F468874
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 609 | 302 | 609 | 198 |
Family's Representative Sequence
| Representative Sequence | 3300026035|Ga0207703_10368809|Ga0207703_103688092 |
| Length | 212 |
| Sequence | MAKYTTAAVQPPLRKRRQIRQDPRPERPLVYERLSDPILVKRAKDGDAKALAALVERHAPRAERLAAHVLADPEDARDAAQEALAKLCVRLRQFRGDSQFATWFHRLVVNTCLDVGDRQRGRRCEPLHEDERVAPDGDPTREMALSELRHELAAELAELSDEQASVVVLKDALGFSFAEISERSGMPVGTAKCYAHRARAGLRARLTDEHAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 34 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 42 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 48 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 50 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 51 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 52 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 56 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 57 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 58 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 59 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 60 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 61 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 62 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 64 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 69 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 70 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 71 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 72 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 73 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 75 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300012481 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 | Metagenome | Rhizosphere |
| 88 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 89 | 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Metagenome | Rhizosphere |
| 90 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 102 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 104 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 105 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 106 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 107 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 108 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 162 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 163 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 164 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 165 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 166 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 167 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 168 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 169 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 170 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 171 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 172 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 173 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 174 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 175 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 176 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 177 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 178 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 179 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 180 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 181 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 182 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 183 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 184 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 185 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 186 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 187 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 188 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 189 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 190 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 191 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 192 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 193 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 194 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 195 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 196 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 197 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 198 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 199 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 200 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 201 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 202 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 203 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 204 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 205 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 206 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 207 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 208 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 209 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 210 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 211 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 256 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 257 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 258 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 259 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 260 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 261 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 262 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 263 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 264 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 265 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 266 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 267 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 268 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 269 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 270 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 271 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 292 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 295 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.85 |
| Metatranscriptomes | 1.15 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 11.99 |
| Rhizosphere | 87.03 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.99 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10005299 | 3300005327 | Bacteria | 10469 |
| 2 | Ga0070676_10081876 | 3300005328 | Bacteria | 1960 |
| 3 | Ga0070676_10334144 | 3300005328 | Unclassified | 1037 |
| 4 | Ga0070683_100138930 | 3300005329 | Bacteria | 2301 |
| 5 | Ga0070683_100343345 | 3300005329 | Bacteria | 1422 |
| 6 | Ga0070690_100209833 | 3300005330 | Unclassified | 1359 |
| 7 | Ga0070680_100017431 | 3300005336 | Bacteria | 5664 |
| 8 | Ga0070680_100070859 | 3300005336 | Bacteria | 2864 |
| 9 | Ga0070680_100225641 | 3300005336 | Bacteria | 1581 |
| 10 | Ga0070682_100095236 | 3300005337 | Bacteria | 1955 |
| 11 | Ga0070682_100195563 | 3300005337 | Bacteria | 1423 |
| 12 | Ga0070682_100278148 | 3300005337 | Bacteria | 1219 |
| 13 | Ga0070682_100500317 | 3300005337 | Bacteria | 941 |
| 14 | Ga0068868_100021788 | 3300005338 | Bacteria | 4828 |
| 15 | Ga0068868_100167146 | 3300005338 | Bacteria | 1820 |
| 16 | Ga0070660_100002486 | 3300005339 | Bacteria | 12647 |
| 17 | Ga0070660_100031245 | 3300005339 | Bacteria | 3998 |
| 18 | Ga0070660_100050719 | 3300005339 | Bacteria | 3193 |
| 19 | Ga0070689_100358758 | 3300005340 | Bacteria | 1224 |
| 20 | Ga0070689_100507162 | 3300005340 | Bacteria | 1034 |
| 21 | Ga0070691_10074907 | 3300005341 | Bacteria | 1648 |
| 22 | Ga0070691_10135809 | 3300005341 | Bacteria | 1250 |
| 23 | Ga0070687_100146084 | 3300005343 | Bacteria | 1383 |
| 24 | Ga0070661_100037444 | 3300005344 | Bacteria | 3529 |
| 25 | Ga0070661_100065602 | 3300005344 | Bacteria | 2667 |
| 26 | Ga0070668_100122738 | 3300005347 | Bacteria | 2078 |
| 27 | Ga0070669_100064010 | 3300005353 | Bacteria | 2708 |
| 28 | Ga0070671_100167077 | 3300005355 | Bacteria | 1860 |
| 29 | Ga0070671_100440162 | 3300005355 | Bacteria | 1117 |
| 30 | Ga0070674_100027862 | 3300005356 | Bacteria | 3705 |
| 31 | Ga0070673_100032982 | 3300005364 | Bacteria | 3905 |
| 32 | Ga0070673_100184980 | 3300005364 | Bacteria | 1785 |
| 33 | Ga0070673_100917615 | 3300005364 | Bacteria | 813 |
| 34 | Ga0070688_100406136 | 3300005365 | Bacteria | 1009 |
| 35 | Ga0070659_100269334 | 3300005366 | Bacteria | 1415 |
| 36 | Ga0070709_10042427 | 3300005434 | Bacteria | 2809 |
| 37 | Ga0070714_100039267 | 3300005435 | Bacteria | 3984 |
| 38 | Ga0070714_100063619 | 3300005435 | Bacteria | 3173 |
| 39 | Ga0070714_101436720 | 3300005435 | Bacteria | 674 |
| 40 | Ga0070713_100056744 | 3300005436 | Bacteria | 3258 |
| 41 | Ga0070713_100153409 | 3300005436 | Bacteria | 2051 |
| 42 | Ga0070710_10009817 | 3300005437 | Bacteria | 4690 |
| 43 | Ga0070710_10547484 | 3300005437 | Bacteria | 799 |
| 44 | Ga0070701_10031548 | 3300005438 | Bacteria | 2630 |
| 45 | Ga0070705_100285209 | 3300005440 | Bacteria | 1176 |
| 46 | Ga0070705_100420745 | 3300005440 | Bacteria | 994 |
| 47 | Ga0070705_100550972 | 3300005440 | Unclassified | 884 |
| 48 | Ga0070700_100034234 | 3300005441 | Bacteria | 3066 |
| 49 | Ga0070694_100214358 | 3300005444 | Bacteria | 1441 |
| 50 | Ga0070708_100058064 | 3300005445 | Bacteria | 3447 |
| 51 | Ga0070663_100036411 | 3300005455 | Bacteria | 3419 |
| 52 | Ga0070678_100015402 | 3300005456 | Bacteria | 4860 |
| 53 | Ga0070678_100231851 | 3300005456 | Bacteria | 1540 |
| 54 | Ga0070678_100544970 | 3300005456 | Bacteria | 1029 |
| 55 | Ga0070662_100137253 | 3300005457 | Bacteria | 1892 |
| 56 | Ga0070662_100286800 | 3300005457 | Bacteria | 1334 |
| 57 | Ga0070681_10045952 | 3300005458 | Bacteria | 4367 |
| 58 | Ga0070681_10058852 | 3300005458 | Bacteria | 3822 |
| 59 | Ga0070681_10078347 | 3300005458 | Bacteria | 3261 |
| 60 | Ga0070681_10137226 | 3300005458 | Bacteria | 2376 |
| 61 | Ga0070681_10186674 | 3300005458 | Bacteria | 1993 |
| 62 | Ga0068867_100077554 | 3300005459 | Bacteria | 2497 |
| 63 | Ga0070706_100009785 | 3300005467 | Bacteria | 8910 |
| 64 | Ga0070707_100005169 | 3300005468 | Bacteria | 12229 |
| 65 | Ga0070698_100447382 | 3300005471 | Bacteria | 1227 |
| 66 | Ga0070699_100014180 | 3300005518 | Bacteria | 6858 |
| 67 | Ga0070699_100026603 | 3300005518 | Bacteria | 4988 |
| 68 | Ga0070699_100041248 | 3300005518 | Bacteria | 3996 |
| 69 | Ga0070679_100002705 | 3300005530 | Bacteria | 16140 |
| 70 | Ga0070679_100021643 | 3300005530 | Bacteria | 6278 |
| 71 | Ga0070679_100054903 | 3300005530 | Bacteria | 3967 |
| 72 | Ga0070679_100125949 | 3300005530 | Bacteria | 2544 |
| 73 | Ga0070679_100294779 | 3300005530 | Bacteria | 1573 |
| 74 | Ga0070679_100795398 | 3300005530 | Bacteria | 889 |
| 75 | Ga0070679_101139264 | 3300005530 | Unclassified | 725 |
| 76 | Ga0070684_100002119 | 3300005535 | Bacteria | 14629 |
| 77 | Ga0070684_100216044 | 3300005535 | Unclassified | 1748 |
| 78 | Ga0070684_100496266 | 3300005535 | Bacteria | 1130 |
| 79 | Ga0070697_100090377 | 3300005536 | Bacteria | 2530 |
