F468975

General Info

Members Datasets Scaffolds Average Seq Length
610 498 1220 126

Family's Representative Sequence

Representative Sequence 3300015261|Ga0182006_1024784|Ga0182006_10247842
Length 148
Sequence MAGSGPACKVAAPIFETSMRKLISTGSPFEKTAGYSRAVVQGDWCFVSGTTGYDYATMTMPETVEAQTRNCLATIGKALADGGFDMADVVRAHYYITDQAFVDVVFPILGETFGDIRPAATMIVCQLNKPEMKIEIEVTALRRTAAGS

Samples

Sample ID Description Type Environment
1 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
9 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
29 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
32 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
33 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
34 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
35 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
36 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
56 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
57 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
58 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
59 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
60 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
61 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
64 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
65 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
67 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
68 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
89 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
91 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
92 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
93 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
94 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
95 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
96 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
97 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
98 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
99 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
100 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
101 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
102 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
103 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
104 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
105 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
106 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
107 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
108 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
109 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
110 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
111 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
112 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
113 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
114 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
115 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
116 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
117 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
118 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
119 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
120 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
121 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
122 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
123 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
124 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
125 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
126 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
127 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
128 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
129 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
130 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
131 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
132 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
133 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
134 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
135 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
136 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
137 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
138 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
139 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
140 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
141 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
142 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
143 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
144 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
145 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
146 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
147 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
148 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
149 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
150 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
151 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
152 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
153 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
154 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
155 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
156 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
157 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
158 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
159 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
160 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
161 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
162 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
163 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
177 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
178 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
179 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
180 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
181 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
182 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
183 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
184 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
185 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
188 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
189 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
190 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
191 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
192 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
193 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
194 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
195 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
196 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
197 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
198 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
199 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
200 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
201 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
202 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
203 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
204 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
205 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
206 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
207 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
208 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
209 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
210 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
211 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
212 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
