54

123

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5fgm-assembly1.cif.gz_A streptomyces coelicolor sigr region 4 0.9324 142 196
2o7g-assembly1.cif.gz_A crystal structure of the pribnow box recognition region of sigc from mycobacterium tuberculosis 0.9245 30 106
4go1-assembly1.cif.gz_B-2 crystal structure of full length transcription repressor lsrr from e. coli. 0.917 154 192
3vfz-assembly3.cif.gz_A crystal structure of -35 promoter binding domain of sigd of mycobacterium tuberculosis 0.9096 142 200
6jhe-assembly1.cif.gz_A crystal structure of bacillus subtilis sigw domain 4 in complexed with -35 element dna 0.9018 150 200
ID Description Score Start End Superfamily
af_P9WGH1_1_91_1.10.1740.10 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.9317 30 106 1.10.1740.10
2o7gB00 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.9278 30 106 1.10.1740.10
2o7gA00 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.9245 30 106 1.10.1740.10
af_P9WGH7_10_94_1.10.1740.10 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.923 30 109 1.10.1740.10
4go1B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.917 154 192 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A538IS04-F1-model_v4 Sigma-70 family RNA polymerase sigma factor 0.5688 1 171 GO:0006352
GO:0016987
AF-A0A538IS04-F1-model_v4 Sigma-70 family RNA polymerase sigma factor 0.5591 1 171 GO:0006352
GO:0016987
AF-A0A537ZU40-F1-model_v4 Sigma-70 family RNA polymerase sigma factor 0.5186 5 198 GO:0003677
GO:0006352
GO:0016987
AF-A0A2E0WEK7-F1-model_v4 RNA polymerase sigma factor SigM 0.5175 23 196 GO:0003677
GO:0006352
GO:0016987
AF-A0A7Y2HC62-F1-model_v4 Sigma-70 family RNA polymerase sigma factor 0.5149 26 196 GO:0003677
GO:0006352
GO:0016987

Feature Viewer

pLDDT pTM Quality
88.54 0.52 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map