| 80 | Ga0068853_100338326 | 3300005539 | Bacteria | 1398 |
| 81 | Ga0068853_100390264 | 3300005539 | Bacteria | 1301 |
| 82 | Ga0068853_100616433 | 3300005539 | Bacteria | 1031 |
| 83 | Ga0070672_100155796 | 3300005543 | Unclassified | 1892 |
| 84 | Ga0070686_100065670 | 3300005544 | Bacteria | 2358 |
| 85 | Ga0070686_100491057 | 3300005544 | Bacteria | 951 |
| 86 | Ga0070686_100564851 | 3300005544 | Bacteria | 892 |
| 87 | Ga0070695_100291237 | 3300005545 | Bacteria | 1203 |
| 88 | Ga0070695_100311010 | 3300005545 | Bacteria | 1168 |
| 89 | Ga0070696_100250219 | 3300005546 | Bacteria | 1340 |
| 90 | Ga0070696_100531487 | 3300005546 | Bacteria | 940 |
| 91 | Ga0070696_100579213 | 3300005546 | Bacteria | 902 |
| 92 | Ga0070693_100004865 | 3300005547 | Bacteria | 6410 |
| 93 | Ga0070693_100085983 | 3300005547 | Bacteria | 1886 |
| 94 | Ga0070693_100613029 | 3300005547 | Bacteria | 787 |
| 95 | Ga0068855_100023892 | 3300005563 | Bacteria | 7320 |
| 96 | Ga0068855_100112283 | 3300005563 | Bacteria | 3127 |
| 97 | Ga0068855_100547653 | 3300005563 | Bacteria | 1253 |
| 98 | Ga0070664_100575210 | 3300005564 | Bacteria | 1043 |
| 99 | Ga0070664_100581060 | 3300005564 | Bacteria | 1038 |
| 100 | Ga0068857_100613880 | 3300005577 | Bacteria | 1029 |
| 101 | Ga0068854_100028313 | 3300005578 | Bacteria | 3870 |
| 102 | Ga0068856_100020613 | 3300005614 | Bacteria | 6405 |
| 103 | Ga0068856_100089066 | 3300005614 | Bacteria | 3069 |
| 104 | Ga0070702_100082577 | 3300005615 | Bacteria | 1928 |
| 105 | Ga0070702_100087311 | 3300005615 | Bacteria | 1883 |
| 106 | Ga0068852_100022416 | 3300005616 | Bacteria | 5065 |
| 107 | Ga0068852_100049174 | 3300005616 | Bacteria | 3606 |
| 108 | Ga0068852_100697629 | 3300005616 | Unclassified | 1025 |
| 109 | Ga0068852_100766007 | 3300005616 | Bacteria | 978 |
| 110 | Ga0068859_100468278 | 3300005617 | Unclassified | 1356 |
| 111 | Ga0068864_100290358 | 3300005618 | Bacteria | 1529 |
| 112 | Ga0068866_10154946 | 3300005718 | Bacteria | 1331 |
| 113 | Ga0068861_100018180 | 3300005719 | Bacteria | 5002 |
| 114 | Ga0068860_100549176 | 3300005843 | Bacteria | 1157 |
| 115 | Ga0068862_100355280 | 3300005844 | Bacteria | 1360 |
| 116 | Ga0081455_10006302 | 3300005937 | Bacteria | 12750 |
| 117 | Ga0081455_10042893 | 3300005937 | Bacteria | 3963 |
| 118 | Ga0081540_1004699 | 3300005983 | Bacteria | 10333 |
| 119 | Ga0081540_1127358 | 3300005983 | Bacteria | 1046 |
| 120 | Ga0070717_10050252 | 3300006028 | Bacteria | 3426 |
| 121 | Ga0075432_10024425 | 3300006058 | Bacteria | 2071 |
| 122 | Ga0070715_10000654 | 3300006163 | Bacteria | 9243 |
| 123 | Ga0070716_100323424 | 3300006173 | Bacteria | 1081 |
| 124 | Ga0070712_100024130 | 3300006175 | Bacteria | 4026 |
| 125 | Ga0070712_100041410 | 3300006175 | Bacteria | 3163 |
| 126 | Ga0070712_100220949 | 3300006175 | Unclassified | 1500 |
| 127 | Ga0097621_100059539 | 3300006237 | Bacteria | 3127 |
| 128 | Ga0068871_100040460 | 3300006358 | Bacteria | 3733 |
| 129 | Ga0075431_100132704 | 3300006847 | Bacteria | 2568 |
| 130 | Ga0075434_100005449 | 3300006871 | Bacteria | 11591 |
| 131 | Ga0075434_100158526 | 3300006871 | Bacteria | 2283 |
| 132 | Ga0075434_100347216 | 3300006871 | Bacteria | 1505 |
| 133 | Ga0075429_100157336 | 3300006880 | Bacteria | 1990 |
| 134 | Ga0075436_100009431 | 3300006914 | Bacteria | 6672 |
| 135 | Ga0075436_100134418 | 3300006914 | Bacteria | 1736 |
| 136 | Ga0097620_100468302 | 3300006931 | Unclassified | 1356 |
| 137 | Ga0075435_100048479 | 3300007076 | Bacteria | 3413 |
| 138 | Ga0075435_100253739 | 3300007076 | Bacteria | 1497 |
| 139 | Ga0075435_100374301 | 3300007076 | Bacteria | 1223 |
| 140 | Ga0105250_10074374 | 3300009092 | Bacteria | 1374 |
| 141 | Ga0105240_10102672 | 3300009093 | Bacteria | 3474 |
| 142 | Ga0105240_10178584 | 3300009093 | Bacteria | 2507 |
| 143 | Ga0105240_10407390 | 3300009093 | Bacteria | 1530 |
| 144 | Ga0105240_10908980 | 3300009093 | Bacteria | 946 |
| 145 | Ga0105245_10041452 | 3300009098 | Bacteria | 4104 |
| 146 | Ga0105245_10151137 | 3300009098 | Bacteria | 2196 |
| 147 | Ga0105245_10286766 | 3300009098 | Bacteria | 1611 |
| 148 | Ga0105245_11932870 | 3300009098 | Unclassified | 643 |
| 149 | Ga0114129_10069365 | 3300009147 | Bacteria | 4913 |
| 150 | Ga0105243_10058320 | 3300009148 | Bacteria | 3077 |
| 151 | Ga0105243_10278002 | 3300009148 | Bacteria | 1507 |
| 152 | Ga0105241_10444981 | 3300009174 | Bacteria | 1145 |
| 153 | Ga0105242_10025311 | 3300009176 | Bacteria | 4696 |
| 154 | Ga0105242_10042260 | 3300009176 | Bacteria | 3680 |
| 155 | Ga0105248_10069119 | 3300009177 | Bacteria | 3965 |
| 156 | Ga0105248_10497426 | 3300009177 | Bacteria | 1374 |
| 157 | Ga0105237_10285356 | 3300009545 | Bacteria | 1653 |
| 158 | Ga0105249_10026375 | 3300009553 | Bacteria | 5235 |
| 159 | Ga0105249_10078383 | 3300009553 | Bacteria | 3066 |
| 160 | Ga0105249_10478008 | 3300009553 | Bacteria | 1288 |
| 161 | Ga0105249_10907855 | 3300009553 | Bacteria | 948 |
| 162 | Ga0105239_10093744 | 3300010375 | Bacteria | 3316 |
| 163 | Ga0105239_10154711 | 3300010375 | Bacteria | 2560 |
| 164 | Ga0105246_10473270 | 3300011119 | Bacteria | 1058 |
| 165 | Ga0157320_1000895 | 3300012481 | Bacteria | 1361 |
| 166 | Ga0157319_1005770 | 3300012497 | Unclassified | 864 |
| 167 | Ga0157313_1002734 | 3300012503 | Unclassified | 1083 |
| 168 | Ga0157373_10107747 | 3300013100 | Bacteria | 1959 |
| 169 | Ga0157373_10329802 | 3300013100 | Bacteria | 1086 |
| 170 | Ga0157371_10028105 | 3300013102 | Bacteria | 4074 |
| 171 | Ga0157370_10002516 | 3300013104 | Bacteria | 22041 |
| 172 | Ga0157370_10091664 | 3300013104 | Bacteria | 2853 |
| 173 | Ga0157370_10227802 | 3300013104 | Bacteria | 1725 |
| 174 | Ga0157374_10180541 | 3300013296 | Bacteria | 2061 |
| 175 | Ga0157378_10163855 | 3300013297 | Bacteria | 2081 |
| 176 | Ga0157378_10185453 | 3300013297 | Bacteria | 1959 |
| 177 | Ga0157378_10521890 | 3300013297 | Bacteria | 1189 |
| 178 | Ga0163162_10060678 | 3300013306 | Bacteria | 3818 |
| 179 | Ga0157372_10194191 | 3300013307 | Bacteria | 2351 |
| 180 | Ga0157372_10334821 | 3300013307 | Bacteria | 1763 |
| 181 | Ga0157372_10383170 | 3300013307 | Bacteria | 1638 |
| 182 | Ga0157372_10584061 | 3300013307 | Bacteria | 1302 |
| 183 | Ga0157372_11085571 | 3300013307 | Bacteria | 926 |
| 184 | Ga0157372_11203384 | 3300013307 | Bacteria | 875 |
| 185 | Ga0157375_10019167 | 3300013308 | Bacteria | 6215 |
| 186 | Ga0157375_10020987 | 3300013308 | Bacteria | 5979 |
| 187 | Ga0163163_10835227 | 3300014325 | Bacteria | 985 |
| 188 | Ga0157380_10015939 | 3300014326 | Bacteria | 5532 |
| 189 | Ga0157376_10070667 | 3300014969 | Bacteria | 2964 |
| 190 | Ga0157376_10617688 | 3300014969 | Bacteria | 1081 |
| 191 | Ga0182006_1179944 | 3300015261 | Bacteria | 705 |
| 192 | Ga0163161_10031916 | 3300017792 | Bacteria | 3757 |
| 193 | Ga0197907_11086716 | 3300020069 | Bacteria | 3553 |
| 194 | Ga0206356_11697997 | 3300020070 | Bacteria | 1167 |
| 195 | Ga0206354_11233273 | 3300020081 | Bacteria | 1155 |
| 196 | Ga0206354_11310183 | 3300020081 | Bacteria | 1073 |
| 197 | Ga0206353_10811714 | 3300020082 | Bacteria | 1020 |
| 198 | Ga0206353_10911104 | 3300020082 | Bacteria | 1885 |
| 199 | Ga0206353_10982834 | 3300020082 | Bacteria | 1218 |
| 200 | Ga0213876_10070533 | 3300021384 | Bacteria | 1846 |
| 201 | Ga0207692_10015566 | 3300025898 | Bacteria | 3349 |
| 202 | Ga0207692_10285335 | 3300025898 | Bacteria | 1000 |
| 203 | Ga0207642_10096720 | 3300025899 | Bacteria | 1472 |
| 204 | Ga0207642_10256181 | 3300025899 | Bacteria | 995 |
| 205 | Ga0207685_10106386 | 3300025905 | Bacteria | 1209 |
| 206 | Ga0207645_10054317 | 3300025907 | Bacteria | 2558 |
| 207 | Ga0207645_10300121 | 3300025907 | Unclassified | 1069 |
| 208 | Ga0207705_10114239 | 3300025909 | Bacteria | 1997 |
| 209 | Ga0207684_10103980 | 3300025910 | Bacteria | 2428 |
| 210 | Ga0207654_10047591 | 3300025911 | Bacteria | 2451 |
| 211 | Ga0207707_10024618 | 3300025912 | Bacteria | 5269 |
| 212 | Ga0207707_10039759 | 3300025912 | Bacteria | 4111 |
| 213 | Ga0207707_10057124 | 3300025912 | Bacteria | 3397 |
| 214 | Ga0207695_10283121 | 3300025913 | Bacteria | 1551 |
| 215 | Ga0207671_10162484 | 3300025914 | Bacteria | 1730 |
| 216 | Ga0207671_10321125 | 3300025914 | Bacteria | 1225 |
| 217 | Ga0207693_10015144 | 3300025915 | Bacteria | 6190 |
| 218 | Ga0207693_10020189 | 3300025915 | Bacteria | 5300 |
| 219 | Ga0207693_10048916 | 3300025915 | Bacteria | 3320 |
| 220 | Ga0207693_10061804 | 3300025915 | Bacteria | 2934 |
| 221 | Ga0207663_10047610 | 3300025916 | Bacteria | 2648 |
| 222 | Ga0207663_10358158 | 3300025916 | Bacteria | 1106 |
| 223 | Ga0207663_10504598 | 3300025916 | Unclassified | 940 |
| 224 | Ga0207663_10603310 | 3300025916 | Unclassified | 863 |
| 225 | Ga0207660_10021857 | 3300025917 | Bacteria | 4305 |
| 226 | Ga0207660_10043606 | 3300025917 | Bacteria | 3152 |
| 227 | Ga0207660_10194054 | 3300025917 | Bacteria | 1583 |
| 228 | Ga0207660_10297483 | 3300025917 | Bacteria | 1284 |
| 229 | Ga0207660_10385880 | 3300025917 | Bacteria | 1126 |
| 230 | Ga0207662_10029471 | 3300025918 | Bacteria | 3180 |
| 231 | Ga0207657_10001654 | 3300025919 | Bacteria | 24052 |
| 232 | Ga0207657_10011840 | 3300025919 | Bacteria | 8635 |
| 233 | Ga0207657_10088477 | 3300025919 | Bacteria | 2588 |
| 234 | Ga0207657_10295785 | 3300025919 | Bacteria | 1283 |
| 235 | Ga0207649_10022809 | 3300025920 | Bacteria | 3617 |
| 236 | Ga0207649_10488575 | 3300025920 | Bacteria | 935 |
| 237 | Ga0207652_10199998 | 3300025921 | Bacteria | 1798 |
| 238 | Ga0207652_10204831 | 3300025921 | Unclassified | 1775 |
| 239 | Ga0207652_10251952 | 3300025921 | Bacteria | 1592 |
| 240 | Ga0207652_10408552 | 3300025921 | Bacteria | 1225 |
| 241 | Ga0207652_10457273 | 3300025921 | Unclassified | 1151 |
| 242 | Ga0207646_10012659 | 3300025922 | Bacteria | 8097 |
| 243 | Ga0207694_11223807 | 3300025924 | Bacteria | 635 |
| 244 | Ga0207687_10054987 | 3300025927 | Bacteria | 2787 |
| 245 | Ga0207687_10068145 | 3300025927 | Bacteria | 2534 |
| 246 | Ga0207687_10117288 | 3300025927 | Bacteria | 1985 |
| 247 | Ga0207700_10082707 | 3300025928 | Bacteria | 2511 |
| 248 | Ga0207700_10835038 | 3300025928 | Bacteria | 824 |
| 249 | Ga0207664_10030555 | 3300025929 | Bacteria | 4115 |
| 250 | Ga0207664_10285601 | 3300025929 | Bacteria | 1449 |
| 251 | Ga0207664_10328858 | 3300025929 | Bacteria | 1350 |
| 252 | Ga0207664_10397419 | 3300025929 | Bacteria | 1225 |
| 253 | Ga0207664_10540347 | 3300025929 | Bacteria | 1045 |
| 254 | Ga0207644_10258428 | 3300025931 | Bacteria | 1392 |
| 255 | Ga0207690_10268125 | 3300025932 | Bacteria | 1325 |
| 256 | Ga0207706_10010417 | 3300025933 | Bacteria | 8493 |
| 257 | Ga0207706_10018314 | 3300025933 | Bacteria | 6302 |
| 258 | Ga0207686_10297157 | 3300025934 | Bacteria | 1198 |
| 259 | Ga0207686_10391558 | 3300025934 | Unclassified | 1056 |
| 260 | Ga0207709_10558095 | 3300025935 | Unclassified | 902 |
| 261 | Ga0207670_10877269 | 3300025936 | Unclassified | 750 |
| 262 | Ga0207704_10553467 | 3300025938 | Unclassified | 935 |
| 263 | Ga0207665_10009442 | 3300025939 | Bacteria | 6402 |
| 264 | Ga0207665_10180960 | 3300025939 | Bacteria | 1527 |
| 265 | Ga0207691_10540370 | 3300025940 | Bacteria | 988 |