213 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
214 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
215 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
216 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
217 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
218 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
219 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
220 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
222 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
223 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
224 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
225 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
226 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
227 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
228 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
229 2512875024
230 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
231 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
232 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
233 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
234 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
235 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
236 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
237 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
238 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
239 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
240 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
241 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
242 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
243 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
244 2738543024 Aminobacter sp. AP02 Isolate Unclassified
245 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
246 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
247 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
248 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
249 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
250 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
251 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
252 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
253 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
254 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
255 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
256 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
257 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
258 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
259 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
260 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
261 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
262 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
263 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
264 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
265 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
266 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
267 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
268 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
269 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
270 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
271 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
272 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
273 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
274 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
275 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
276 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
277 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
278 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
279 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
280 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
281 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
282 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
283 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
284 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
285 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
286 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
287 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
288 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
289 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
290 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
291 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
292 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
293 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
294 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
295 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
296 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
297 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
298 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
299 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
300 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
301 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
302 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
303 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
304 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
305 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
306 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
307 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
308 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
309 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
310 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
311 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
312 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
313 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
314 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
315 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
316 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
317 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
318 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
319 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
320 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
321 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
322 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
323 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
324 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
325 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
326 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
327 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
328 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
329 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
330 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
331 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
332 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
333 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
334 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
335 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
336 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
337 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
338 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
339 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
340 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
341 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
342 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
343 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
344 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
345 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
346 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
347 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