| 266 | Ga0207711_10205634 | 3300025941 | Bacteria | 1798 |
| 267 | Ga0207711_10376897 | 3300025941 | Bacteria | 1316 |
| 268 | Ga0207689_10633434 | 3300025942 | Bacteria | 900 |
| 269 | Ga0207661_10220513 | 3300025944 | Bacteria | 1676 |
| 270 | Ga0207679_10460926 | 3300025945 | Unclassified | 1129 |
| 271 | Ga0207679_10501653 | 3300025945 | Bacteria | 1083 |
| 272 | Ga0207679_10534569 | 3300025945 | Bacteria | 1050 |
| 273 | Ga0207667_10433592 | 3300025949 | Bacteria | 1337 |
| 274 | Ga0207667_10546700 | 3300025949 | Unclassified | 1172 |
| 275 | Ga0207667_10651785 | 3300025949 | Unclassified | 1058 |
| 276 | Ga0207651_10122907 | 3300025960 | Bacteria | 1972 |
| 277 | Ga0207651_10531756 | 3300025960 | Bacteria | 1020 |
| 278 | Ga0207712_10188107 | 3300025961 | Bacteria | 1628 |
| 279 | Ga0207712_10258512 | 3300025961 | Bacteria | 1411 |
| 280 | Ga0207712_10454711 | 3300025961 | Bacteria | 1086 |
| 281 | Ga0207668_10045440 | 3300025972 | Bacteria | 2995 |
| 282 | Ga0207640_10099870 | 3300025981 | Bacteria | 2032 |
| 283 | Ga0207640_10139815 | 3300025981 | Bacteria | 1763 |
| 284 | Ga0207677_10142366 | 3300026023 | Bacteria | 1838 |
| 285 | Ga0207677_10290017 | 3300026023 | Bacteria | 1347 |
| 286 | Ga0207703_10368809 | 3300026035 | Bacteria | 1326 |
| 287 | Ga0207639_10245967 | 3300026041 | Bacteria | 1558 |
| 288 | Ga0207678_10021000 | 3300026067 | Bacteria | 5723 |
| 289 | Ga0207678_11022182 | 3300026067 | Bacteria | 732 |
| 290 | Ga0207708_10011806 | 3300026075 | Bacteria | 6505 |
| 291 | Ga0207702_10091714 | 3300026078 | Bacteria | 2661 |
| 292 | Ga0207702_10388214 | 3300026078 | Bacteria | 1344 |
| 293 | Ga0207702_10498718 | 3300026078 | Bacteria | 1187 |
| 294 | Ga0207648_10020652 | 3300026089 | Bacteria | 5929 |
| 295 | Ga0207676_10433586 | 3300026095 | Bacteria | 1235 |
| 296 | Ga0207674_10029332 | 3300026116 | Bacteria | 5792 |
| 297 | Ga0207675_100008428 | 3300026118 | Bacteria | 9717 |
| 298 | Ga0207675_100356731 | 3300026118 | Bacteria | 1434 |
| 299 | Ga0207683_10031994 | 3300026121 | Bacteria | 4568 |
| 300 | Ga0207683_10077408 | 3300026121 | Bacteria | 2946 |
| 301 | Ga0207683_10611532 | 3300026121 | Bacteria | 1009 |
| 302 | Ga0207698_10120346 | 3300026142 | Bacteria | 2220 |
| 303 | Ga0268264_10968010 | 3300028381 | Bacteria | 857 |
| 304 | Ga0265326_10047912 | 3300028558 | Bacteria | 1212 |
| 305 | Ga0265319_1072983 | 3300028563 | Bacteria | 1098 |
| 306 | Ga0265318_10045496 | 3300028577 | Bacteria | 1659 |
| 307 | Ga0265322_10010830 | 3300028654 | Bacteria | 2648 |
| 308 | Ga0265338_10022159 | 3300028800 | Bacteria | 6591 |
| 309 | Ga0265328_10137782 | 3300031239 | Bacteria | 915 |
| 310 | Ga0265325_10063380 | 3300031241 | Bacteria | 1870 |
| 311 | Ga0265340_10036305 | 3300031247 | Bacteria | 2443 |
| 312 | Ga0265339_10040690 | 3300031249 | Bacteria | 2583 |
| 313 | Ga0265316_10017339 | 3300031344 | Bacteria | 6230 |
| 314 | Ga0265313_10017169 | 3300031595 | Bacteria | 4125 |
| 315 | Ga0265314_10003467 | 3300031711 | Bacteria | 15234 |
| 316 | Ga0265342_10041734 | 3300031712 | Bacteria | 2775 |
| 317 | Ga0307405_10194749 | 3300031731 | Bacteria | 1467 |
| 318 | Ga0307409_100068664 | 3300031995 | Bacteria | 2804 |
| 319 | Ga0307416_100919909 | 3300032002 | Bacteria | 975 |
| 320 | Ga0373959_0004948 | 3300034820 | Bacteria | 2172 |
| 321 | Ga0373928_0031219 | 3300035084 | Bacteria | 1182 |
| 322 | Ga0373944_0010639 | 3300035089 | Bacteria | 2510 |
| 323 | Ga0373939_0017153 | 3300035114 | Bacteria | 1920 |
| 324 | Ga0373945_0024109 | 3300035116 | Bacteria | 2106 |
| 325 | Ga0373954_0165640 | 3300035118 | Bacteria | 1082 |
| 326 | Ga0373960_0136084 | 3300035121 | Bacteria | 828 |
| 327 | Ga0373943_0072897 | 3300035170 | Bacteria | 1743 |
| 328 | Ga0373955_0024629 | 3300035172 | Bacteria | 3080 |
| 329 | Ga0373962_0020228 | 3300035242 | Bacteria | 1747 |
| 330 | Ga0373962_0057048 | 3300035242 | Bacteria | 1139 |
| 331 | Ga0373931_0435745 | 3300035691 | Bacteria | 836 |
| 332 | Ga0373931_0673050 | 3300035691 | Bacteria | 681 |
| 333 | Ga0373947_0000664 | 3300035725 | Bacteria | 20398 |
| 334 | Ga0373947_0306441 | 3300035725 | Unclassified | 1060 |
| 335 | Ga0373925_0020960 | 3300037068 | Bacteria | 4763 |
| 336 | Ga0373925_0277634 | 3300037068 | Bacteria | 1349 |
| 337 | Ga0373925_0866123 | 3300037068 | Bacteria | 745 |
| 338 | Ga0395899_0008449 | 3300037312 | Bacteria | 7931 |
| 339 | Ga0395899_0009866 | 3300037312 | Bacteria | 7323 |
| 340 | Ga0395899_0021787 | 3300037312 | Bacteria | 4860 |
| 341 | Ga0395899_0035920 | 3300037312 | Bacteria | 3719 |
| 342 | Ga0395899_0057931 | 3300037312 | Bacteria | 2858 |
| 343 | Ga0395899_0211076 | 3300037312 | Bacteria | 1349 |
| 344 | Ga0395900_0001009 | 3300037418 | Bacteria | 36426 |
| 345 | Ga0395900_0003572 | 3300037418 | Bacteria | 16711 |
| 346 | Ga0395900_0008866 | 3300037418 | Bacteria | 10326 |
| 347 | Ga0395900_0010139 | 3300037418 | Bacteria | 9635 |
| 348 | Ga0395900_0034348 | 3300037418 | Bacteria | 5221 |
| 349 | Ga0395900_0099566 | 3300037418 | Bacteria | 2986 |
| 350 | Ga0395900_0646074 | 3300037418 | Bacteria | 995 |
| 351 | Ga0395900_0861180 | 3300037418 | Bacteria | 831 |
| 352 | Ga0395898_0001088 | 3300037466 | Bacteria | 41937 |
| 353 | Ga0395898_0005269 | 3300037466 | Bacteria | 13980 |
| 354 | Ga0395898_0009019 | 3300037466 | Bacteria | 10499 |
| 355 | Ga0395898_0020640 | 3300037466 | Bacteria | 6691 |
| 356 | Ga0395898_0066891 | 3300037466 | Bacteria | 3480 |
| 357 | Ga0395898_0081040 | 3300037466 | Bacteria | 3130 |
| 358 | Ga0395898_0193798 | 3300037466 | Bacteria | 1941 |
| 359 | Ga0395898_0313393 | 3300037466 | Bacteria | 1497 |
| 360 | Ga0395898_0480294 | 3300037466 | Bacteria | 1182 |
| 361 | Ga0395905_0001033 | 3300037471 | Bacteria | 35408 |
| 362 | Ga0395905_0001800 | 3300037471 | Bacteria | 24833 |
| 363 | Ga0395905_0011027 | 3300037471 | Bacteria | 8745 |
| 364 | Ga0395905_0016912 | 3300037471 | Bacteria | 6928 |
| 365 | Ga0395905_0080585 | 3300037471 | Bacteria | 3051 |
| 366 | Ga0395905_0210352 | 3300037471 | Bacteria | 1822 |
| 367 | Ga0395905_0260395 | 3300037471 | Unclassified | 1619 |
| 368 | Ga0395905_0493651 | 3300037471 | Bacteria | 1124 |
| 369 | Ga0436364_0069329 | 3300037853 | Bacteria | 1072 |
| 370 | Ga0395901_0002285 | 3300038443 | Bacteria | 19538 |
| 371 | Ga0395901_0006248 | 3300038443 | Bacteria | 12075 |
| 372 | Ga0395901_0012090 | 3300038443 | Bacteria | 8757 |
| 373 | Ga0395901_0012202 | 3300038443 | Bacteria | 8720 |
| 374 | Ga0395901_0012213 | 3300038443 | Bacteria | 8716 |
| 375 | Ga0395901_0014628 | 3300038443 | Bacteria | 7973 |
| 376 | Ga0395901_0147824 | 3300038443 | Bacteria | 2469 |
| 377 | Ga0395901_0225294 | 3300038443 | Bacteria | 1959 |
| 378 | Ga0395901_0237416 | 3300038443 | Bacteria | 1902 |
| 379 | Ga0395901_0348433 | 3300038443 | Bacteria | 1529 |
| 380 | Ga0395901_1267495 | 3300038443 | Unclassified | 700 |
| 381 | Ga0395901_1352235 | 3300038443 | Bacteria | 672 |
| 382 | Ga0436365_0415531 | 3300039437 | Bacteria | 4308 |
| 383 | Ga0436365_1056826 | 3300039437 | Unclassified | 2022 |
| 384 | Ga0436363_1254646 | 3300039450 | Bacteria | 1218 |
| 385 | Ga0436363_1633358 | 3300039450 | Bacteria | 2287 |
| 386 | Ga0439448_0120022 | 3300042005 | Bacteria | 902 |
| 387 | Ga0439460_0053297 | 3300042461 | Bacteria | 1218 |
| 388 | Ga0466972_0161118 | 3300044658 | Bacteria | 1054 |
| 389 | Ga0466966_0192281 | 3300044684 | Bacteria | 1236 |
| 390 | Ga0466963_0007165 | 3300044694 | Bacteria | 6647 |
| 391 | Ga0466963_0043897 | 3300044694 | Bacteria | 2941 |
| 392 | Ga0466963_0148678 | 3300044694 | Bacteria | 1626 |
| 393 | Ga0466963_0711046 | 3300044694 | Bacteria | 709 |
| 394 | Ga0466964_0000345 | 3300044706 | Bacteria | 13898 |
| 395 | Ga0466964_0019450 | 3300044706 | Bacteria | 2609 |
| 396 | Ga0466964_0111307 | 3300044706 | Bacteria | 1221 |
| 397 | Ga0466964_0391408 | 3300044706 | Bacteria | 724 |
| 398 | Ga0466964_0415677 | 3300044706 | Unclassified | 706 |
| 399 | Ga0466971_0014266 | 3300044719 | Bacteria | 3494 |
| 400 | Ga0466971_0017308 | 3300044719 | Bacteria | 3187 |
| 401 | Ga0466971_0268785 | 3300044719 | Unclassified | 815 |
| 402 | Ga0466957_0017401 | 3300044842 | Bacteria | 4209 |
| 403 | Ga0466957_0357522 | 3300044842 | Bacteria | 992 |
| 404 | Ga0466957_0523014 | 3300044842 | Unclassified | 824 |
| 405 | Ga0466960_0142140 | 3300044901 | Unclassified | 1276 |
| 406 | Ga0466959_0016325 | 3300045049 | Bacteria | 5424 |
| 407 | Ga0451576_0009107 | 3300045051 | Bacteria | 11549 |
| 408 | Ga0451576_0156682 | 3300045051 | Bacteria | 2376 |
| 409 | Ga0451576_1062406 | 3300045051 | Bacteria | 848 |
| 410 | Ga0466958_0006066 | 3300045836 | Bacteria | 6552 |
| 411 | Ga0466958_0187391 | 3300045836 | Bacteria | 1314 |
| 412 | Ga0466967_0020487 | 3300045976 | Bacteria | 5347 |
| 413 | Ga0466967_0029561 | 3300045976 | Bacteria | 4588 |
| 414 | Ga0466967_0030293 | 3300045976 | Bacteria | 4539 |
| 415 | Ga0466967_0062473 | 3300045976 | Bacteria | 3306 |
| 416 | Ga0466967_0076320 | 3300045976 | Bacteria | 3014 |
| 417 | Ga0466967_0079196 | 3300045976 | Bacteria | 2962 |
| 418 | Ga0466967_0169328 | 3300045976 | Bacteria | 2054 |
| 419 | Ga0466967_0231957 | 3300045976 | Bacteria | 1758 |
| 420 | Ga0466967_0255654 | 3300045976 | Bacteria | 1675 |
| 421 | Ga0495592_0024442 | 3300046454 | Bacteria | 4593 |
| 422 | Ga0495603_0000219 | 3300046455 | Bacteria | 29709 |
| 423 | Ga0495629_0141110 | 3300046459 | Bacteria | 1676 |
| 424 | Ga0495629_0730225 | 3300046459 | Unclassified | 656 |
| 425 | Ga0495641_0000516 | 3300046461 | Bacteria | 32427 |
| 426 | Ga0495651_0015286 | 3300046462 | Bacteria | 5934 |
| 427 | Ga0495651_0048767 | 3300046462 | Bacteria | 3270 |
| 428 | Ga0495651_0167727 | 3300046462 | Bacteria | 1567 |
| 429 | Ga0495653_0205608 | 3300046463 | Bacteria | 1333 |
| 430 | Ga0495580_0105068 | 3300046472 | Bacteria | 1962 |
| 431 | Ga0495582_0027449 | 3300046473 | Bacteria | 3121 |
| 432 | Ga0495582_0130634 | 3300046473 | Bacteria | 1419 |
| 433 | Ga0495662_0322933 | 3300046476 | Bacteria | 759 |
| 434 | Ga0495664_0092676 | 3300046477 | Bacteria | 1817 |
| 435 | Ga0495584_0263386 | 3300046491 | Bacteria | 876 |
| 436 | Ga0495594_0009038 | 3300046499 | Bacteria | 5142 |
| 437 | Ga0495583_0294309 | 3300046506 | Unclassified | 646 |
| 438 | Ga0495608_0016498 | 3300046511 | Bacteria | 5111 |
| 439 | Ga0495608_0119771 | 3300046511 | Bacteria | 1688 |
| 440 | Ga0495608_0332784 | 3300046511 | Bacteria | 936 |
| 441 | Ga0495618_0255354 | 3300046514 | Bacteria | 1099 |
| 442 | Ga0495628_0273353 | 3300046516 | Bacteria | 1256 |
| 443 | Ga0495630_0050663 | 3300046517 | Bacteria | 3107 |
| 444 | Ga0495644_0175579 | 3300046523 | Bacteria | 823 |
| 445 | Ga0495652_0130019 | 3300046529 | Bacteria | 1995 |
| 446 | Ga0495652_0446532 | 3300046529 | Bacteria | 906 |
| 447 | Ga0495640_0058566 | 3300046533 | Bacteria | 2627 |
| 448 | Ga0495640_0079781 | 3300046533 | Bacteria | 2178 |
| 449 | Ga0495586_0114377 | 3300046535 | Bacteria | 1504 |
| 450 | Ga0495586_0126264 | 3300046535 | Bacteria | 1431 |
| 451 | Ga0495587_0093090 | 3300046536 | Bacteria | 1740 |
| 452 | Ga0495587_0181541 | 3300046536 | Unclassified | 1193 |
| 453 | Ga0495645_0322815 | 3300046543 | Bacteria | 1002 |