348 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
349 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
350 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
351 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
352 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
353 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
354 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
355 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
356 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
357 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
358 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
359 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
360 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
361 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
362 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
363 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
364 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
365 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
366 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
367 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
368 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
369 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
370 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
371 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
372 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
373 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
374 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
375 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
376 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
377 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
378 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
379 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
380 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
381 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
382 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
383 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
384 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
385 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
386 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
387 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
388 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
389 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
390 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
391 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
392 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
393 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
394 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
395 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
396 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
397 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
398 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
399 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
400 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
401 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
402 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
403 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
404 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
405 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
406 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
407 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
408 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
409 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
410 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
411 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
412 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
413 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
414 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
415 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
416 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
417 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
418 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
419 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
420 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
421 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
422 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
423 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
424 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
425 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
426 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
427 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
428 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
429 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
430 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
431 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
432 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
433 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
434 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
435 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
436 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
437 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
438 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
439 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
440 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
441 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
442 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
443 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
444 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
445 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
446 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
447 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
448 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
449 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
450 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
451 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
452 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
453 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
454 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
455 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
456 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
457 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
458 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
459 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
460 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
461 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
462 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
463 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
464 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
465 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
466 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
467 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
468 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
469 3004167301 Mesorhizobium loti 582 Isolate Unclassified
470 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
471 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
472 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
473 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
474 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
475 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
476 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
477 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
478 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
479 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
480 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