| 454 | Ga0495622_0020433 | 3300046557 | Bacteria | 3084 |
| 455 | Ga0495667_0001711 | 3300046559 | Bacteria | 14566 |
| 456 | Ga0495667_0064032 | 3300046559 | Bacteria | 2405 |
| 457 | Ga0495656_0033437 | 3300046615 | Bacteria | 2099 |
| 458 | Ga0495634_0014753 | 3300046642 | Bacteria | 5622 |
| 459 | Ga0495634_0042253 | 3300046642 | Bacteria | 3093 |
| 460 | Ga0495635_0092078 | 3300046663 | Bacteria | 2073 |
| 461 | Ga0495635_0143391 | 3300046663 | Bacteria | 1627 |
| 462 | Ga0495588_0000660 | 3300046674 | Bacteria | 15991 |
| 463 | Ga0495657_0222989 | 3300046675 | Bacteria | 1142 |
| 464 | Ga0495657_0289626 | 3300046675 | Bacteria | 978 |
| 465 | Ga0495599_0019441 | 3300046678 | Bacteria | 4234 |
| 466 | Ga0495599_0070717 | 3300046678 | Bacteria | 2178 |
| 467 | Ga0495613_0049721 | 3300046689 | Bacteria | 3093 |
| 468 | Ga0495613_0233188 | 3300046689 | Bacteria | 1289 |
| 469 | Ga0495613_0339148 | 3300046689 | Bacteria | 1034 |
| 470 | Ga0495624_0216125 | 3300046690 | Unclassified | 1163 |
| 471 | Ga0495624_0401169 | 3300046690 | Unclassified | 823 |
| 472 | Ga0495671_0183687 | 3300046692 | Bacteria | 1016 |
| 473 | Ga0495589_0234076 | 3300046794 | Unclassified | 861 |
| 474 | Ga0495600_0019857 | 3300046809 | Bacteria | 4295 |
| 475 | Ga0495600_0218671 | 3300046809 | Bacteria | 1219 |
| 476 | Ga0495581_0068795 | 3300047315 | Bacteria | 2047 |
| 477 | Ga0495581_0136840 | 3300047315 | Bacteria | 1428 |
| 478 | Ga0495604_0028425 | 3300047317 | Bacteria | 4449 |
| 479 | Ga0495604_0066588 | 3300047317 | Bacteria | 2739 |
| 480 | Ga0495604_0124051 | 3300047317 | Bacteria | 1865 |
| 481 | Ga0495604_0178739 | 3300047317 | Bacteria | 1486 |
| 482 | Ga0495674_0002208 | 3300047319 | Bacteria | 19139 |
| 483 | Ga0495674_0018930 | 3300047319 | Bacteria | 6404 |
| 484 | Ga0495676_0000977 | 3300047321 | Bacteria | 23953 |
| 485 | Ga0495680_0004620 | 3300047322 | Bacteria | 13121 |
| 486 | Ga0495680_0030276 | 3300047322 | Bacteria | 4421 |
| 487 | Ga0495675_0049456 | 3300047444 | Bacteria | 2673 |
| 488 | Ga0495684_0013231 | 3300047471 | Bacteria | 6368 |
| 489 | Ga0495684_0092468 | 3300047471 | Bacteria | 2291 |
| 490 | Ga0495684_0203110 | 3300047471 | Bacteria | 1460 |
| 491 | Ga0495602_0116437 | 3300048088 | Bacteria | 2159 |
| 492 | Ga0495602_0278220 | 3300048088 | Bacteria | 1234 |
| 493 | Ga0495602_0742064 | 3300048088 | Bacteria | 663 |
| 494 | Ga0496100_0021461 | 3300048903 | Bacteria | 3889 |
| 495 | Ga0496101_0000424 | 3300048904 | Bacteria | 27117 |
| 496 | Ga0496101_0005214 | 3300048904 | Bacteria | 8267 |
| 497 | Ga0496101_0128510 | 3300048904 | Bacteria | 1922 |
| 498 | Ga0496101_0206284 | 3300048904 | Bacteria | 1521 |
| 499 | Ga0496101_0321385 | 3300048904 | Bacteria | 1214 |
| 500 | Ga0496102_0003088 | 3300048905 | Bacteria | 14109 |
| 501 | Ga0496102_0009838 | 3300048905 | Bacteria | 8222 |
| 502 | Ga0496102_0037456 | 3300048905 | Bacteria | 4375 |
| 503 | Ga0496102_0059615 | 3300048905 | Bacteria | 3490 |
| 504 | Ga0496102_0269614 | 3300048905 | Bacteria | 1605 |
| 505 | Ga0496102_0276539 | 3300048905 | Bacteria | 1583 |
| 506 | Ga0496102_0365850 | 3300048905 | Bacteria | 1357 |
| 507 | Ga0496102_0433250 | 3300048905 | Bacteria | 1234 |
| 508 | Ga0496103_0022233 | 3300048906 | Bacteria | 3817 |
| 509 | Ga0496103_0164634 | 3300048906 | Bacteria | 1423 |
| 510 | Ga0496104_0002376 | 3300048907 | Bacteria | 16220 |
| 511 | Ga0496104_0006585 | 3300048907 | Bacteria | 10215 |
| 512 | Ga0496104_0007994 | 3300048907 | Bacteria | 9378 |
| 513 | Ga0496104_0019246 | 3300048907 | Bacteria | 6243 |
| 514 | Ga0496104_0080285 | 3300048907 | Bacteria | 3110 |
| 515 | Ga0496104_0481301 | 3300048907 | Bacteria | 1152 |
| 516 | Ga0496104_0555635 | 3300048907 | Bacteria | 1059 |
| 517 | Ga0496105_0000597 | 3300048908 | Bacteria | 24061 |
| 518 | Ga0496105_0048656 | 3300048908 | Bacteria | 3499 |
| 519 | Ga0496105_0082467 | 3300048908 | Bacteria | 2656 |
| 520 | Ga0496106_0007641 | 3300048909 | Bacteria | 7996 |
| 521 | Ga0496106_0014004 | 3300048909 | Bacteria | 5929 |
| 522 | Ga0496106_0088709 | 3300048909 | Bacteria | 2384 |
| 523 | Ga0496106_0142310 | 3300048909 | Bacteria | 1887 |
| 524 | Ga0496106_0521087 | 3300048909 | Bacteria | 954 |
| 525 | Ga0496107_0020310 | 3300048910 | Bacteria | 4690 |
| 526 | Ga0496107_0023106 | 3300048910 | Bacteria | 4395 |
| 527 | Ga0496107_0041489 | 3300048910 | Bacteria | 3304 |
| 528 | Ga0496107_0117226 | 3300048910 | Bacteria | 1960 |
| 529 | Ga0496107_0308008 | 3300048910 | Bacteria | 1179 |
| 530 | Ga0496108_0001639 | 3300048911 | Bacteria | 17745 |
| 531 | Ga0496108_0002438 | 3300048911 | Bacteria | 14862 |
| 532 | Ga0496108_0010971 | 3300048911 | Bacteria | 7358 |
| 533 | Ga0496108_0012650 | 3300048911 | Bacteria | 6876 |
| 534 | Ga0496109_0035209 | 3300048912 | Bacteria | 4514 |
| 535 | Ga0496109_0050646 | 3300048912 | Bacteria | 3781 |
| 536 | Ga0496109_0051487 | 3300048912 | Bacteria | 3750 |
| 537 | Ga0496109_0118069 | 3300048912 | Bacteria | 2469 |
| 538 | Ga0496110_0002351 | 3300048913 | Bacteria | 14159 |
| 539 | Ga0496110_0004851 | 3300048913 | Bacteria | 10487 |
| 540 | Ga0496110_0006795 | 3300048913 | Bacteria | 9099 |
| 541 | Ga0496110_0140385 | 3300048913 | Bacteria | 2184 |
| 542 | Ga0496110_0524644 | 3300048913 | Bacteria | 1077 |
| 543 | Ga0496111_0003363 | 3300048914 | Bacteria | 9885 |
| 544 | Ga0496111_0005204 | 3300048914 | Bacteria | 8296 |
| 545 | Ga0496111_0068769 | 3300048914 | Bacteria | 2574 |
| 546 | Ga0496112_0024000 | 3300048915 | Bacteria | 5834 |
| 547 | Ga0496112_0080709 | 3300048915 | Bacteria | 3216 |
| 548 | Ga0496112_0244298 | 3300048915 | Bacteria | 1747 |
| 549 | Ga0496112_1296133 | 3300048915 | Bacteria | 644 |
| 550 | Ga0496113_0000612 | 3300048916 | Bacteria | 17857 |
| 551 | Ga0496113_0004409 | 3300048916 | Bacteria | 8642 |
| 552 | Ga0496113_0022210 | 3300048916 | Bacteria | 4484 |
| 553 | Ga0496113_0338321 | 3300048916 | Bacteria | 1207 |
| 554 | Ga0496113_0499214 | 3300048916 | Bacteria | 977 |
| 555 | Ga0496114_0000392 | 3300048917 | Bacteria | 32304 |
| 556 | Ga0496114_0002716 | 3300048917 | Bacteria | 13516 |
| 557 | Ga0496114_0029440 | 3300048917 | Bacteria | 4514 |
| 558 | Ga0496114_0159050 | 3300048917 | Bacteria | 1963 |
| 559 | Ga0496114_0167288 | 3300048917 | Bacteria | 1915 |
| 560 | Ga0496114_0361573 | 3300048917 | Bacteria | 1284 |
| 561 | Ga0496115_0001999 | 3300048918 | Bacteria | 14573 |
| 562 | Ga0496115_0003805 | 3300048918 | Bacteria | 10865 |
| 563 | Ga0496115_0017651 | 3300048918 | Bacteria | 5463 |
| 564 | Ga0496115_0020748 | 3300048918 | Bacteria | 5069 |
| 565 | Ga0496115_0191751 | 3300048918 | Bacteria | 1688 |
| 566 | Ga0496115_0222990 | 3300048918 | Bacteria | 1556 |
| 567 | Ga0501036_0027279 | 3300049572 | Bacteria | 4825 |
| 568 | Ga0501037_0030682 | 3300049573 | Bacteria | 3972 |
| 569 | Ga0501038_0058938 | 3300049574 | Bacteria | 3290 |
| 570 | Ga0501041_0024997 | 3300049577 | Bacteria | 3588 |
| 571 | Ga0501042_0033857 | 3300049578 | Bacteria | 3622 |
| 572 | Ga0501043_0288724 | 3300049579 | Bacteria | 1256 |
| 573 | Ga0501046_0084140 | 3300049580 | Bacteria | 2454 |
| 574 | Ga0501047_0020349 | 3300049581 | Bacteria | 6373 |
| 575 | Ga0501067_0001274 | 3300049583 | Bacteria | 13704 |
| 576 | Ga0501069_0005847 | 3300049585 | Bacteria | 6406 |
| 577 | Ga0501070_0099001 | 3300049586 | Bacteria | 2412 |
| 578 | Ga0501070_0212554 | 3300049586 | Bacteria | 1587 |
| 579 | Ga0501071_0114923 | 3300049587 | Unclassified | 1991 |
| 580 | Ga0501072_0022091 | 3300049588 | Bacteria | 4935 |
| 581 | Ga0501074_0147796 | 3300049590 | Bacteria | 1681 |
| 582 | Ga0501076_0019639 | 3300049592 | Bacteria | 5166 |
| 583 | Ga0501079_0723274 | 3300049741 | Bacteria | 783 |
| 584 | Ga0501080_0575119 | 3300049742 | Bacteria | 1002 |
| 585 | Ga0501081_0005825 | 3300049743 | Bacteria | 7977 |
| 586 | Ga0501081_0130715 | 3300049743 | Bacteria | 1794 |
| 587 | Ga0501083_0431536 | 3300049744 | Unclassified | 857 |
| 588 | Ga0501045_0029191 | 3300049824 | Bacteria | 3984 |
| 589 | nmdc:mga09592_256991_c1 | 3300050508 | Bacteria | 1514 |
| 590 | nmdc:mga06r32_595847_c1 | 3300050510 | Bacteria | 1076 |
| 591 | nmdc:mga08y16_908261_c1 | 3300050511 | Unclassified | 866 |
| 592 | nmdc:mga08y16_99563_c1 | 3300050511 | Bacteria | 3027 |
| 593 | nmdc:mga0n895_81357_c1 | 3300050512 | Bacteria | 3228 |
| 594 | nmdc:mga0rr50_13606_c1 | 3300050513 | Bacteria | 5305 |
| 595 | nmdc:mga0rr50_458260_c1 | 3300050513 | Bacteria | 1081 |
| 596 | nmdc:mga0rr50_82854_c1 | 3300050513 | Bacteria | 2478 |
| 597 | nmdc:mga0a205_100150_c1 | 3300050515 | Bacteria | 2797 |
| 598 | nmdc:mga0a205_622364_c1 | 3300050515 | Unclassified | 932 |
| 599 | nmdc:mga0a205_703827_c1 | 3300050515 | Bacteria | 860 |
| 600 | Ga0495601_0026769 | 3300053077 | Bacteria | 3563 |
| 601 | Ga0495601_0253166 | 3300053077 | Bacteria | 1150 |
| 602 | Ga0495612_0058974 | 3300053078 | Bacteria | 1587 |
| 603 | Ga0495619_0012550 | 3300053085 | Bacteria | 5336 |
| 604 | Ga0495619_0012949 | 3300053085 | Bacteria | 5254 |
| 605 | Ga0495619_0080638 | 3300053085 | Bacteria | 2190 |
| 606 | Ga0495619_0207186 | 3300053085 | Bacteria | 1358 |
| 607 | Ga0501084_0054541 | 3300054114 | Bacteria | 3344 |
| 608 | Ga0501082_0016025 | 3300060353 | Bacteria | 6447 |
| 609 | Ga0530510_0022085 | 3300061734 | Bacteria | 4531 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035118 | Ga0373954_0165640 | Ga0373954_0165640_306_890 | 169 |
| 2 | 3300035172 | Ga0373955_0024629 | Ga0373955_0024629_641_1225 | 169 |
| 3 | 3300046511 | Ga0495608_0119771 | Ga0495608_0119771_95_679 | 169 |
| 4 | 3300046514 | Ga0495618_0255354 | Ga0495618_0255354_222_806 | 169 |
| 5 | 3300046536 | Ga0495587_0093090 | Ga0495587_0093090_924_1508 | 169 |
| 6 | 3300046543 | Ga0495645_0322815 | Ga0495645_0322815_139_723 | 169 |
| 7 | 3300046559 | Ga0495667_0064032 | Ga0495667_0064032_224_808 | 169 |
| 8 | 3300046678 | Ga0495599_0070717 | Ga0495599_0070717_587_1171 | 169 |
| 9 | 3300046689 | Ga0495613_0233188 | Ga0495613_0233188_544_1128 | 169 |
| 10 | 3300046690 | Ga0495624_0216125 | Ga0495624_0216125_315_899 | 169 |
| 11 | 3300047317 | Ga0495604_0124051 | Ga0495604_0124051_213_797 | 169 |
| 12 | 3300047444 | Ga0495675_0049456 | Ga0495675_0049456_253_837 | 169 |
| 13 | 3300047471 | Ga0495684_0203110 | Ga0495684_0203110_448_1032 | 169 |
| 14 | 3300048088 | Ga0495602_0116437 | Ga0495602_0116437_801_1385 | 169 |
| 15 | 3300049572 | Ga0501036_0027279 | Ga0501036_0027279_780_1292 | 169 |
| 16 | 3300049573 | Ga0501037_0030682 | Ga0501037_0030682_756_1268 | 169 |
| 17 | 3300049574 | Ga0501038_0058938 | Ga0501038_0058938_708_1220 | 169 |
| 18 | 3300049577 | Ga0501041_0024997 | Ga0501041_0024997_1123_1635 | 169 |
| 19 | 3300049578 | Ga0501042_0033857 | Ga0501042_0033857_1939_2451 | 169 |
| 20 | 3300049579 | Ga0501043_0288724 | Ga0501043_0288724_493_1005 | 169 |
| 21 | 3300049587 | Ga0501071_0114923 | Ga0501071_0114923_282_794 | 169 |
| 22 | 3300049588 | Ga0501072_0022091 | Ga0501072_0022091_2235_2747 | 169 |
| 23 | 3300049592 | Ga0501076_0019639 | Ga0501076_0019639_2015_2527 | 169 |
| 24 | 3300049741 | Ga0501079_0723274 | Ga0501079_0723274_210_722 | 169 |
| 25 | 3300049742 | Ga0501080_0575119 | Ga0501080_0575119_202_714 | 169 |