481 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
482 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
483 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
484 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
485 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
486 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
487 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
488 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
489 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
490 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
491 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
492 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
493 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
494 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
495 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
496 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
497 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
498 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 54.1
Metatranscriptomes 0.16
Isolates 45.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.8
Nodule 40.16
Rhizoplane 4.1
Rhizosphere 35.74
Stem 0
Stem Tuber 0
Unclassified 1.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0182006_1024784 3300015261 Bacteria 2471
2 JGI24740J21852_10156652 3300001979 Bacteria 565
3 JGI25156J39149_1008981 3300002705 Bacteria 2468
4 JGI25157J39369_1003567 3300002741 Bacteria 3120
5 JGI25151J46595_10057929 3300003187 Bacteria 1259
6 JGI25406J46586_10037116 3300003203 Bacteria 1761
7 JGI25165J46597_1000052 3300003214 Bacteria 236064
8 Ga0055542_1000651 3300003762 Bacteria 28655
9 Ga0055529_1006363 3300003763 Bacteria 1655
10 Ga0055526_1000509 3300003771 Bacteria 30962
11 Ga0055524_1011546 3300003775 Bacteria 3450
12 Ga0065712_10697790 3300005290 Bacteria 548
13 Ga0065715_10134556 3300005293 Bacteria 1953
14 Ga0070668_100469229 3300005347 Bacteria 1085
15 Ga0070669_100951943 3300005353 Bacteria 735
16 Ga0070659_100525205 3300005366 Bacteria 1011
17 Ga0070694_100105764 3300005444 Bacteria 1998
18 Ga0070697_101704848 3300005536 Bacteria 564
19 Ga0068853_100281794 3300005539 Bacteria 1532
20 Ga0070665_100020141 3300005548 Bacteria 6698
21 Ga0070665_100070744 3300005548 Bacteria 3496
22 Ga0070665_100502459 3300005548 Bacteria 1224
23 Ga0068855_100646085 3300005563 Bacteria 1137
24 Ga0068855_102239198 3300005563 Bacteria 548
25 Ga0068857_101308126 3300005577 Bacteria 704
26 Ga0068854_100600273 3300005578 Bacteria 940
27 Ga0068854_100878469 3300005578 Bacteria 787
28 Ga0068856_100537717 3300005614 Bacteria 1190
29 Ga0068864_100594719 3300005618 Bacteria 1073
30 Ga0068851_10854887 3300005834 Bacteria 568
31 Ga0081455_10039042 3300005937 Bacteria 4199
32 Ga0081455_10074211 3300005937 Bacteria 2810
33 Ga0081455_10503223 3300005937 Bacteria 813
34 Ga0081540_1017126 3300005983 Bacteria 4499
35 Ga0081539_10002395 3300005985 Bacteria 26644
36 Ga0075365_10325583 3300006038 Bacteria 1082
37 Ga0075365_10774177 3300006038 Bacteria 677
38 Ga0075368_10011121 3300006042 Bacteria 3270
39 Ga0075368_10023099 3300006042 Bacteria 2372
40 Ga0075363_100094514 3300006048 Bacteria 1648
41 Ga0075363_100114728 3300006048 Bacteria 1500
42 Ga0075364_10270204 3300006051 Bacteria 1156
43 Ga0075364_10329002 3300006051 Bacteria 1041
44 Ga0075364_10400294 3300006051 Bacteria 937
45 Ga0075364_10745401 3300006051 Bacteria 668
46 Ga0075367_10093284 3300006178 Bacteria 1833
47 Ga0075367_10095571 3300006178 Bacteria 1812
48 Ga0075369_10030334 3300006186 Bacteria 2276
49 Ga0075370_10050626 3300006353 Bacteria 2356
50 Ga0075370_10319284 3300006353 Bacteria 925
51 Ga0075434_100098377 3300006871 Bacteria 2931
52 Ga0068865_100586303 3300006881 Bacteria 941
53 Ga0105240_10058351 3300009093 Bacteria 4818
54 Ga0105247_10461842 3300009101 Bacteria 917
55 Ga0105243_10475923 3300009148 Bacteria 1178
56 Ga0105241_10076906 3300009174 Bacteria 2604
57 Ga0105241_10344400 3300009174 Bacteria 1292
58 Ga0105237_10201491 3300009545 Bacteria 1990
59 Ga0105237_10409254 3300009545 Bacteria 1361
60 Ga0105237_11449049 3300009545 Bacteria 693
61 Ga0105237_11535523 3300009545 Bacteria 673
62 Ga0105238_10430035 3300009551 Bacteria 1316
63 Ga0105238_11735832 3300009551 Bacteria 656
64 Ga0105249_10107933 3300009553 Bacteria 2627
65 Ga0105239_10102611 3300010375 Bacteria 3165
66 Ga0105239_10390386 3300010375 Bacteria 1574
67 Ga0105239_10433082 3300010375 Bacteria 1491
68 Ga0105239_10716877 3300010375 Bacteria 1144
69 Ga0105246_10132653 3300011119 Bacteria 1863
70 Ga0105246_11325553 3300011119 Bacteria 668
71 Ga0157370_10509334 3300013104 Bacteria 1105
72 Ga0157369_10417196 3300013105 Bacteria 1392
73 Ga0157374_11779210 3300013296 Bacteria 641
74 Ga0157378_11083338 3300013297 Bacteria 838
75 Ga0163162_11622615 3300013306 Bacteria 738
76 Ga0163163_10381752 3300014325 Bacteria 1466
77 Ga0157376_10327396 3300014969 Bacteria 1459
78 Ga0157376_11436460 3300014969 Unclassified 722
79 Ga0182007_10112892 3300015262 Bacteria 905
80 Ga0213873_10160866 3300021358 Bacteria 680
81 Ga0213872_10051689 3300021361 Bacteria 1865
82 Ga0213871_10294679 3300021441 Unclassified 523
83 Ga0209646_1014908 3300025246 Bacteria 1165
84 Ga0209026_1000032 3300025250 Bacteria 322378
85 Ga0209677_116251 3300025253 Bacteria 957
86 Ga0209148_1000111 3300025254 Bacteria 198095
87 Ga0209759_1000495 3300025256 Bacteria 43378
88 Ga0209233_1000118 3300025261 Bacteria 236172
89 Ga0209233_1006482 3300025261 Bacteria 3766
90 Ga0209455_1000201 3300025272 Bacteria 86804
91 Ga0209025_1024248 3300025294 Bacteria 3138
92 Ga0209758_1090387 3300025297 Bacteria 898
93 Ga0209256_1000266 3300025299 Bacteria 92357
94 Ga0207647_10215213 3300025904 Bacteria 1108
95 Ga0207647_10471164 3300025904 Bacteria 702
96 Ga0207705_10562494 3300025909 Bacteria 886
97 Ga0207654_10522602 3300025911 Bacteria 840
98 Ga0207654_10591985 3300025911 Bacteria 791
99 Ga0207695_10092828 3300025913 Bacteria 3028
100 Ga0207695_11446107 3300025913 Bacteria 568
101 Ga0207671_10116155 3300025914 Bacteria 2041
102 Ga0207671_10310210 3300025914 Bacteria 1247
103 Ga0207671_10397466 3300025914 Bacteria 1096
104 Ga0207671_10492120 3300025914 Bacteria 978
105 Ga0207657_10120534 3300025919 Bacteria 2158
106 Ga0207681_11481335 3300025923 Bacteria 569
107 Ga0207694_10670254 3300025924 Bacteria 874
108 Ga0207644_11091291 3300025931 Bacteria 671
109 Ga0207690_10967194 3300025932 Bacteria 708
110 Ga0207689_11146238 3300025942 Bacteria 655
111 Ga0207667_10495629 3300025949 Bacteria 1239
112 Ga0207668_10289650 3300025972 Bacteria 1347
113 Ga0207640_11875689 3300025981 Bacteria 542
114 Ga0207658_10224355 3300025986 Bacteria 1583
115 Ga0207677_11036102 3300026023 Bacteria 745
116 Ga0207639_10491081 3300026041 Bacteria 1120
117 Ga0207639_11368316 3300026041 Bacteria 664
118 Ga0207702_10973371 3300026078 Bacteria 841
119 Ga0207702_10981779 3300026078 Bacteria 838
120 Ga0207674_10543236 3300026116 Bacteria 1123
121 Ga0209813_10111017 3300027866 Bacteria 944
122 Ga0268266_10013310 3300028379 Bacteria 7090
123 Ga0268266_10195524 3300028379 Bacteria 1848
124 Ga0268266_11263763 3300028379 Bacteria 713
125 Ga0307515_10003402 3300028794 Bacteria 33496
126 Ga0307513_11076804 3300031456 Bacteria 515
127 Ga0307408_100176837 3300031548 Bacteria 1708
128 Ga0307408_100790960 3300031548 Bacteria 860
129 Ga0307508_10000125 3300031616 Bacteria 91829
130 Ga0307406_10006876 3300031901 Bacteria 6298
131 Ga0307406_10307959 3300031901 Bacteria 1220
132 Ga0307412_10133911 3300031911 Bacteria 1805
133 Ga0307412_10253496 3300031911 Bacteria 1368
134 Ga0307412_10337524 3300031911 Bacteria 1205
135 Ga0307412_10426817 3300031911 Bacteria 1086
136 Ga0307412_11062000 3300031911 Bacteria 719
137 Ga0307412_11102849 3300031911 Bacteria 706
138 Ga0307409_101510054 3300031995 Bacteria 699
139 Ga0307416_103289128 3300032002 Bacteria 541
140 Ga0316584_0096449 3300036712 Bacteria 2214
141 Ga0373925_0476306 3300037068 Bacteria 1024
142 Ga0395899_0522602 3300037312 Bacteria 767
143 Ga0395900_0127024 3300037418 Bacteria 2615
144 Ga0395900_0420720 3300037418 Bacteria 1297
145 Ga0395900_1889166 3300037418 Bacteria 508
146 Ga0395898_0086749 3300037466 Bacteria 3016
147 Ga0395898_0563361 3300037466 Bacteria 1082
148 Ga0395905_0083575 3300037471 Bacteria 2991
149 Ga0395905_0122021 3300037471 Bacteria 2450
150 Ga0395905_0138810 3300037471 Bacteria 2287
151 Ga0395905_0548405 3300037471 Bacteria 1057
152 Ga0395905_0616104 3300037471 Bacteria 987
153 Ga0395905_0769216 3300037471 Bacteria 866
154 Ga0395901_0106352 3300038443 Bacteria 2945
155 Ga0395901_0220636 3300038443 Bacteria 1982
156 Ga0395901_0753171 3300038443 Bacteria 967
157 Ga0436360_0115943 3300039438 Bacteria 3206
158 Ga0436360_0723218 3300039438 Bacteria 1198
159 Ga0436360_0954271 3300039438 Bacteria 1386
160 Ga0436360_1010740 3300039438 Bacteria 607
161 Ga0436360_1077079 3300039438 Bacteria 848
162 Ga0436361_0332511 3300039447 Bacteria 930
163 Ga0436361_0601876 3300039447 Bacteria 2274
164 Ga0436361_0977274 3300039447 Bacteria 7056
165 Ga0436363_0845733 3300039450 Bacteria 930
166 Ga0436362_0307133 3300039453 Bacteria 1485
167 Ga0439465_0233341 3300041413 Bacteria 677
168 Ga0451793_0488867 3300041452 Bacteria 636
169 Ga0451797_0773066 3300041453 Bacteria 624
170 Ga0451798_0494404 3300041458 Bacteria 583
171 Ga0451802_1611693 3300041460 Bacteria 612
172 Ga0451807_1693925 3300041486 Bacteria 549
173 Ga0466972_0076561 3300044658 Bacteria 1593
174 Ga0466971_0141068 3300044719 Bacteria 1122
175 Ga0466960_0115201 3300044901 Bacteria 1401
176 Ga0466959_0051864 3300045049 Bacteria 3006
177 Ga0451576_0036894 3300045051 Bacteria 5179
178 Ga0466958_0460408 3300045836 Bacteria 824
179 Ga0495590_0374083 3300046457 Bacteria 544
180 Ga0495638_0010018 3300046460 Bacteria 6609
181 Ga0495606_0217079 3300046507 Bacteria 1080
182 Ga0495616_0094800 3300046513 Bacteria 1408
183 Ga0495618_0507380 3300046514 Unclassified 726
184 Ga0495620_0159208 3300046515 Bacteria 878
185 Ga0495620_0324135 3300046515 Bacteria 585
186 Ga0495628_0060445 3300046516 Bacteria 2973
187 Ga0495637_0208682 3300046520 Bacteria 715
188 Ga0495652_0198613 3300046529 Bacteria 1524
189 Ga0495633_0100793 3300046558 Bacteria 1340
190 Ga0495668_0051636 3300046616 Bacteria 2276
191 Ga0495668_0295616 3300046616 Bacteria 888
192 Ga0495634_0362615 3300046642 Unclassified 866
193 Ga0495625_0328456 3300046660 Bacteria 972
194 Ga0495625_0367504 3300046660 Bacteria 905
195 Ga0495661_0541279 3300046665 Bacteria 552
196 Ga0495599_0098928 3300046678 Bacteria 1818
197 Ga0495613_0551304 3300046689 Bacteria 771
198 Ga0495660_0105703 3300046810 Bacteria 1443
199 Ga0495636_0348355 3300047318 Bacteria 699
200 Ga0495674_0103857 3300047319 Bacteria 2416
201 Ga0495672_0046136 3300047320 Bacteria 2601
202 Ga0495687_062038 3300047443 Bacteria 1536
203 Ga0495602_0571662 3300048088 Bacteria 781
204 Ga0495602_0599070 3300048088 Bacteria 758
205 Ga0495626_0215798 3300048091 Bacteria 781
206 Ga0496100_0719225 3300048903 Unclassified 780
207 Ga0496101_0280737 3300048904 Bacteria 1302
208 Ga0496102_0476767 3300048905 Bacteria 1169
209 Ga0496102_0967303 3300048905 Bacteria 772
210 Ga0496103_0232974 3300048906 Bacteria 1185
211 Ga0496104_0073533 3300048907 Bacteria 3252
212 Ga0496104_1644514 3300048907 Bacteria 545
213 Ga0496108_0346671 3300048911 Bacteria 1296
214 Ga0496109_0482839 3300048912 Bacteria 1170
215 Ga0496110_0278227 3300048913 Bacteria 1524
216 Ga0496110_1190303 3300048913 Bacteria 671
217 Ga0496112_0460542 3300048915 Bacteria 1209
218 Ga0496113_0214211 3300048916 Bacteria 1534
219 Ga0496114_0404520 3300048917 Bacteria 1209
220 Ga0496114_0513631 3300048917 Bacteria 1060
221 Ga0496114_0741690 3300048917 Bacteria 859
222 Ga0496115_0068971 3300048918 Bacteria 2863
223 Ga0496115_0361972 3300048918 Bacteria 1182
224 Ga0496117_0497482 3300048920 Bacteria 592
225 Ga0496118_0046019 3300048921 Bacteria 3399
226 Ga0496119_0117480 3300048922 Bacteria 1466
227 Ga0496119_0267946 3300048922 Bacteria 854
228 Ga0496119_0286440 3300048922 Bacteria 817
229 Ga0496120_0087517 3300048923 Bacteria 1672
230 Ga0496120_0127976 3300048923 Bacteria 1304
231 Ga0496120_0252558 3300048923 Bacteria 827
232 Ga0496121_0246743 3300048924 Bacteria 1241
233 Ga0496121_0453765 3300048924 Bacteria 825
234 Ga0496124_0003251 3300048927 Bacteria 20064
235 Ga0496126_0000258 3300048929 Bacteria 113843
236 Ga0496126_0245785 3300048929 Bacteria 1493
237 Ga0496126_0773470 3300048929 Bacteria 739
238 Ga0501031_0033166 3300049568 Bacteria 3367
239 Ga0501031_0049680 3300049568 Bacteria 2733
240 Ga0501032_0037853 3300049569 Bacteria 3287
241 Ga0501032_0773555 3300049569 Bacteria 607
242 Ga0501033_0036862 3300049570 Bacteria 3662
243 Ga0501033_0399756 3300049570 Bacteria 958
244 Ga0501034_0000702 3300049571 Bacteria 50840
245 Ga0501034_0001206 3300049571 Bacteria 35489
246 Ga0501034_0016581 3300049571 Bacteria 7553
247 Ga0501034_0186478 3300049571 Bacteria 2037
248 Ga0501034_0245747 3300049571 Bacteria 1734
249 Ga0501034_1699887 3300049571 Bacteria 503
250 Ga0501036_0108327 3300049572 Bacteria 2348
251 Ga0501037_0085576 3300049573 Bacteria 2282
252 Ga0501038_0157440 3300049574 Bacteria 1848
253 Ga0501039_0074313 3300049575 Bacteria 2641
254 Ga0501039_0206201 3300049575 Bacteria 1546
255 Ga0501040_0126182 3300049576 Bacteria 1798
256 Ga0501042_0030016 3300049578 Bacteria 3838
257 Ga0501043_0146535 3300049579 Bacteria 1848
258 Ga0501043_1066545 3300049579 Bacteria 572
259 Ga0501046_0172438 3300049580 Bacteria 1622
260 Ga0501046_0781589 3300049580 Bacteria 670
261 Ga0501047_0028722 3300049581 Bacteria 5363
262 Ga0501047_0593730 3300049581 Bacteria 929
263 Ga0501067_0317417 3300049583 Bacteria 868
264 Ga0501069_0261969 3300049585 Bacteria 1010
265 Ga0501070_0006133 3300049586 Bacteria 10248
266 Ga0501070_0819224 3300049586 Bacteria 730
267 Ga0501071_0419394 3300049587 Bacteria 1023
268 Ga0501071_0493065 3300049587 Bacteria 939
269 Ga0501072_0120807 3300049588 Bacteria 2088
270 Ga0501074_0162689 3300049590 Bacteria 1594
271 Ga0501079_0545194 3300049741 Bacteria 912
272 Ga0501083_0421296 3300049744 Bacteria 869
273 Ga0501241_129059 3300049758 Bacteria 568
274 Ga0501035_0063116 3300049822 Bacteria 3295
275 Ga0501035_0124520 3300049822 Bacteria 2250
276 Ga0501044_0034369 3300049823 Bacteria 5316
277 Ga0501044_0115739 3300049823 Bacteria 2687
278 Ga0501044_0474394 3300049823 Bacteria 1155
279 Ga0501045_0141141 3300049824 Bacteria 1791
280 Ga0501045_0183635 3300049824 Bacteria 1558
281 nmdc:mga03683_399584_c1 3300050489 Bacteria 656
282 nmdc:mga03n38_119597_c1 3300050490 Bacteria 1293
283 nmdc:mga03n38_603397_c1 3300050490 Bacteria 625
284 nmdc:mga03n38_91037_c1 3300050490 Bacteria 1452
285 nmdc:mga00v17_126583_c1 3300050491 Bacteria 1630
286 nmdc:mga00v17_273348_c1 3300050491 Bacteria 1096
287 nmdc:mga0yw44_112662_c1 3300050492 Bacteria 1745
288 nmdc:mga0yw44_114602_c1 3300050492 Bacteria 1730
289 nmdc:mga0yw44_215253_c1 3300050492 Bacteria 1272
290 nmdc:mga0yw44_485886_c1 3300050492 Bacteria 838
291 nmdc:mga0yw44_676645_c1 3300050492 Bacteria 701
292 nmdc:mga0yw44_940781_c1 3300050492 Bacteria 586
293 nmdc:mga06z11_203910_c1 3300050494 Bacteria 1150
294 nmdc:mga06z11_210047_c1 3300050494 Bacteria 1134
295 nmdc:mga04h51_108655_c1 3300050495 Bacteria 1020
296 nmdc:mga04h51_131639_c1 3300050495 Bacteria 941
297 nmdc:mga04h51_38878_c1 3300050495 Bacteria 1543
298 nmdc:mga07m45_300388_c1 3300050496 Bacteria 934