| 26 | 3300049743 | Ga0501081_0005825 | Ga0501081_0005825_3083_3595 | 169 |
| 27 | 3300049824 | Ga0501045_0029191 | Ga0501045_0029191_887_1399 | 169 |
| 28 | 3300053085 | Ga0495619_0012949 | Ga0495619_0012949_4447_5031 | 169 |
| 29 | 3300054114 | Ga0501084_0054541 | Ga0501084_0054541_62_574 | 169 |
| 30 | 3300060353 | Ga0501082_0016025 | Ga0501082_0016025_1151_1663 | 169 |
| 31 | 3300037312 | Ga0395899_0057931 | Ga0395899_0057931_1872_2408 | 173 |
| 32 | 3300037418 | Ga0395900_0001009 | Ga0395900_0001009_14996_15532 | 173 |
| 33 | 3300037466 | Ga0395898_0066891 | Ga0395898_0066891_1003_1539 | 173 |
| 34 | 3300037471 | Ga0395905_0001033 | Ga0395905_0001033_21345_21881 | 173 |
| 35 | 3300038443 | Ga0395901_0012090 | Ga0395901_0012090_1410_1946 | 173 |
| 36 | 3300037068 | Ga0373925_0866123 | Ga0373925_0866123_140_712 | 174 |
| 37 | 3300005937 | Ga0081455_10042893 | Ga0081455_100428932 | 177 |
| 38 | 3300009093 | Ga0105240_10102672 | Ga0105240_101026723 | 179 |
| 39 | 3300009545 | Ga0105237_10285356 | Ga0105237_102853563 | 179 |
| 40 | 3300013100 | Ga0157373_10107747 | Ga0157373_101077472 | 179 |
| 41 | 3300013104 | Ga0157370_10091664 | Ga0157370_100916643 | 179 |
| 42 | 3300013307 | Ga0157372_10334821 | Ga0157372_103348211 | 179 |
| 43 | 3300020081 | Ga0206354_11310183 | Ga0206354_113101832 | 179 |
| 44 | 3300044694 | Ga0466963_0148678 | Ga0466963_0148678_584_1150 | 179 |
| 45 | 3300045976 | Ga0466967_0020487 | Ga0466967_0020487_2922_3488 | 179 |
| 46 | 3300048915 | Ga0496112_1296133 | Ga0496112_1296133_59_604 | 179 |
| 47 | 3300048916 | Ga0496113_0499214 | Ga0496113_0499214_223_768 | 179 |
| 48 | 3300035084 | Ga0373928_0031219 | Ga0373928_0031219_514_1128 | 182 |
| 49 | 3300037312 | Ga0395899_0035920 | Ga0395899_0035920_1416_2027 | 182 |
| 50 | 3300037418 | Ga0395900_0034348 | Ga0395900_0034348_723_1334 | 182 |
| 51 | 3300037466 | Ga0395898_0020640 | Ga0395898_0020640_3905_4516 | 182 |
| 52 | 3300037471 | Ga0395905_0210352 | Ga0395905_0210352_111_722 | 182 |
| 53 | 3300038443 | Ga0395901_0012202 | Ga0395901_0012202_5510_6121 | 182 |
| 54 | 3300005337 | Ga0070682_100095236 | Ga0070682_1000952363 | 183 |
| 55 | 3300005364 | Ga0070673_100184980 | Ga0070673_1001849803 | 183 |
| 56 | 3300005434 | Ga0070709_10042427 | Ga0070709_100424273 | 183 |
| 57 | 3300005435 | Ga0070714_100039267 | Ga0070714_1000392673 | 183 |
| 58 | 3300005436 | Ga0070713_100153409 | Ga0070713_1001534091 | 183 |
| 59 | 3300005437 | Ga0070710_10009817 | Ga0070710_100098173 | 183 |
| 60 | 3300005440 | Ga0070705_100285209 | Ga0070705_1002852092 | 183 |
| 61 | 3300005455 | Ga0070663_100036411 | Ga0070663_1000364113 | 183 |
| 62 | 3300005518 | Ga0070699_100041248 | Ga0070699_1000412483 | 183 |
| 63 | 3300005544 | Ga0070686_100564851 | Ga0070686_1005648511 | 183 |
| 64 | 3300005546 | Ga0070696_100531487 | Ga0070696_1005314871 | 183 |
| 65 | 3300005614 | Ga0068856_100020613 | Ga0068856_1000206134 | 183 |
| 66 | 3300006163 | Ga0070715_10000654 | Ga0070715_100006548 | 183 |
| 67 | 3300006175 | Ga0070712_100041410 | Ga0070712_1000414102 | 183 |
| 68 | 3300006237 | Ga0097621_100059539 | Ga0097621_1000595393 | 183 |
| 69 | 3300006358 | Ga0068871_100040460 | Ga0068871_1000404604 | 183 |
| 70 | 3300006871 | Ga0075434_100347216 | Ga0075434_1003472162 | 183 |
| 71 | 3300006914 | Ga0075436_100134418 | Ga0075436_1001344183 | 183 |
| 72 | 3300007076 | Ga0075435_100048479 | Ga0075435_1000484792 | 183 |
| 73 | 3300011119 | Ga0105246_10473270 | Ga0105246_104732702 | 183 |
| 74 | 3300013100 | Ga0157373_10329802 | Ga0157373_103298022 | 183 |
| 75 | 3300013297 | Ga0157378_10521890 | Ga0157378_105218902 | 183 |
| 76 | 3300014969 | Ga0157376_10070667 | Ga0157376_100706672 | 183 |
| 77 | 3300025898 | Ga0207692_10015566 | Ga0207692_100155663 | 183 |
| 78 | 3300025898 | Ga0207692_10285335 | Ga0207692_102853351 | 183 |
| 79 | 3300025905 | Ga0207685_10106386 | Ga0207685_101063862 | 183 |
| 80 | 3300025911 | Ga0207654_10047591 | Ga0207654_100475913 | 183 |
| 81 | 3300025915 | Ga0207693_10015144 | Ga0207693_100151446 | 183 |
| 82 | 3300025915 | Ga0207693_10020189 | Ga0207693_100201893 | 183 |
| 83 | 3300025916 | Ga0207663_10047610 | Ga0207663_100476104 | 183 |
| 84 | 3300025921 | Ga0207652_10408552 | Ga0207652_104085522 | 183 |
| 85 | 3300025928 | Ga0207700_10082707 | Ga0207700_100827073 | 183 |
| 86 | 3300025928 | Ga0207700_10835038 | Ga0207700_108350382 | 183 |
| 87 | 3300025929 | Ga0207664_10540347 | Ga0207664_105403472 | 183 |
| 88 | 3300025939 | Ga0207665_10009442 | Ga0207665_100094425 | 183 |
| 89 | 3300025939 | Ga0207665_10180960 | Ga0207665_101809602 | 183 |
| 90 | 3300026067 | Ga0207678_10021000 | Ga0207678_100210003 | 183 |
| 91 | 3300026078 | Ga0207702_10091714 | Ga0207702_100917144 | 183 |
| 92 | 3300034820 | Ga0373959_0004948 | Ga0373959_0004948_881_1495 | 183 |
| 93 | 3300035242 | Ga0373962_0057048 | Ga0373962_0057048_336_950 | 183 |
| 94 | 3300035691 | Ga0373931_0673050 | Ga0373931_0673050_54_668 | 183 |
| 95 | 3300048905 | Ga0496102_0276539 | Ga0496102_0276539_360_974 | 183 |
| 96 | 3300048906 | Ga0496103_0022233 | Ga0496103_0022233_298_912 | 183 |
| 97 | 3300048907 | Ga0496104_0481301 | Ga0496104_0481301_354_968 | 183 |
| 98 | 3300048909 | Ga0496106_0521087 | Ga0496106_0521087_246_860 | 183 |
| 99 | 3300048910 | Ga0496107_0117226 | Ga0496107_0117226_761_1375 | 183 |
| 100 | 3300048913 | Ga0496110_0140385 | Ga0496110_0140385_1220_1828 | 183 |
| 101 | 3300048913 | Ga0496110_0524644 | Ga0496110_0524644_317_931 | 183 |
| 102 | 3300048915 | Ga0496112_0244298 | Ga0496112_0244298_586_1200 | 183 |
| 103 | 3300048916 | Ga0496113_0338321 | Ga0496113_0338321_464_1078 | 183 |
| 104 | 3300048917 | Ga0496114_0159050 | Ga0496114_0159050_894_1508 | 183 |
| 105 | 3300048918 | Ga0496115_0017651 | Ga0496115_0017651_4623_5237 | 183 |
| 106 | 3300048918 | Ga0496115_0191751 | Ga0496115_0191751_489_1103 | 183 |
| 107 | 3300050513 | nmdc:mga0rr50_82854_c1 | nmdc:mga0rr50_82854_c1_1220_1834 | 183 |
| 108 | 3300005435 | Ga0070714_101436720 | Ga0070714_1014367201 | 184 |
| 109 | 3300044706 | Ga0466964_0415677 | Ga0466964_0415677_100_675 | 184 |
| 110 | 3300045976 | Ga0466967_0076320 | Ga0466967_0076320_1799_2374 | 184 |
| 111 | 3300045976 | Ga0466967_0079196 | Ga0466967_0079196_2353_2913 | 184 |
| 112 | 3300046462 | Ga0495651_0048767 | Ga0495651_0048767_34_594 | 184 |
| 113 | 3300046511 | Ga0495608_0016498 | Ga0495608_0016498_51_611 | 184 |
| 114 | 3300046529 | Ga0495652_0130019 | Ga0495652_0130019_438_998 | 184 |
| 115 | 3300046675 | Ga0495657_0289626 | Ga0495657_0289626_116_676 | 184 |
| 116 | 3300047317 | Ga0495604_0178739 | Ga0495604_0178739_253_813 | 184 |
| 117 | 3300047319 | Ga0495674_0018930 | Ga0495674_0018930_2223_2783 | 184 |
| 118 | 3300053077 | Ga0495601_0253166 | Ga0495601_0253166_426_986 | 184 |
| 119 | 3300053078 | Ga0495612_0058974 | Ga0495612_0058974_103_663 | 184 |
| 120 | 3300053085 | Ga0495619_0207186 | Ga0495619_0207186_58_618 | 184 |
| 121 | 3300005564 | Ga0070664_100581060 | Ga0070664_1005810602 | 185 |
| 122 | 3300025945 | Ga0207679_10534569 | Ga0207679_105345692 | 185 |
| 123 | 3300035170 | Ga0373943_0072897 | Ga0373943_0072897_933_1541 | 186 |
| 124 | 3300035725 | Ga0373947_0306441 | Ga0373947_0306441_80_688 | 186 |
| 125 | 3300044706 | Ga0466964_0391408 | Ga0466964_0391408_65_631 | 186 |
| 126 | 3300045976 | Ga0466967_0169328 | Ga0466967_0169328_1263_1829 | 186 |
| 127 | 3300048905 | Ga0496102_0269614 | Ga0496102_0269614_998_1564 | 186 |
| 128 | 3300049580 | Ga0501046_0084140 | Ga0501046_0084140_97_705 | 186 |
| 129 | 3300049581 | Ga0501047_0020349 | Ga0501047_0020349_4233_4841 | 186 |
| 130 | 3300049586 | Ga0501070_0212554 | Ga0501070_0212554_321_929 | 186 |
| 131 | 3300049744 | Ga0501083_0431536 | Ga0501083_0431536_156_764 | 186 |
| 132 | 3300005616 | Ga0068852_100766007 | Ga0068852_1007660072 | 187 |
| 133 | 3300015261 | Ga0182006_1179944 | Ga0182006_11799441 | 187 |
| 134 | 3300044694 | Ga0466963_0007165 | Ga0466963_0007165_5830_6399 | 187 |
| 135 | 3300005341 | Ga0070691_10135809 | Ga0070691_101358092 | 188 |
| 136 | 3300005435 | Ga0070714_100063619 | Ga0070714_1000636192 | 188 |
| 137 | 3300005440 | Ga0070705_100550972 | Ga0070705_1005509721 | 188 |
| 138 | 3300005456 | Ga0070678_100231851 | Ga0070678_1002318513 | 188 |
| 139 | 3300005458 | Ga0070681_10058852 | Ga0070681_100588522 | 188 |
| 140 | 3300005530 | Ga0070679_101139264 | Ga0070679_1011392641 | 188 |
| 141 | 3300005535 | Ga0070684_100216044 | Ga0070684_1002160443 | 188 |
| 142 | 3300005545 | Ga0070695_100311010 | Ga0070695_1003110102 | 188 |
| 143 | 3300005546 | Ga0070696_100250219 | Ga0070696_1002502192 | 188 |
| 144 | 3300005547 | Ga0070693_100004865 | Ga0070693_1000048656 | 188 |
| 145 | 3300005563 | Ga0068855_100023892 | Ga0068855_1000238924 | 188 |
| 146 | 3300005614 | Ga0068856_100089066 | Ga0068856_1000890663 | 188 |
| 147 | 3300005615 | Ga0070702_100087311 | Ga0070702_1000873112 | 188 |
| 148 | 3300009174 | Ga0105241_10444981 | Ga0105241_104449812 | 188 |
| 149 | 3300020070 | Ga0206356_11697997 | Ga0206356_116979971 | 188 |
| 150 | 3300020082 | Ga0206353_10811714 | Ga0206353_108117142 | 188 |
| 151 | 3300025912 | Ga0207707_10057124 | Ga0207707_100571243 | 188 |
| 152 | 3300025914 | Ga0207671_10321125 | Ga0207671_103211253 | 188 |
| 153 | 3300025917 | Ga0207660_10385880 | Ga0207660_103858802 | 188 |
| 154 | 3300025921 | Ga0207652_10251952 | Ga0207652_102519522 | 188 |
| 155 | 3300025921 | Ga0207652_10457273 | Ga0207652_104572733 | 188 |
| 156 | 3300025924 | Ga0207694_11223807 | Ga0207694_112238071 | 188 |
| 157 | 3300025929 | Ga0207664_10030555 | Ga0207664_100305554 | 188 |
| 158 | 3300025981 | Ga0207640_10099870 | Ga0207640_100998703 | 188 |
| 159 | 3300026078 | Ga0207702_10498718 | Ga0207702_104987182 | 188 |
| 160 | 3300026121 | Ga0207683_10077408 | Ga0207683_100774083 | 188 |
| 161 | 3300037418 | Ga0395900_0099566 | Ga0395900_0099566_508_1116 | 188 |
| 162 | 3300038443 | Ga0395901_1267495 | Ga0395901_1267495_13_621 | 188 |
| 163 | 3300048905 | Ga0496102_0365850 | Ga0496102_0365850_365_1003 | 188 |
| 164 | 3300005547 | Ga0070693_100613029 | Ga0070693_1006130291 | 189 |
| 165 | 3300009093 | Ga0105240_10908980 | Ga0105240_109089802 | 189 |
| 166 | 3300013307 | Ga0157372_11085571 | Ga0157372_110855712 | 189 |
| 167 | 3300013307 | Ga0157372_11203384 | Ga0157372_112033842 | 189 |
| 168 | 3300025916 | Ga0207663_10504598 | Ga0207663_105045982 | 189 |
| 169 | 3300025929 | Ga0207664_10285601 | Ga0207664_102856013 | 189 |
| 170 | 3300037418 | Ga0395900_0646074 | Ga0395900_0646074_366_956 | 189 |
| 171 | 3300037466 | Ga0395898_0480294 | Ga0395898_0480294_568_1158 | 189 |
| 172 | 3300038443 | Ga0395901_0225294 | Ga0395901_0225294_601_1191 | 189 |
| 173 | 3300038443 | Ga0395901_0348433 | Ga0395901_0348433_618_1193 | 189 |
| 174 | 3300044694 | Ga0466963_0711046 | Ga0466963_0711046_37_612 | 189 |
| 175 | 3300044706 | Ga0466964_0111307 | Ga0466964_0111307_312_926 | 189 |
| 176 | 3300044719 | Ga0466971_0268785 | Ga0466971_0268785_194_769 | 189 |
| 177 | 3300044842 | Ga0466957_0357522 | Ga0466957_0357522_30_605 | 189 |
| 178 | 3300045976 | Ga0466967_0231957 | Ga0466967_0231957_872_1447 | 189 |
| 179 | 3300046459 | Ga0495629_0141110 | Ga0495629_0141110_1060_1635 | 189 |
| 180 | 3300046459 | Ga0495629_0730225 | Ga0495629_0730225_71_646 | 189 |
| 181 | 3300047315 | Ga0495581_0136840 | Ga0495581_0136840_152_727 | 189 |
| 182 | 3300048088 | Ga0495602_0742064 | Ga0495602_0742064_32_607 | 189 |
| 183 | 3300048907 | Ga0496104_0080285 | Ga0496104_0080285_2230_2805 | 189 |
| 184 | 3300048917 | Ga0496114_0002716 | Ga0496114_0002716_6544_7119 | 189 |
| 185 | 3300048918 | Ga0496115_0003805 | Ga0496115_0003805_6762_7337 | 189 |
| 186 | 3300021384 | Ga0213876_10070533 | Ga0213876_100705332 | 190 |
| 187 | 3300037853 | Ga0436364_0069329 | Ga0436364_0069329_209_787 | 190 |
| 188 | 3300039437 | Ga0436365_0415531 | Ga0436365_0415531_3225_3803 | 190 |
| 189 | 3300039437 | Ga0436365_1056826 | Ga0436365_1056826_540_1118 | 190 |
| 190 | 3300039450 | Ga0436363_1633358 | Ga0436363_1633358_1036_1614 | 190 |
| 191 | 3300045976 | Ga0466967_0062473 | Ga0466967_0062473_763_1341 | 190 |
| 192 | 3300046462 | Ga0495651_0167727 | Ga0495651_0167727_933_1541 | 190 |
| 193 | 3300005437 | Ga0070710_10547484 | Ga0070710_105474841 | 191 |
| 194 | 3300005983 | Ga0081540_1127358 | Ga0081540_11273582 | 192 |
| 195 | 3300006175 | Ga0070712_100024130 | Ga0070712_1000241303 | 192 |
| 196 | 3300013296 | Ga0157374_10180541 | Ga0157374_101805413 | 192 |
| 197 | 3300025915 | Ga0207693_10061804 | Ga0207693_100618043 | 192 |
| 198 | 3300025916 | Ga0207663_10603310 | Ga0207663_106033101 | 192 |
| 199 | 3300035691 | Ga0373931_0435745 | Ga0373931_0435745_30_617 | 192 |
| 200 | 3300044694 | Ga0466963_0043897 | Ga0466963_0043897_1029_1625 | 192 |
| 201 | 3300045976 | Ga0466967_0255654 | Ga0466967_0255654_323_919 | 192 |
| 202 | 3300048904 | Ga0496101_0206284 | Ga0496101_0206284_234_821 | 192 |
| 203 | 3300048906 | Ga0496103_0164634 | Ga0496103_0164634_200_787 | 192 |
| 204 | 3300048907 | Ga0496104_0019246 | Ga0496104_0019246_1248_1835 | 192 |
| 205 | 3300048910 | Ga0496107_0041489 | Ga0496107_0041489_2201_2788 | 192 |
| 206 | 3300048911 | Ga0496108_0001639 | Ga0496108_0001639_15163_15750 | 192 |
| 207 | 3300048912 | Ga0496109_0035209 | Ga0496109_0035209_1277_1864 | 192 |
| 208 | 3300048913 | Ga0496110_0002351 | Ga0496110_0002351_7312_7899 | 192 |
| 209 | 3300048914 | Ga0496111_0068769 | Ga0496111_0068769_255_842 | 192 |
| 210 | 3300048916 | Ga0496113_0004409 | Ga0496113_0004409_3678_4265 | 192 |
| 211 | 3300010375 | Ga0105239_10154711 | Ga0105239_101547113 | 193 |
| 212 | 3300025933 | Ga0207706_10010417 | Ga0207706_100104175 | 193 |
| 213 | 3300046491 | Ga0495584_0263386 | Ga0495584_0263386_90_728 | 193 |
| 214 | 3300046523 | Ga0495644_0175579 | Ga0495644_0175579_81_719 | 193 |
| 215 | 3300044719 | Ga0466971_0014266 | Ga0466971_0014266_2269_2880 | 194 |
| 216 | 3300044842 | Ga0466957_0523014 | Ga0466957_0523014_82_693 | 194 |
| 217 | 3300045836 | Ga0466958_0187391 | Ga0466958_0187391_183_794 | 194 |
| 218 | 3300045976 | Ga0466967_0029561 | Ga0466967_0029561_707_1318 | 194 |
| 219 | 3300005337 | Ga0070682_100500317 | Ga0070682_1005003171 | 195 |
| 220 | 3300005339 | Ga0070660_100050719 | Ga0070660_1000507193 | 195 |
| 221 | 3300005344 | Ga0070661_100065602 | Ga0070661_1000656023 | 195 |
| 222 | 3300005458 | Ga0070681_10078347 | Ga0070681_100783474 | 195 |
| 223 | 3300005458 | Ga0070681_10186674 | Ga0070681_101866743 | 195 |
| 224 | 3300005530 | Ga0070679_100021643 | Ga0070679_1000216436 | 195 |
| 225 | 3300005530 | Ga0070679_100054903 | Ga0070679_1000549034 | 195 |
| 226 | 3300005530 | Ga0070679_100294779 | Ga0070679_1002947792 | 195 |
| 227 | 3300005539 | Ga0068853_100390264 | Ga0068853_1003902642 | 195 |
| 228 | 3300005577 | Ga0068857_100613880 | Ga0068857_1006138802 | 195 |
| 229 | 3300009093 | Ga0105240_10407390 | Ga0105240_104073901 | 195 |
| 230 | 3300013307 | Ga0157372_10194191 | Ga0157372_101941913 | 195 |
| 231 | 3300013308 | Ga0157375_10019167 | Ga0157375_100191676 | 195 |
| 232 | 3300025912 | Ga0207707_10039759 | Ga0207707_100397594 | 195 |
| 233 | 3300025917 | Ga0207660_10021857 | Ga0207660_100218573 | 195 |
| 234 | 3300025919 | Ga0207657_10088477 | Ga0207657_100884773 | 195 |
| 235 | 3300025919 | Ga0207657_10295785 | Ga0207657_102957852 | 195 |
| 236 | 3300025921 | Ga0207652_10204831 | Ga0207652_102048311 | 195 |
| 237 | 3300026041 | Ga0207639_10245967 | Ga0207639_102459671 | 195 |
| 238 | 3300026067 | Ga0207678_11022182 | Ga0207678_110221821 | 195 |
| 239 | 3300026116 | Ga0207674_10029332 | Ga0207674_100293326 | 195 |
| 240 | 3300037068 | Ga0373925_0277634 | Ga0373925_0277634_546_1148 | 195 |
| 241 | 3300042005 | Ga0439448_0120022 | Ga0439448_0120022_299_892 | 195 |
| 242 | 3300046473 | Ga0495582_0130634 | Ga0495582_0130634_640_1242 | 195 |
| 243 | 3300046506 | Ga0495583_0294309 | Ga0495583_0294309_12_614 | 195 |
| 244 | 3300046615 | Ga0495656_0033437 | Ga0495656_0033437_594_1196 | 195 |
| 245 | 3300046690 | Ga0495624_0401169 | Ga0495624_0401169_60_662 | 195 |
| 246 | 3300046692 | Ga0495671_0183687 | Ga0495671_0183687_140_742 | 195 |
| 247 | 3300048904 | Ga0496101_0128510 | Ga0496101_0128510_350_952 | 195 |
| 248 | 3300048907 | Ga0496104_0007994 | Ga0496104_0007994_7321_7923 | 195 |
| 249 | 3300048908 | Ga0496105_0048656 | Ga0496105_0048656_560_1162 | 195 |
| 250 | 3300048911 | Ga0496108_0012650 | Ga0496108_0012650_5736_6338 | 195 |
| 251 | 3300048912 | Ga0496109_0118069 | Ga0496109_0118069_1122_1724 | 195 |
| 252 | 3300048913 | Ga0496110_0004851 | Ga0496110_0004851_3774_4376 | 195 |
| 253 | 3300048914 | Ga0496111_0005204 | Ga0496111_0005204_5194_5796 | 195 |
| 254 | 3300048915 | Ga0496112_0080709 | Ga0496112_0080709_1493_2095 | 195 |
| 255 | 3300048916 | Ga0496113_0000612 | Ga0496113_0000612_2193_2795 | 195 |
| 256 | 3300048917 | Ga0496114_0029440 | Ga0496114_0029440_2143_2745 | 195 |
| 257 | 3300048918 | Ga0496115_0020748 | Ga0496115_0020748_1375_1977 | 195 |
| 258 | 3300049583 | Ga0501067_0001274 | Ga0501067_0001274_8844_9437 | 195 |
| 259 | 3300049585 | Ga0501069_0005847 | Ga0501069_0005847_717_1310 | 195 |
| 260 | 3300049586 | Ga0501070_0099001 | Ga0501070_0099001_1135_1728 | 195 |
| 261 | 3300049743 | Ga0501081_0130715 | Ga0501081_0130715_80_673 | 195 |
| 262 | 3300061734 | Ga0530510_0022085 | Ga0530510_0022085_3687_4280 | 195 |
| 263 | 3300009093 | Ga0105240_10178584 | Ga0105240_101785841 | 196 |
| 264 | 3300013104 | Ga0157370_10002516 | Ga0157370_1000251614 | 196 |
| 265 | 3300013307 | Ga0157372_10584061 | Ga0157372_105840612 | 196 |
| 266 | 3300005328 | Ga0070676_10081876 | Ga0070676_100818762 | 199 |
| 267 | 3300005328 | Ga0070676_10334144 | Ga0070676_103341442 | 199 |
| 268 | 3300005329 | Ga0070683_100138930 | Ga0070683_1001389303 | 199 |
| 269 | 3300005329 | Ga0070683_100343345 | Ga0070683_1003433452 | 199 |
| 270 | 3300005330 | Ga0070690_100209833 | Ga0070690_1002098332 | 199 |
| 271 | 3300005336 | Ga0070680_100070859 | Ga0070680_1000708592 | 199 |
| 272 | 3300005338 | Ga0068868_100021788 | Ga0068868_1000217884 | 199 |
| 273 | 3300005338 | Ga0068868_100167146 | Ga0068868_1001671462 | 199 |
| 274 | 3300005339 | Ga0070660_100031245 | Ga0070660_1000312454 | 199 |
| 275 | 3300005340 | Ga0070689_100358758 | Ga0070689_1003587582 | 199 |
| 276 | 3300005340 | Ga0070689_100507162 | Ga0070689_1005071622 | 199 |
| 277 | 3300005341 | Ga0070691_10074907 | Ga0070691_100749072 | 199 |
| 278 | 3300005343 | Ga0070687_100146084 | Ga0070687_1001460842 | 199 |
| 279 | 3300005347 | Ga0070668_100122738 | Ga0070668_1001227383 | 199 |
| 280 | 3300005353 | Ga0070669_100064010 | Ga0070669_1000640103 | 199 |
| 281 | 3300005355 | Ga0070671_100167077 | Ga0070671_1001670772 | 199 |
| 282 | 3300005356 | Ga0070674_100027862 | Ga0070674_1000278622 | 199 |
| 283 | 3300005364 | Ga0070673_100032982 | Ga0070673_1000329823 | 199 |
| 284 | 3300005364 | Ga0070673_100917615 | Ga0070673_1009176151 | 199 |
| 285 | 3300005365 | Ga0070688_100406136 | Ga0070688_1004061362 | 199 |
| 286 | 3300005366 | Ga0070659_100269334 | Ga0070659_1002693342 | 199 |
| 287 | 3300005436 | Ga0070713_100056744 | Ga0070713_1000567444 | 199 |
| 288 | 3300005438 | Ga0070701_10031548 | Ga0070701_100315483 | 199 |
| 289 | 3300005440 | Ga0070705_100420745 | Ga0070705_1004207452 | 199 |
| 290 | 3300005441 | Ga0070700_100034234 | Ga0070700_1000342344 | 199 |
| 291 | 3300005444 | Ga0070694_100214358 | Ga0070694_1002143583 | 199 |
| 292 | 3300005445 | Ga0070708_100058064 | Ga0070708_1000580643 | 199 |
| 293 | 3300005456 | Ga0070678_100015402 | Ga0070678_1000154023 | 199 |
| 294 | 3300005456 | Ga0070678_100544970 | Ga0070678_1005449702 | 199 |
| 295 | 3300005457 | Ga0070662_100137253 | Ga0070662_1001372532 | 199 |
| 296 | 3300005457 | Ga0070662_100286800 | Ga0070662_1002868002 | 199 |
| 297 | 3300005459 | Ga0068867_100077554 | Ga0068867_1000775543 | 199 |
| 298 | 3300005467 | Ga0070706_100009785 | Ga0070706_1000097856 | 199 |
| 299 | 3300005468 | Ga0070707_100005169 | Ga0070707_1000051694 | 199 |
| 300 | 3300005471 | Ga0070698_100447382 | Ga0070698_1004473822 | 199 |
| 301 | 3300005518 | Ga0070699_100014180 | Ga0070699_1000141803 | 199 |
| 302 | 3300005518 | Ga0070699_100026603 | Ga0070699_1000266034 | 199 |
| 303 | 3300005530 | Ga0070679_100795398 | Ga0070679_1007953981 | 199 |
| 304 | 3300005535 | Ga0070684_100496266 | Ga0070684_1004962662 | 199 |
| 305 | 3300005536 | Ga0070697_100090377 | Ga0070697_1000903772 | 199 |
| 306 | 3300005539 | Ga0068853_100616433 | Ga0068853_1006164332 | 199 |
| 307 | 3300005543 | Ga0070672_100155796 | Ga0070672_1001557962 | 199 |
| 308 | 3300005544 | Ga0070686_100065670 | Ga0070686_1000656703 | 199 |
| 309 | 3300005544 | Ga0070686_100491057 | Ga0070686_1004910571 | 199 |
| 310 | 3300005545 | Ga0070695_100291237 | Ga0070695_1002912371 | 199 |
| 311 | 3300005546 | Ga0070696_100579213 | Ga0070696_1005792132 | 199 |
| 312 | 3300005547 | Ga0070693_100085983 | Ga0070693_1000859832 | 199 |
| 313 | 3300005563 | Ga0068855_100112283 | Ga0068855_1001122832 | 199 |
| 314 | 3300005564 | Ga0070664_100575210 | Ga0070664_1005752102 | 199 |
| 315 | 3300005578 | Ga0068854_100028313 | Ga0068854_1000283133 | 199 |
| 316 | 3300005615 | Ga0070702_100082577 | Ga0070702_1000825772 | 199 |
| 317 | 3300005616 | Ga0068852_100697629 | Ga0068852_1006976292 | 199 |
| 318 | 3300005617 | Ga0068859_100468278 | Ga0068859_1004682783 | 199 |
| 319 | 3300005618 | Ga0068864_100290358 | Ga0068864_1002903582 | 199 |
| 320 | 3300005718 | Ga0068866_10154946 | Ga0068866_101549462 | 199 |
| 321 | 3300005719 | Ga0068861_100018180 | Ga0068861_1000181806 | 199 |
| 322 | 3300005843 | Ga0068860_100549176 | Ga0068860_1005491761 | 199 |
| 323 | 3300005844 | Ga0068862_100355280 | Ga0068862_1003552802 | 199 |
| 324 | 3300005937 | Ga0081455_10006302 | Ga0081455_100063023 | 199 |
| 325 | 3300005983 | Ga0081540_1004699 | Ga0081540_10046992 | 199 |
| 326 | 3300006028 | Ga0070717_10050252 | Ga0070717_100502524 | 199 |
| 327 | 3300006058 | Ga0075432_10024425 | Ga0075432_100244253 | 199 |
| 328 | 3300006173 | Ga0070716_100323424 | Ga0070716_1003234242 | 199 |
| 329 | 3300006847 | Ga0075431_100132704 | Ga0075431_1001327042 | 199 |
| 330 | 3300006871 | Ga0075434_100158526 | Ga0075434_1001585263 | 199 |
| 331 | 3300006880 | Ga0075429_100157336 | Ga0075429_1001573362 | 199 |
| 332 | 3300006914 | Ga0075436_100009431 | Ga0075436_1000094312 | 199 |