299 nmdc:mga07m45_496408_c1 3300050496 Bacteria 707
300 nmdc:mga05p37_1301470_c1 3300050507 Bacteria 741
301 nmdc:mga0n895_288503_c1 3300050512 Bacteria 1664
302 nmdc:mga08x19_115892_c1 3300050514 Bacteria 1791
303 nmdc:mga0sz30_83131_c1 3300050516 Bacteria 1387
304 Ga0495601_0001178 3300053077 Bacteria 14287
305 Ga0495601_0357821 3300053077 Bacteria 949
306 Ga0495655_0348501 3300053083 Bacteria 518
307 Ga0495595_0076771 3300053084 Bacteria 1586
308 Ga0500643_227327 3300053087 Bacteria 501
309 Ga0500644_0008243 3300053088 Bacteria 2745
310 Ga0500593_000257 3300053117 Bacteria 21760
311 Ga0500594_0081574 3300053118 Bacteria 968
312 Ga0500595_142761 3300053119 Bacteria 671
313 Ga0500597_000871 3300053120 Bacteria 6983
314 Ga0500608_013457 3300053122 Bacteria 3629
315 Ga0500658_0053164 3300053134 Bacteria 1661
316 Ga0500568_0000005 3300053139 Bacteria 614296
317 Ga0500568_0000131 3300053139 Bacteria 67970
318 Ga0500577_0248955 3300053142 Unclassified 772
319 Ga0500604_0162451 3300053151 Bacteria 761
320 Ga0500616_0025858 3300053153 Bacteria 3254
321 Ga0500616_0334673 3300053153 Bacteria 620
322 Ga0500620_002799 3300053155 Bacteria 3604
323 Ga0500622_0000037 3300053156 Bacteria 179427
324 Ga0500624_000081 3300053157 Bacteria 49492
325 Ga0500624_025103 3300053157 Bacteria 989
326 Ga0500627_0408013 3300053158 Bacteria 578
327 Ga0500637_0000234 3300053178 Bacteria 20673
328 Ga0500637_0412238 3300053178 Unclassified 698
329 Ga0500611_007535 3300053727 Bacteria 1640
330 Ga0587107_094343 3300059652 Bacteria 583
331 Ga0466962_0402396 3300061719 Bacteria 686
332 2503198964 2503198000 Bacteria 6884444
333 2509118206 2508501123 Bacteria 6283661
334 2509143141 2508501127 Bacteria 7037543
335 2509371465 2509276018 Bacteria 6910194
336 2509393947 2509276022 Bacteria 6200534
337 2510318408 2510065059 Bacteria 6847884
338 2512933640 2512875016 Bacteria 6529530
339 2512961786 2512875024 Bacteria 7195110
340 2513613388 2513237090 Bacteria 7096802
341 2514035537 2513237164 Bacteria 7563725
342 2514419605 2513237305 Bacteria 7293571
343 2514586589 2513237351 Bacteria 6968952
344 2588519719 2588253730 Bacteria 6881675
345 2599938772 2599185301 Bacteria 6161860
346 2643988582 2643221595 Bacteria 6565519
347 2644130745 2643221623 Bacteria 5239945
348 2644154501 2643221627 Bacteria 6761570
349 2671121098 2667528175 Bacteria 7532676
350 2688596241 2687453392 Bacteria 6880454
351 2694627625 2693429783 Bacteria 7019804
352 2694636736 2693429784 Bacteria 7241525
353 2723573365 2721755686 Bacteria 7343952
354 2739305918 2738543024 Bacteria 5603683
355 2756673630 2756170246 Bacteria 7451806
356 2792747481 2791355123 Bacteria 8049106
357 2841736655 2841734538 Bacteria 6784580
358 2842926363 2842922631 Bacteria 5824079
359 2844003192 2844002411 Bacteria 7168230
360 2844011068 2844009547 Bacteria 6728125
361 2847673699 2847670302 Bacteria 6165597
362 2847690177 2847686936 Bacteria 6278406
363 2856318876 2856314179 Bacteria 6477897
364 2856327108 2856320880 Bacteria 7263508
365 2856329522 2856328259 Bacteria 6528202
366 2856340547 2856334872 Bacteria 7037011
367 2856354439 2856349417 Bacteria 6230045
368 2856357243 2856356410 Bacteria 6297484
369 2856365135 2856364286 Bacteria 6939991
370 2857353191 2857349434 Bacteria 7926032
371 2857371608 2857367948 Bacteria 6965560
372 2869166813 2869162929 Bacteria 6399702
373 2869174226 2869169390 Bacteria 6659796
374 2869238338 2869234852 Bacteria 6654993
375 2869247084 2869242130 Bacteria 6609239
376 2869251148 2869249662 Bacteria 6868783
377 2869256971 2869256925 Bacteria 6981691
378 2869269165 2869264136 Bacteria 6880765
379 2869278057 2869271264 Bacteria 6908218
380 2869279661 2869278585 Bacteria 7077053
381 2869286241 2869285874 Bacteria 6901219
382 2871430210 2871429161 Bacteria 6547891
383 2871441153 2871435913 Bacteria 6880295
384 2871446565 2871444079 Bacteria 6423508
385 2871456598 2871451962 Bacteria 7336357
386 2871464684 2871459585 Bacteria 6866887
387 2871467960 2871466892 Bacteria 6923287
388 2871475197 2871474448 Bacteria 6806570
389 2871482624 2871481445 Bacteria 6700002
390 2871492938 2871488783 Bacteria 6929816
391 2871500301 2871495908 Bacteria 6935695
392 2874108323 2874102143 Bacteria 6342645
393 2874112745 2874109183 Bacteria 6517025
394 2874116945 2874116593 Bacteria 6674494
395 2874136300 2874131515 Bacteria 6820270
396 2874139348 2874139085 Bacteria 7021506
397 2874146625 2874146452 Bacteria 7533118
398 2874155701 2874155637 Bacteria 6724144
399 2874167326 2874162495 Bacteria 6174670
400 2874170606 2874168670 Bacteria 8062617
401 2876364105 2876363079 Bacteria 6544991
402 2876383851 2876377896 Bacteria 6565995
403 2876387789 2876386047 Bacteria 6698674
404 2876399152 2876392853 Bacteria 6660880
405 2876404613 2876399893 Bacteria 6927900
406 2876407632 2876406927 Bacteria 6191900
407 2876414030 2876413966 Bacteria 6831344
408 2876426543 2876420981 Bacteria 6687741
409 2878039192 2878035449 Bacteria 6555736
410 2878733018 2878730984 Bacteria 6380721
411 2878742189 2878738818 Bacteria 7136951
412 2878746406 2878745973 Bacteria 6867388
413 2878754728 2878753008 Bacteria 6922523
414 2878764401 2878760144 Bacteria 6823465
415 2878771493 2878767105 Bacteria 6898628
416 2878777250 2878774303 Bacteria 6108671
417 2878781930 2878781027 Bacteria 6834456
418 2878795657 2878788777 Bacteria 6567085
419 2881148458 2881147464 Bacteria 7779814
420 2881159541 2881155292 Bacteria 6461656
421 2881165245 2881161766 Bacteria 7127907
422 2881848145 2881845957 Bacteria 6611900
423 2881857355 2881853255 Bacteria 6698367
424 2881868578 2881861095 Bacteria 7128710
425 2882640431 2882632389 Bacteria 8154593
426 2882916042 2882912400 Bacteria 6801539
427 2885307109 2885305155 Bacteria 7348390
428 2885313882 2885312484 Bacteria 6415165
429 2885320846 2885318864 Bacteria 6729568
430 2885329821 2885326080 Bacteria 7134805
431 2885341762 2885334103 Bacteria 7216818
432 2885350199 2885342637 Bacteria 7011821
433 2885354182 2885350715 Bacteria 6787678
434 2888343640 2888337043 Bacteria 6629336
435 2888344641 2888343758 Bacteria 6611049
436 2888353453 2888350351 Bacteria 7372807
437 2889015166 2889010040 Bacteria 6749192
438 2889019751 2889016732 Bacteria 6700763
439 2889795759 2889790730 Bacteria 5689708
440 2889916404 2889914905 Bacteria 5702301
441 2903453792 2903448605 Bacteria 7357801
442 2903493989 2903492973 Bacteria 13473544
443 2903499885 2903492973 Bacteria 13473544
444 2903516801 2903513507 Bacteria 6344008
445 2903525735 2903521522 Bacteria 6525694
446 2903532718 2903528002 Bacteria 6586099
447 2903545114 2903540706 Bacteria 7062119
448 2904665679 2904659560 Bacteria 6685615
449 2906308807 2906308376 Bacteria 6841989
450 2906322087 2906321335 Bacteria 6579571
451 2906333965 2906328253 Bacteria 6585166
452 2906361065 2906354277 Bacteria 6991324
453 2906369499 2906363423 Bacteria 6856682
454 2906373135 2906370794 Bacteria 6881062
455 2906383653 2906378014 Bacteria 6911440
456 2906390279 2906386501 Bacteria 5977019
457 2906401226 2906393657 Bacteria 6790866
458 2906407496 2906401398 Bacteria 6693206
459 2906410624 2906408224 Bacteria 6162342
460 2906418946 2906414383 Bacteria 6580790
461 2906434009 2906427513 Bacteria 6375796
462 2922136724 2922130491 Bacteria 7173936
463 2922151633 2922151315 Bacteria 6902399
464 2922159492 2922158528 Bacteria 6573167
465 2922173180 2922172374 Bacteria 6167644
466 2922180576 2922178524 Bacteria 6025201
467 2922186063 2922185730 Bacteria 7113964
468 2924717498 2924710171 Bacteria 6752351
469 2924720927 2924718760 Bacteria 6331356
470 2924728284 2924726620 Bacteria 6271473
471 2924733413 2924733363 Bacteria 7574837
472 2924747405 2924741084 Bacteria 6661321
473 2924754086 2924748358 Bacteria 6154725
474 2924756077 2924754689 Bacteria 6774424
475 2924768533 2924762789 Bacteria 6561353
476 2924779873 2924776078 Bacteria 7492003
477 2924790948 2924784321 Bacteria 7416538
478 2937822145 2937813078 Bacteria 7783518
479 2937823517 2937822353 Bacteria 7290551
480 2937839293 2937836603 Bacteria 6811263
481 2937854623 2937848649 Bacteria 6983481
482 2937868529 2937861824 Bacteria 6660327
483 2937869344 2937868953 Bacteria 6639878
484 2937880541 2937877337 Bacteria 7246526
485 2937894867 2937891427 Bacteria 6357007
486 2937974170 2937972304 Bacteria 7532020
487 2937982947 2937980651 Bacteria 6517427
488 2937998961 2937994558 Bacteria 7036190
489 2938015993 2938014810 Bacteria 6700592
490 2958035238 2958034702 Bacteria 6989922
491 2958042666 2958041894 Bacteria 13082850
492 2958044270 2958041894 Bacteria 13082850
493 2958065615 2958064165 Bacteria 7158582
494 2958072430 2958071322 Bacteria 6815895
495 2958087674 2958084443 Bacteria 7312792
496 2958103300 2958100919 Bacteria 6800575
497 2958108272 2958108152 Bacteria 6681128
498 2958120349 2958115193 Bacteria 6923548
499 2958130259 2958122699 Bacteria 7280457
500 2958130640 2958130278 Bacteria 6897202
501 2958140685 2958137437 Bacteria 6050276
502 2958150271 2958144490 Bacteria 6677056
503 2958160144 2958158011 Bacteria 6058449
504 2958169435 2958165035 Bacteria 6906348
505 2958176674 2958172287 Bacteria 6716688
506 2958179978 2958179912 Bacteria 6874908
507 2961077805 2961077736 Bacteria 7079850
508 2961121022 2961114664 Bacteria 6680456
509 2961135415 2961127735 Bacteria 7196641
510 2961136852 2961136820 Bacteria 6775228
511 2961167896 2961163497 Bacteria 6901077
512 2961173894 2961170736 Bacteria 7072258
513 2961185040 2961183825 Bacteria 6688536
514 2963645563 2963644680 Bacteria 6530403
515 2965022715 2965018300 Bacteria 6883036
516 2965026724 2965025482 Bacteria 6532201
517 2965033469 2965032056 Bacteria 6887443
518 2965043014 2965040258 Bacteria 6855979
519 2965054718 2965047637 Bacteria 6623551
520 2965062452 2965062239 Bacteria 7412989
521 2965091628 2965089291 Bacteria 6866420
522 2965107460 2965102966 Bacteria 6800987
523 2965123105 2965119406 Bacteria 6956431
524 2968000071 2967996073 Bacteria 6787468
525 2968006956 2968003550 Bacteria 6929263
526 2968023658 2968016561 Bacteria 7022047
527 2968085102 2968083720 Bacteria 7351627
528 2968093460 2968091066 Bacteria 6052692
529 2968098112 2968097103 Bacteria 6107094
530 2968117172 2968110612 Bacteria 6814636
531 2968122406 2968117919 Bacteria 6536078
532 2968129582 2968128360 Bacteria 6270294
533 2968145222 2968138860 Bacteria 6605449
534 2968176297 2968171901 Bacteria 6894245
535 2970476240 2970469710 Bacteria 6969209
536 2970493836 2970489779 Bacteria 6517260
537 2970506439 2970503327 Bacteria 7099517
538 2970512216 2970510686 Bacteria 7006402
539 2970526370 2970524798 Bacteria 6840927
540 2970544100 2970540015 Bacteria 6977556
541 2970550819 2970547951 Bacteria 6931819
542 2970559245 2970554993 Bacteria 6814252
543 2970594260 2970593180 Bacteria 7073582
544 2970623834 2970619444 Bacteria 6986144
545 2970632889 2970627176 Bacteria 6680862
546 2977823945 2977821940 Bacteria 6906439
547 2977835302 2977828996 Bacteria 7007971
548 2977844357 2977843712 Bacteria 6753583
549 2977854298 2977851361 Bacteria 6694324
550 2977859108 2977858184 Bacteria 6215359
551 2977865623 2977864932 Bacteria 7534097
552 2977875339 2977872689 Bacteria 7270173
553 2977899588 2977898635 Bacteria 6675551
554 2977910822 2977907340 Bacteria 6577984
555 2977921889 2977915119 Bacteria 6829656
556 2977929592 2977922695 Bacteria 6956781
557 2977938039 2977935797 Bacteria 6252826
558 2977945340 2977942078 Bacteria 7570577
559 2977957665 2977950692 Bacteria 6893264
560 2977959477 2977957713 Bacteria 6877875
561 2977973875 2977971508 Bacteria 7472917
562 2977987947 2977986579 Bacteria 6581278
563 2979712225 2979710463 Bacteria 6785254
564 2979743880 2979742915 Bacteria 7301278
565 2979766223 2979764755 Bacteria 6610066
566 2979772352 2979772303 Bacteria 6618277
567 2979780810 2979779861 Bacteria 6219781
568 2979796312 2979793036 Bacteria 6808957
569 2979811129 2979808191 Bacteria 7179355
570 2987641783 2987636660 Bacteria 8088555
571 2987647897 2987645492 Bacteria 6117018
572 2987654419 2987652177 Bacteria 6969023
573 2987663907 2987659509 Bacteria 6966464
574 2987670120 2987666974 Bacteria 6509233
575 2987680887 2987673487 Bacteria 6884027
576 2996339353 2996336353 Bacteria 5511628
577 2996346006 2996341866 Bacteria 6643098
578 2996354824 2996348954 Bacteria 7239054
579 2996389115 2996386984 Bacteria 6978667
580 3000137583 3000135777 Bacteria 6891109
581 3004173565 3004167301 Bacteria 8330599
582 3004192964 3004188549 Bacteria 6952365
583 3004197632 3004195979 Bacteria 6776956
584 3004209405 3004203850 Bacteria 7307914
585 3004218444 3004211236 Bacteria 7417683
586 3004219459 3004218560 Bacteria 7421728
587 3004237631 3004232784 Bacteria 6662140
588 3004241164 3004239961 Bacteria 6892290
589 3004254816 3004248173 Bacteria 6563236
590 3004269473 3004268573 Bacteria 7043476
591 3004281472 3004275668 Bacteria 7114440
592 3004295320 3004289098 Bacteria 6135450
593 3004336926 3004334049 Bacteria 8449246
594 637076745 637000159 Bacteria 7596297
595 649870799 649633066 Bacteria 6690028
596 8002291964 8002285264 Bacteria 6717907
597 8004303321 8004300914 Bacteria 6132239
598 8004320138 8004312739 Bacteria 7444653
599 8004364140 8004361976 Bacteria 6858373
600 8004376310 8004374579 Bacteria 6898112
601 8004388733 8004387939 Bacteria 7049250
602 8004401338 8004395343 Bacteria 6620908
603 8004447693 8004445564 Bacteria 6322258
604 8004633344 8004633249 Bacteria 6723080
605 8004641963 8004640170 Bacteria 6723001
606 8004696458 8004695233 Bacteria 6731676
607 8004706495 8004703790 Bacteria 8006957
608 8004715063 8004714634 Bacteria 6776161
609 8004732002 8004727605 Bacteria 6643904
610 8055618193 8055617313 Bacteria 7548464
611 Ga0182006_1024784
612 JGI24740J21852_10156652
613 JGI25156J39149_1008981
614 JGI25157J39369_1003567
615 JGI25151J46595_10057929
616 JGI25406J46586_10037116
617 JGI25165J46597_1000052
618 Ga0055542_1000651
619 Ga0055529_1006363
620 Ga0055526_1000509
621 Ga0055524_1011546
622 Ga0065712_10697790
623 Ga0065715_10134556
624 Ga0070668_100469229
625 Ga0070669_100951943
626 Ga0070659_100525205
627 Ga0070694_100105764
628 Ga0070697_101704848
629 Ga0068853_100281794
630 Ga0070665_100020141
631 Ga0070665_100070744
632 Ga0070665_100502459
633 Ga0068855_100646085
634 Ga0068855_102239198
635 Ga0068857_101308126
636 Ga0068854_100600273
637 Ga0068854_100878469
638 Ga0068856_100537717
639 Ga0068864_100594719
640 Ga0068851_10854887
641 Ga0081455_10039042
642 Ga0081455_10074211
643 Ga0081455_10503223
644 Ga0081540_1017126
645 Ga0081539_10002395
646 Ga0075365_10325583
647 Ga0075365_10774177
648 Ga0075368_10011121
649 Ga0075368_10023099
650 Ga0075363_100094514
651 Ga0075363_100114728
652 Ga0075364_10270204
653 Ga0075364_10329002
654 Ga0075364_10400294
655 Ga0075364_10745401
656 Ga0075367_10093284
657 Ga0075367_10095571
658 Ga0075369_10030334
659 Ga0075370_10050626
660 Ga0075370_10319284
661 Ga0075434_100098377
662 Ga0068865_100586303
663 Ga0105240_10058351
664 Ga0105247_10461842
665 Ga0105243_10475923
666 Ga0105241_10076906
667 Ga0105241_10344400
668 Ga0105237_10201491
669 Ga0105237_10409254
670 Ga0105237_11449049
671 Ga0105237_11535523
672 Ga0105238_10430035
673 Ga0105238_11735832
674 Ga0105249_10107933
675 Ga0105239_10102611
676 Ga0105239_10390386
677 Ga0105239_10433082
678 Ga0105239_10716877
679 Ga0105246_10132653
680 Ga0105246_11325553
681 Ga0157370_10509334
682 Ga0157369_10417196
683 Ga0157374_11779210
684 Ga0157378_11083338
685 Ga0163162_11622615
686 Ga0163163_10381752
687 Ga0157376_10327396
688 Ga0157376_11436460
689 Ga0182007_10112892