| 333 | 3300006931 | Ga0097620_100468302 | Ga0097620_1004683021 | 199 |
| 334 | 3300007076 | Ga0075435_100374301 | Ga0075435_1003743012 | 199 |
| 335 | 3300009092 | Ga0105250_10074374 | Ga0105250_100743742 | 199 |
| 336 | 3300009098 | Ga0105245_10041452 | Ga0105245_100414523 | 199 |
| 337 | 3300009098 | Ga0105245_10151137 | Ga0105245_101511373 | 199 |
| 338 | 3300009098 | Ga0105245_10286766 | Ga0105245_102867663 | 199 |
| 339 | 3300009098 | Ga0105245_11932870 | Ga0105245_119328701 | 199 |
| 340 | 3300009147 | Ga0114129_10069365 | Ga0114129_100693654 | 199 |
| 341 | 3300009148 | Ga0105243_10058320 | Ga0105243_100583203 | 199 |
| 342 | 3300009148 | Ga0105243_10278002 | Ga0105243_102780023 | 199 |
| 343 | 3300009176 | Ga0105242_10025311 | Ga0105242_100253112 | 199 |
| 344 | 3300009177 | Ga0105248_10069119 | Ga0105248_100691195 | 199 |
| 345 | 3300009177 | Ga0105248_10497426 | Ga0105248_104974262 | 199 |
| 346 | 3300009553 | Ga0105249_10026375 | Ga0105249_100263753 | 199 |
| 347 | 3300009553 | Ga0105249_10078383 | Ga0105249_100783833 | 199 |
| 348 | 3300009553 | Ga0105249_10478008 | Ga0105249_104780082 | 199 |
| 349 | 3300009553 | Ga0105249_10907855 | Ga0105249_109078551 | 199 |
| 350 | 3300010375 | Ga0105239_10093744 | Ga0105239_100937441 | 199 |
| 351 | 3300012481 | Ga0157320_1000895 | Ga0157320_10008952 | 199 |
| 352 | 3300012497 | Ga0157319_1005770 | Ga0157319_10057701 | 199 |
| 353 | 3300012503 | Ga0157313_1002734 | Ga0157313_10027341 | 199 |
| 354 | 3300013102 | Ga0157371_10028105 | Ga0157371_100281053 | 199 |
| 355 | 3300013297 | Ga0157378_10185453 | Ga0157378_101854533 | 199 |
| 356 | 3300013306 | Ga0163162_10060678 | Ga0163162_100606783 | 199 |
| 357 | 3300013307 | Ga0157372_10383170 | Ga0157372_103831702 | 199 |
| 358 | 3300013308 | Ga0157375_10020987 | Ga0157375_100209875 | 199 |
| 359 | 3300014325 | Ga0163163_10835227 | Ga0163163_108352272 | 199 |
| 360 | 3300014326 | Ga0157380_10015939 | Ga0157380_100159393 | 199 |
| 361 | 3300014969 | Ga0157376_10617688 | Ga0157376_106176882 | 199 |
| 362 | 3300017792 | Ga0163161_10031916 | Ga0163161_100319163 | 199 |
| 363 | 3300025899 | Ga0207642_10096720 | Ga0207642_100967202 | 199 |
| 364 | 3300025899 | Ga0207642_10256181 | Ga0207642_102561812 | 199 |
| 365 | 3300025907 | Ga0207645_10054317 | Ga0207645_100543173 | 199 |
| 366 | 3300025907 | Ga0207645_10300121 | Ga0207645_103001212 | 199 |
| 367 | 3300025910 | Ga0207684_10103980 | Ga0207684_101039803 | 199 |
| 368 | 3300025914 | Ga0207671_10162484 | Ga0207671_101624842 | 199 |
| 369 | 3300025915 | Ga0207693_10048916 | Ga0207693_100489164 | 199 |
| 370 | 3300025916 | Ga0207663_10358158 | Ga0207663_103581581 | 199 |
| 371 | 3300025917 | Ga0207660_10194054 | Ga0207660_101940543 | 199 |
| 372 | 3300025918 | Ga0207662_10029471 | Ga0207662_100294712 | 199 |
| 373 | 3300025919 | Ga0207657_10011840 | Ga0207657_100118408 | 199 |
| 374 | 3300025920 | Ga0207649_10488575 | Ga0207649_104885752 | 199 |
| 375 | 3300025922 | Ga0207646_10012659 | Ga0207646_100126596 | 199 |
| 376 | 3300025927 | Ga0207687_10054987 | Ga0207687_100549872 | 199 |
| 377 | 3300025927 | Ga0207687_10068145 | Ga0207687_100681453 | 199 |
| 378 | 3300025927 | Ga0207687_10117288 | Ga0207687_101172882 | 199 |
| 379 | 3300025932 | Ga0207690_10268125 | Ga0207690_102681252 | 199 |
| 380 | 3300025933 | Ga0207706_10018314 | Ga0207706_100183148 | 199 |
| 381 | 3300025934 | Ga0207686_10297157 | Ga0207686_102971572 | 199 |
| 382 | 3300025934 | Ga0207686_10391558 | Ga0207686_103915581 | 199 |
| 383 | 3300025935 | Ga0207709_10558095 | Ga0207709_105580952 | 199 |
| 384 | 3300025936 | Ga0207670_10877269 | Ga0207670_108772691 | 199 |
| 385 | 3300025938 | Ga0207704_10553467 | Ga0207704_105534672 | 199 |
| 386 | 3300025940 | Ga0207691_10540370 | Ga0207691_105403701 | 199 |
| 387 | 3300025941 | Ga0207711_10205634 | Ga0207711_102056343 | 199 |
| 388 | 3300025941 | Ga0207711_10376897 | Ga0207711_103768972 | 199 |
| 389 | 3300025942 | Ga0207689_10633434 | Ga0207689_106334342 | 199 |
| 390 | 3300025944 | Ga0207661_10220513 | Ga0207661_102205132 | 199 |
| 391 | 3300025945 | Ga0207679_10460926 | Ga0207679_104609262 | 199 |
| 392 | 3300025945 | Ga0207679_10501653 | Ga0207679_105016532 | 199 |
| 393 | 3300025949 | Ga0207667_10546700 | Ga0207667_105467002 | 199 |
| 394 | 3300025949 | Ga0207667_10651785 | Ga0207667_106517852 | 199 |
| 395 | 3300025960 | Ga0207651_10122907 | Ga0207651_101229072 | 199 |
| 396 | 3300025960 | Ga0207651_10531756 | Ga0207651_105317562 | 199 |
| 397 | 3300025961 | Ga0207712_10188107 | Ga0207712_101881072 | 199 |
| 398 | 3300025961 | Ga0207712_10258512 | Ga0207712_102585123 | 199 |
| 399 | 3300025961 | Ga0207712_10454711 | Ga0207712_104547112 | 199 |
| 400 | 3300025972 | Ga0207668_10045440 | Ga0207668_100454403 | 199 |
| 401 | 3300025981 | Ga0207640_10139815 | Ga0207640_101398153 | 199 |
| 402 | 3300026023 | Ga0207677_10142366 | Ga0207677_101423663 | 199 |
| 403 | 3300026023 | Ga0207677_10290017 | Ga0207677_102900172 | 199 |
| 404 | 3300026035 | Ga0207703_10368809 | Ga0207703_103688092 | 199 |
| 405 | 3300026075 | Ga0207708_10011806 | Ga0207708_100118063 | 199 |
| 406 | 3300026078 | Ga0207702_10388214 | Ga0207702_103882142 | 199 |
| 407 | 3300026089 | Ga0207648_10020652 | Ga0207648_100206525 | 199 |
| 408 | 3300026095 | Ga0207676_10433586 | Ga0207676_104335863 | 199 |
| 409 | 3300026118 | Ga0207675_100008428 | Ga0207675_10000842811 | 199 |
| 410 | 3300026118 | Ga0207675_100356731 | Ga0207675_1003567312 | 199 |
| 411 | 3300026121 | Ga0207683_10031994 | Ga0207683_100319944 | 199 |
| 412 | 3300026121 | Ga0207683_10611532 | Ga0207683_106115322 | 199 |
| 413 | 3300028381 | Ga0268264_10968010 | Ga0268264_109680102 | 199 |
| 414 | 3300031731 | Ga0307405_10194749 | Ga0307405_101947492 | 199 |
| 415 | 3300031995 | Ga0307409_100068664 | Ga0307409_1000686642 | 199 |
| 416 | 3300032002 | Ga0307416_100919909 | Ga0307416_1009199092 | 199 |
| 417 | 3300035089 | Ga0373944_0010639 | Ga0373944_0010639_1127_1765 | 199 |
| 418 | 3300035114 | Ga0373939_0017153 | Ga0373939_0017153_434_1048 | 199 |
| 419 | 3300035116 | Ga0373945_0024109 | Ga0373945_0024109_1414_2052 | 199 |
| 420 | 3300035121 | Ga0373960_0136084 | Ga0373960_0136084_47_661 | 199 |
| 421 | 3300035242 | Ga0373962_0020228 | Ga0373962_0020228_346_960 | 199 |
| 422 | 3300035725 | Ga0373947_0000664 | Ga0373947_0000664_9576_10214 | 199 |
| 423 | 3300037068 | Ga0373925_0020960 | Ga0373925_0020960_851_1489 | 199 |
| 424 | 3300037312 | Ga0395899_0008449 | Ga0395899_0008449_250_888 | 199 |
| 425 | 3300037312 | Ga0395899_0009866 | Ga0395899_0009866_1856_2470 | 199 |
| 426 | 3300037312 | Ga0395899_0021787 | Ga0395899_0021787_1638_2252 | 199 |
| 427 | 3300037312 | Ga0395899_0211076 | Ga0395899_0211076_373_981 | 199 |
| 428 | 3300037418 | Ga0395900_0003572 | Ga0395900_0003572_142_750 | 199 |
| 429 | 3300037418 | Ga0395900_0008866 | Ga0395900_0008866_7944_8558 | 199 |
| 430 | 3300037418 | Ga0395900_0010139 | Ga0395900_0010139_7277_7915 | 199 |
| 431 | 3300037418 | Ga0395900_0861180 | Ga0395900_0861180_197_811 | 199 |
| 432 | 3300037466 | Ga0395898_0001088 | Ga0395898_0001088_27458_28072 | 199 |
| 433 | 3300037466 | Ga0395898_0005269 | Ga0395898_0005269_9440_10048 | 199 |
| 434 | 3300037466 | Ga0395898_0009019 | Ga0395898_0009019_8641_9255 | 199 |
| 435 | 3300037466 | Ga0395898_0081040 | Ga0395898_0081040_2476_3090 | 199 |
| 436 | 3300037466 | Ga0395898_0193798 | Ga0395898_0193798_926_1564 | 199 |
| 437 | 3300037466 | Ga0395898_0313393 | Ga0395898_0313393_471_1085 | 199 |
| 438 | 3300037471 | Ga0395905_0001800 | Ga0395905_0001800_3868_4482 | 199 |
| 439 | 3300037471 | Ga0395905_0011027 | Ga0395905_0011027_5728_6336 | 199 |
| 440 | 3300037471 | Ga0395905_0016912 | Ga0395905_0016912_2383_3021 | 199 |
| 441 | 3300037471 | Ga0395905_0080585 | Ga0395905_0080585_129_743 | 199 |
| 442 | 3300037471 | Ga0395905_0260395 | Ga0395905_0260395_822_1436 | 199 |
| 443 | 3300038443 | Ga0395901_0002285 | Ga0395901_0002285_17001_17615 | 199 |
| 444 | 3300038443 | Ga0395901_0006248 | Ga0395901_0006248_10440_11054 | 199 |
| 445 | 3300038443 | Ga0395901_0014628 | Ga0395901_0014628_2081_2719 | 199 |
| 446 | 3300038443 | Ga0395901_0147824 | Ga0395901_0147824_257_865 | 199 |
| 447 | 3300038443 | Ga0395901_0237416 | Ga0395901_0237416_657_1271 | 199 |
| 448 | 3300038443 | Ga0395901_1352235 | Ga0395901_1352235_11_622 | 199 |
| 449 | 3300039450 | Ga0436363_1254646 | Ga0436363_1254646_371_973 | 199 |
| 450 | 3300042461 | Ga0439460_0053297 | Ga0439460_0053297_523_1137 | 199 |
| 451 | 3300045051 | Ga0451576_0009107 | Ga0451576_0009107_10903_11511 | 199 |
| 452 | 3300045051 | Ga0451576_0156682 | Ga0451576_0156682_1653_2291 | 199 |
| 453 | 3300045051 | Ga0451576_1062406 | Ga0451576_1062406_113_727 | 199 |
| 454 | 3300046455 | Ga0495603_0000219 | Ga0495603_0000219_19455_20093 | 199 |
| 455 | 3300046461 | Ga0495641_0000516 | Ga0495641_0000516_11031_11669 | 199 |
| 456 | 3300046472 | Ga0495580_0105068 | Ga0495580_0105068_276_914 | 199 |
| 457 | 3300046473 | Ga0495582_0027449 | Ga0495582_0027449_548_1162 | 199 |
| 458 | 3300046499 | Ga0495594_0009038 | Ga0495594_0009038_1181_1819 | 199 |
| 459 | 3300046557 | Ga0495622_0020433 | Ga0495622_0020433_1918_2556 | 199 |
| 460 | 3300046674 | Ga0495588_0000660 | Ga0495588_0000660_4065_4703 | 199 |
| 461 | 3300046794 | Ga0495589_0234076 | Ga0495589_0234076_108_746 | 199 |
| 462 | 3300047321 | Ga0495676_0000977 | Ga0495676_0000977_11074_11712 | 199 |
| 463 | 3300048904 | Ga0496101_0321385 | Ga0496101_0321385_40_648 | 199 |
| 464 | 3300048905 | Ga0496102_0037456 | Ga0496102_0037456_1208_1822 | 199 |
| 465 | 3300048905 | Ga0496102_0059615 | Ga0496102_0059615_2616_3224 | 199 |
| 466 | 3300048905 | Ga0496102_0433250 | Ga0496102_0433250_303_917 | 199 |
| 467 | 3300048907 | Ga0496104_0002376 | Ga0496104_0002376_9422_10036 | 199 |
| 468 | 3300048908 | Ga0496105_0082467 | Ga0496105_0082467_942_1556 | 199 |
| 469 | 3300048909 | Ga0496106_0088709 | Ga0496106_0088709_793_1407 | 199 |
| 470 | 3300048909 | Ga0496106_0142310 | Ga0496106_0142310_827_1435 | 199 |
| 471 | 3300048910 | Ga0496107_0023106 | Ga0496107_0023106_3725_4339 | 199 |
| 472 | 3300048910 | Ga0496107_0308008 | Ga0496107_0308008_243_857 | 199 |
| 473 | 3300048911 | Ga0496108_0002438 | Ga0496108_0002438_13432_14046 | 199 |
| 474 | 3300048912 | Ga0496109_0051487 | Ga0496109_0051487_1309_1923 | 199 |
| 475 | 3300048914 | Ga0496111_0003363 | Ga0496111_0003363_2619_3233 | 199 |
| 476 | 3300048915 | Ga0496112_0024000 | Ga0496112_0024000_1367_1981 | 199 |
| 477 | 3300048916 | Ga0496113_0022210 | Ga0496113_0022210_3491_4105 | 199 |
| 478 | 3300048917 | Ga0496114_0167288 | Ga0496114_0167288_1100_1708 | 199 |
| 479 | 3300050508 | nmdc:mga09592_256991_c1 | nmdc:mga09592_256991_c1_403_1017 | 199 |
| 480 | 3300050510 | nmdc:mga06r32_595847_c1 | nmdc:mga06r32_595847_c1_42_656 | 199 |
| 481 | 3300050511 | nmdc:mga08y16_908261_c1 | nmdc:mga08y16_908261_c1_160_774 | 199 |
| 482 | 3300050511 | nmdc:mga08y16_99563_c1 | nmdc:mga08y16_99563_c1_340_954 | 199 |
| 483 | 3300050512 | nmdc:mga0n895_81357_c1 | nmdc:mga0n895_81357_c1_2214_2828 | 199 |
| 484 | 3300050513 | nmdc:mga0rr50_13606_c1 | nmdc:mga0rr50_13606_c1_1571_2185 | 199 |
| 485 | 3300050513 | nmdc:mga0rr50_458260_c1 | nmdc:mga0rr50_458260_c1_394_1008 | 199 |