690 Ga0213873_10160866
691 Ga0213872_10051689
692 Ga0213871_10294679
693 Ga0209646_1014908
694 Ga0209026_1000032
695 Ga0209677_116251
696 Ga0209148_1000111
697 Ga0209759_1000495
698 Ga0209233_1000118
699 Ga0209233_1006482
700 Ga0209455_1000201
701 Ga0209025_1024248
702 Ga0209758_1090387
703 Ga0209256_1000266
704 Ga0207647_10215213
705 Ga0207647_10471164
706 Ga0207705_10562494
707 Ga0207654_10522602
708 Ga0207654_10591985
709 Ga0207695_10092828
710 Ga0207695_11446107
711 Ga0207671_10116155
712 Ga0207671_10310210
713 Ga0207671_10397466
714 Ga0207671_10492120
715 Ga0207657_10120534
716 Ga0207681_11481335
717 Ga0207694_10670254
718 Ga0207644_11091291
719 Ga0207690_10967194
720 Ga0207689_11146238
721 Ga0207667_10495629
722 Ga0207668_10289650
723 Ga0207640_11875689
724 Ga0207658_10224355
725 Ga0207677_11036102
726 Ga0207639_10491081
727 Ga0207639_11368316
728 Ga0207702_10973371
729 Ga0207702_10981779
730 Ga0207674_10543236
731 Ga0209813_10111017
732 Ga0268266_10013310
733 Ga0268266_10195524
734 Ga0268266_11263763
735 Ga0307515_10003402
736 Ga0307513_11076804
737 Ga0307408_100176837
738 Ga0307408_100790960
739 Ga0307508_10000125
740 Ga0307406_10006876
741 Ga0307406_10307959
742 Ga0307412_10133911
743 Ga0307412_10253496
744 Ga0307412_10337524
745 Ga0307412_10426817
746 Ga0307412_11062000
747 Ga0307412_11102849
748 Ga0307409_101510054
749 Ga0307416_103289128
750 Ga0316584_0096449
751 Ga0373925_0476306
752 Ga0395899_0522602
753 Ga0395900_0127024
754 Ga0395900_0420720
755 Ga0395900_1889166
756 Ga0395898_0086749
757 Ga0395898_0563361
758 Ga0395905_0083575
759 Ga0395905_0122021
760 Ga0395905_0138810
761 Ga0395905_0548405
762 Ga0395905_0616104
763 Ga0395905_0769216
764 Ga0395901_0106352
765 Ga0395901_0220636
766 Ga0395901_0753171
767 Ga0436360_0115943
768 Ga0436360_0723218
769 Ga0436360_0954271
770 Ga0436360_1010740
771 Ga0436360_1077079
772 Ga0436361_0332511
773 Ga0436361_0601876
774 Ga0436361_0977274
775 Ga0436363_0845733
776 Ga0436362_0307133
777 Ga0439465_0233341
778 Ga0451793_0488867
779 Ga0451797_0773066
780 Ga0451798_0494404
781 Ga0451802_1611693
782 Ga0451807_1693925
783 Ga0466972_0076561
784 Ga0466971_0141068
785 Ga0466960_0115201
786 Ga0466959_0051864
787 Ga0451576_0036894
788 Ga0466958_0460408
789 Ga0495590_0374083
790 Ga0495638_0010018
791 Ga0495606_0217079
792 Ga0495616_0094800
793 Ga0495618_0507380
794 Ga0495620_0159208
795 Ga0495620_0324135
796 Ga0495628_0060445
797 Ga0495637_0208682
798 Ga0495652_0198613
799 Ga0495633_0100793
800 Ga0495668_0051636
801 Ga0495668_0295616
802 Ga0495634_0362615
803 Ga0495625_0328456
804 Ga0495625_0367504
805 Ga0495661_0541279
806 Ga0495599_0098928
807 Ga0495613_0551304
808 Ga0495660_0105703
809 Ga0495636_0348355
810 Ga0495674_0103857
811 Ga0495672_0046136
812 Ga0495687_062038
813 Ga0495602_0571662
814 Ga0495602_0599070
815 Ga0495626_0215798
816 Ga0496100_0719225
817 Ga0496101_0280737
818 Ga0496102_0476767
819 Ga0496102_0967303
820 Ga0496103_0232974
821 Ga0496104_0073533
822 Ga0496104_1644514
823 Ga0496108_0346671
824 Ga0496109_0482839
825 Ga0496110_0278227
826 Ga0496110_1190303
827 Ga0496112_0460542
828 Ga0496113_0214211
829 Ga0496114_0404520
830 Ga0496114_0513631
831 Ga0496114_0741690
832 Ga0496115_0068971
833 Ga0496115_0361972
834 Ga0496117_0497482
835 Ga0496118_0046019
836 Ga0496119_0117480
837 Ga0496119_0267946
838 Ga0496119_0286440
839 Ga0496120_0087517
840 Ga0496120_0127976
841 Ga0496120_0252558
842 Ga0496121_0246743
843 Ga0496121_0453765
844 Ga0496124_0003251
845 Ga0496126_0000258
846 Ga0496126_0245785
847 Ga0496126_0773470
848 Ga0501031_0033166
849 Ga0501031_0049680
850 Ga0501032_0037853
851 Ga0501032_0773555
852 Ga0501033_0036862
853 Ga0501033_0399756
854 Ga0501034_0000702
855 Ga0501034_0001206
856 Ga0501034_0016581
857 Ga0501034_0186478
858 Ga0501034_0245747
859 Ga0501034_1699887
860 Ga0501036_0108327
861 Ga0501037_0085576
862 Ga0501038_0157440
863 Ga0501039_0074313
864 Ga0501039_0206201
865 Ga0501040_0126182
866 Ga0501042_0030016
867 Ga0501043_0146535
868 Ga0501043_1066545
869 Ga0501046_0172438
870 Ga0501046_0781589
871 Ga0501047_0028722
872 Ga0501047_0593730
873 Ga0501067_0317417
874 Ga0501069_0261969
875 Ga0501070_0006133
876 Ga0501070_0819224
877 Ga0501071_0419394
878 Ga0501071_0493065
879 Ga0501072_0120807
880 Ga0501074_0162689
881 Ga0501079_0545194
882 Ga0501083_0421296
883 Ga0501241_129059
884 Ga0501035_0063116
885 Ga0501035_0124520
886 Ga0501044_0034369
887 Ga0501044_0115739
888 Ga0501044_0474394
889 Ga0501045_0141141
890 Ga0501045_0183635
891 nmdc:mga03683_399584_c1
892 nmdc:mga03n38_119597_c1
893 nmdc:mga03n38_603397_c1
894 nmdc:mga03n38_91037_c1
895 nmdc:mga00v17_126583_c1
896 nmdc:mga00v17_273348_c1
897 nmdc:mga0yw44_112662_c1
898 nmdc:mga0yw44_114602_c1
899 nmdc:mga0yw44_215253_c1
900 nmdc:mga0yw44_485886_c1
901 nmdc:mga0yw44_676645_c1
902 nmdc:mga0yw44_940781_c1
903 nmdc:mga06z11_203910_c1
904 nmdc:mga06z11_210047_c1
905 nmdc:mga04h51_108655_c1
906 nmdc:mga04h51_131639_c1
907 nmdc:mga04h51_38878_c1
908 nmdc:mga07m45_300388_c1
909 nmdc:mga07m45_496408_c1
910 nmdc:mga05p37_1301470_c1
911 nmdc:mga0n895_288503_c1
912 nmdc:mga08x19_115892_c1
913 nmdc:mga0sz30_83131_c1
914 Ga0495601_0001178
915 Ga0495601_0357821
916 Ga0495655_0348501
917 Ga0495595_0076771
918 Ga0500643_227327
919 Ga0500644_0008243
920 Ga0500593_000257
921 Ga0500594_0081574
922 Ga0500595_142761
923 Ga0500597_000871
924 Ga0500608_013457
925 Ga0500658_0053164
926 Ga0500568_0000005
927 Ga0500568_0000131
928 Ga0500577_0248955
929 Ga0500604_0162451
930 Ga0500616_0025858
931 Ga0500616_0334673
932 Ga0500620_002799
933 Ga0500622_0000037
934 Ga0500624_000081
935 Ga0500624_025103
936 Ga0500627_0408013
937 Ga0500637_0000234
938 Ga0500637_0412238
939 Ga0500611_007535
940 Ga0587107_094343
941 Ga0466962_0402396
942 2503198964
943 2509118206
944 2509143141
945 2509371465
946 2509393947
947 2510318408
948 2512933640
949 2512961786
950 2513613388
951 2514035537
952 2514419605
953 2514586589
954 2588519719
955 2599938772
956 2643988582
957 2644130745
958 2644154501
959 2671121098
960 2688596241
961 2694627625
962 2694636736
963 2723573365
964 2739305918
965 2756673630
966 2792747481
967 2841736655
968 2842926363
969 2844003192
970 2844011068
971 2847673699
972 2847690177
973 2856318876
974 2856327108
975 2856329522
976 2856340547
977 2856354439
978 2856357243
979 2856365135
980 2857353191
981 2857371608
982 2869166813
983 2869174226
984 2869238338
985 2869247084
986 2869251148
987 2869256971
988 2869269165
989 2869278057
990 2869279661
991 2869286241
992 2871430210
993 2871441153
994 2871446565
995 2871456598
996 2871464684
997 2871467960
998 2871475197
999 2871482624
1000 2871492938
1001 2871500301
1002 2874108323
1003 2874112745
1004 2874116945
1005 2874136300
1006 2874139348
1007 2874146625
1008 2874155701
1009 2874167326
1010 2874170606
1011 2876364105
1012 2876383851
1013 2876387789
1014 2876399152
1015 2876404613
1016 2876407632
1017 2876414030
1018 2876426543
1019 2878039192
1020 2878733018
1021 2878742189
1022 2878746406
1023 2878754728
1024 2878764401
1025 2878771493
1026 2878777250
1027 2878781930
1028 2878795657
1029 2881148458
1030 2881159541
1031 2881165245
1032 2881848145
1033 2881857355
1034 2881868578
1035 2882640431
1036 2882916042
1037 2885307109
1038 2885313882
1039 2885320846
1040 2885329821
1041 2885341762
1042 2885350199
1043 2885354182
1044 2888343640
1045 2888344641
1046 2888353453
1047 2889015166
1048 2889019751
1049 2889795759
1050 2889916404
1051 2903453792
1052 2903493989
1053 2903499885
1054 2903516801
1055 2903525735
1056 2903532718
1057 2903545114
1058 2904665679
1059 2906308807
1060 2906322087
1061 2906333965
1062 2906361065
1063 2906369499
1064 2906373135
1065 2906383653
1066 2906390279
1067 2906401226
1068 2906407496
1069 2906410624