| 486 | 3300050515 | nmdc:mga0a205_100150_c1 | nmdc:mga0a205_100150_c1_229_843 | 199 |
| 487 | 3300050515 | nmdc:mga0a205_622364_c1 | nmdc:mga0a205_622364_c1_169_783 | 199 |
| 488 | 3300050515 | nmdc:mga0a205_703827_c1 | nmdc:mga0a205_703827_c1_103_717 | 199 |
| 489 | 3300005327 | Ga0070658_10005299 | Ga0070658_100052998 | 200 |
| 490 | 3300005336 | Ga0070680_100017431 | Ga0070680_1000174313 | 200 |
| 491 | 3300005336 | Ga0070680_100225641 | Ga0070680_1002256412 | 200 |
| 492 | 3300005337 | Ga0070682_100195563 | Ga0070682_1001955632 | 200 |
| 493 | 3300005337 | Ga0070682_100278148 | Ga0070682_1002781481 | 200 |
| 494 | 3300005339 | Ga0070660_100002486 | Ga0070660_10000248614 | 200 |
| 495 | 3300005344 | Ga0070661_100037444 | Ga0070661_1000374444 | 200 |
| 496 | 3300005355 | Ga0070671_100440162 | Ga0070671_1004401622 | 200 |
| 497 | 3300005458 | Ga0070681_10045952 | Ga0070681_100459524 | 200 |
| 498 | 3300005458 | Ga0070681_10137226 | Ga0070681_101372261 | 200 |
| 499 | 3300005530 | Ga0070679_100002705 | Ga0070679_1000027059 | 200 |
| 500 | 3300005530 | Ga0070679_100125949 | Ga0070679_1001259493 | 200 |
| 501 | 3300005535 | Ga0070684_100002119 | Ga0070684_10000211912 | 200 |
| 502 | 3300005539 | Ga0068853_100338326 | Ga0068853_1003383262 | 200 |
| 503 | 3300005563 | Ga0068855_100547653 | Ga0068855_1005476532 | 200 |
| 504 | 3300005616 | Ga0068852_100022416 | Ga0068852_1000224163 | 200 |
| 505 | 3300005616 | Ga0068852_100049174 | Ga0068852_1000491743 | 200 |
| 506 | 3300006175 | Ga0070712_100220949 | Ga0070712_1002209493 | 200 |
| 507 | 3300006871 | Ga0075434_100005449 | Ga0075434_1000054499 | 200 |
| 508 | 3300007076 | Ga0075435_100253739 | Ga0075435_1002537392 | 200 |
| 509 | 3300009176 | Ga0105242_10042260 | Ga0105242_100422603 | 200 |
| 510 | 3300013104 | Ga0157370_10227802 | Ga0157370_102278021 | 200 |
| 511 | 3300013297 | Ga0157378_10163855 | Ga0157378_101638552 | 200 |
| 512 | 3300020069 | Ga0197907_11086716 | Ga0197907_110867165 | 200 |
| 513 | 3300020081 | Ga0206354_11233273 | Ga0206354_112332731 | 200 |
| 514 | 3300020082 | Ga0206353_10911104 | Ga0206353_109111043 | 200 |
| 515 | 3300020082 | Ga0206353_10982834 | Ga0206353_109828342 | 200 |
| 516 | 3300025909 | Ga0207705_10114239 | Ga0207705_101142393 | 200 |
| 517 | 3300025912 | Ga0207707_10024618 | Ga0207707_100246186 | 200 |
| 518 | 3300025913 | Ga0207695_10283121 | Ga0207695_102831212 | 200 |
| 519 | 3300025917 | Ga0207660_10043606 | Ga0207660_100436062 | 200 |
| 520 | 3300025917 | Ga0207660_10297483 | Ga0207660_102974832 | 200 |
| 521 | 3300025919 | Ga0207657_10001654 | Ga0207657_1000165417 | 200 |
| 522 | 3300025920 | Ga0207649_10022809 | Ga0207649_100228093 | 200 |
| 523 | 3300025921 | Ga0207652_10199998 | Ga0207652_101999982 | 200 |
| 524 | 3300025929 | Ga0207664_10328858 | Ga0207664_103288582 | 200 |
| 525 | 3300025929 | Ga0207664_10397419 | Ga0207664_103974192 | 200 |
| 526 | 3300025931 | Ga0207644_10258428 | Ga0207644_102584282 | 200 |
| 527 | 3300025949 | Ga0207667_10433592 | Ga0207667_104335922 | 200 |
| 528 | 3300026142 | Ga0207698_10120346 | Ga0207698_101203461 | 200 |
| 529 | 3300028558 | Ga0265326_10047912 | Ga0265326_100479121 | 200 |
| 530 | 3300028563 | Ga0265319_1072983 | Ga0265319_10729832 | 200 |
| 531 | 3300028577 | Ga0265318_10045496 | Ga0265318_100454962 | 200 |
| 532 | 3300028654 | Ga0265322_10010830 | Ga0265322_100108303 | 200 |
| 533 | 3300028800 | Ga0265338_10022159 | Ga0265338_100221596 | 200 |
| 534 | 3300031239 | Ga0265328_10137782 | Ga0265328_101377822 | 200 |
| 535 | 3300031241 | Ga0265325_10063380 | Ga0265325_100633801 | 200 |
| 536 | 3300031247 | Ga0265340_10036305 | Ga0265340_100363052 | 200 |
| 537 | 3300031249 | Ga0265339_10040690 | Ga0265339_100406904 | 200 |
| 538 | 3300031344 | Ga0265316_10017339 | Ga0265316_100173393 | 200 |
| 539 | 3300031595 | Ga0265313_10017169 | Ga0265313_100171693 | 200 |
| 540 | 3300031711 | Ga0265314_10003467 | Ga0265314_100034678 | 200 |
| 541 | 3300031712 | Ga0265342_10041734 | Ga0265342_100417341 | 200 |
| 542 | 3300037471 | Ga0395905_0493651 | Ga0395905_0493651_178_786 | 200 |
| 543 | 3300038443 | Ga0395901_0012213 | Ga0395901_0012213_5264_5872 | 200 |
| 544 | 3300044658 | Ga0466972_0161118 | Ga0466972_0161118_185_793 | 200 |
| 545 | 3300044684 | Ga0466966_0192281 | Ga0466966_0192281_212_823 | 200 |
| 546 | 3300044706 | Ga0466964_0000345 | Ga0466964_0000345_6460_7068 | 200 |
| 547 | 3300044706 | Ga0466964_0019450 | Ga0466964_0019450_1379_1987 | 200 |
| 548 | 3300044719 | Ga0466971_0017308 | Ga0466971_0017308_629_1237 | 200 |
| 549 | 3300044842 | Ga0466957_0017401 | Ga0466957_0017401_1053_1661 | 200 |
| 550 | 3300044901 | Ga0466960_0142140 | Ga0466960_0142140_542_1150 | 200 |
| 551 | 3300045049 | Ga0466959_0016325 | Ga0466959_0016325_4371_4979 | 200 |
| 552 | 3300045836 | Ga0466958_0006066 | Ga0466958_0006066_4871_5479 | 200 |
| 553 | 3300045976 | Ga0466967_0030293 | Ga0466967_0030293_330_938 | 200 |
| 554 | 3300046454 | Ga0495592_0024442 | Ga0495592_0024442_1559_2170 | 200 |
| 555 | 3300046462 | Ga0495651_0015286 | Ga0495651_0015286_2383_2994 | 200 |
| 556 | 3300046463 | Ga0495653_0205608 | Ga0495653_0205608_276_884 | 200 |
| 557 | 3300046476 | Ga0495662_0322933 | Ga0495662_0322933_37_645 | 200 |
| 558 | 3300046477 | Ga0495664_0092676 | Ga0495664_0092676_758_1366 | 200 |
| 559 | 3300046511 | Ga0495608_0332784 | Ga0495608_0332784_251_859 | 200 |
| 560 | 3300046516 | Ga0495628_0273353 | Ga0495628_0273353_347_958 | 200 |
| 561 | 3300046517 | Ga0495630_0050663 | Ga0495630_0050663_85_696 | 200 |
| 562 | 3300046529 | Ga0495652_0446532 | Ga0495652_0446532_143_751 | 200 |
| 563 | 3300046533 | Ga0495640_0058566 | Ga0495640_0058566_486_1097 | 200 |
| 564 | 3300046533 | Ga0495640_0079781 | Ga0495640_0079781_902_1510 | 200 |
| 565 | 3300046535 | Ga0495586_0114377 | Ga0495586_0114377_430_1038 | 200 |
| 566 | 3300046535 | Ga0495586_0126264 | Ga0495586_0126264_768_1379 | 200 |
| 567 | 3300046536 | Ga0495587_0181541 | Ga0495587_0181541_565_1173 | 200 |
| 568 | 3300046559 | Ga0495667_0001711 | Ga0495667_0001711_9588_10199 | 200 |
| 569 | 3300046642 | Ga0495634_0014753 | Ga0495634_0014753_3736_4344 | 200 |
| 570 | 3300046642 | Ga0495634_0042253 | Ga0495634_0042253_304_915 | 200 |
| 571 | 3300046663 | Ga0495635_0092078 | Ga0495635_0092078_1289_1897 | 200 |
| 572 | 3300046663 | Ga0495635_0143391 | Ga0495635_0143391_54_665 | 200 |
| 573 | 3300046675 | Ga0495657_0222989 | Ga0495657_0222989_32_640 | 200 |
| 574 | 3300046678 | Ga0495599_0019441 | Ga0495599_0019441_3356_3967 | 200 |
| 575 | 3300046689 | Ga0495613_0049721 | Ga0495613_0049721_66_677 | 200 |
| 576 | 3300046689 | Ga0495613_0339148 | Ga0495613_0339148_405_1013 | 200 |
| 577 | 3300046809 | Ga0495600_0019857 | Ga0495600_0019857_1578_2186 | 200 |
| 578 | 3300046809 | Ga0495600_0218671 | Ga0495600_0218671_206_814 | 200 |
| 579 | 3300047315 | Ga0495581_0068795 | Ga0495581_0068795_261_872 | 200 |
| 580 | 3300047317 | Ga0495604_0028425 | Ga0495604_0028425_3210_3818 | 200 |
| 581 | 3300047317 | Ga0495604_0066588 | Ga0495604_0066588_1634_2245 | 200 |
| 582 | 3300047319 | Ga0495674_0002208 | Ga0495674_0002208_10527_11138 | 200 |
| 583 | 3300047322 | Ga0495680_0004620 | Ga0495680_0004620_3426_4034 | 200 |
| 584 | 3300047322 | Ga0495680_0030276 | Ga0495680_0030276_261_872 | 200 |
| 585 | 3300047471 | Ga0495684_0013231 | Ga0495684_0013231_2608_3216 | 200 |
| 586 | 3300047471 | Ga0495684_0092468 | Ga0495684_0092468_1392_2003 | 200 |
| 587 | 3300048088 | Ga0495602_0278220 | Ga0495602_0278220_288_896 | 200 |
| 588 | 3300048903 | Ga0496100_0021461 | Ga0496100_0021461_1741_2349 | 200 |
| 589 | 3300048904 | Ga0496101_0000424 | Ga0496101_0000424_26236_26844 | 200 |
| 590 | 3300048904 | Ga0496101_0005214 | Ga0496101_0005214_752_1360 | 200 |
| 591 | 3300048905 | Ga0496102_0003088 | Ga0496102_0003088_11743_12351 | 200 |
| 592 | 3300048905 | Ga0496102_0009838 | Ga0496102_0009838_2148_2756 | 200 |
| 593 | 3300048907 | Ga0496104_0006585 | Ga0496104_0006585_5733_6341 | 200 |
| 594 | 3300048907 | Ga0496104_0555635 | Ga0496104_0555635_141_749 | 200 |
| 595 | 3300048908 | Ga0496105_0000597 | Ga0496105_0000597_8473_9081 | 200 |
| 596 | 3300048909 | Ga0496106_0007641 | Ga0496106_0007641_833_1441 | 200 |
| 597 | 3300048909 | Ga0496106_0014004 | Ga0496106_0014004_2061_2669 | 200 |
| 598 | 3300048910 | Ga0496107_0020310 | Ga0496107_0020310_634_1242 | 200 |
| 599 | 3300048911 | Ga0496108_0010971 | Ga0496108_0010971_5327_5935 | 200 |
| 600 | 3300048912 | Ga0496109_0050646 | Ga0496109_0050646_2186_2794 | 200 |
| 601 | 3300048913 | Ga0496110_0006795 | Ga0496110_0006795_2704_3312 | 200 |
| 602 | 3300048917 | Ga0496114_0000392 | Ga0496114_0000392_16716_17324 | 200 |
| 603 | 3300048917 | Ga0496114_0361573 | Ga0496114_0361573_23_697 | 200 |
| 604 | 3300048918 | Ga0496115_0001999 | Ga0496115_0001999_11743_12351 | 200 |
| 605 | 3300048918 | Ga0496115_0222990 | Ga0496115_0222990_545_1153 | 200 |
| 606 | 3300049590 | Ga0501074_0147796 | Ga0501074_0147796_689_1297 | 200 |
| 607 | 3300053077 | Ga0495601_0026769 | Ga0495601_0026769_2424_3035 | 200 |
| 608 | 3300053085 | Ga0495619_0012550 | Ga0495619_0012550_3241_3849 | 200 |
| 609 | 3300053085 | Ga0495619_0080638 | Ga0495619_0080638_981_1592 | 200 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5fgm-assembly1.cif.gz_A | streptomyces coelicolor sigr region 4 | 0.9324 | 142 | 196 |
| 2o7g-assembly1.cif.gz_A | crystal structure of the pribnow box recognition region of sigc from mycobacterium tuberculosis | 0.9245 | 30 | 106 |
| 4go1-assembly1.cif.gz_B-2 | crystal structure of full length transcription repressor lsrr from e. coli. | 0.917 | 154 | 192 |
| 3vfz-assembly3.cif.gz_A | crystal structure of -35 promoter binding domain of sigd of mycobacterium tuberculosis | 0.9096 | 142 | 200 |
| 6jhe-assembly1.cif.gz_A | crystal structure of bacillus subtilis sigw domain 4 in complexed with -35 element dna | 0.9018 | 150 | 200 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WGH1_1_91_1.10.1740.10 | Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif | 0.9317 | 30 | 106 | 1.10.1740.10 |
| 2o7gB00 | Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif | 0.9278 | 30 | 106 | 1.10.1740.10 |
| 2o7gA00 | Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif | 0.9245 | 30 | 106 | 1.10.1740.10 |
| af_P9WGH7_10_94_1.10.1740.10 | Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif | 0.923 | 30 | 109 | 1.10.1740.10 |
| 4go1B01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.917 | 154 | 192 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538IS04-F1-model_v4 | Sigma-70 family RNA polymerase sigma factor | 0.5688 | 1 | 171 |
GO:0006352
GO:0016987 |
| AF-A0A538IS04-F1-model_v4 | Sigma-70 family RNA polymerase sigma factor | 0.5591 | 1 | 171 |
GO:0006352
GO:0016987 |
| AF-A0A537ZU40-F1-model_v4 | Sigma-70 family RNA polymerase sigma factor | 0.5186 | 5 | 198 |
GO:0003677
GO:0006352 GO:0016987 |
| AF-A0A2E0WEK7-F1-model_v4 | RNA polymerase sigma factor SigM | 0.5175 | 23 | 196 |
GO:0003677
GO:0006352 GO:0016987 |
| AF-A0A7Y2HC62-F1-model_v4 | Sigma-70 family RNA polymerase sigma factor | 0.5149 | 26 | 196 |
GO:0003677
GO:0006352 GO:0016987 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar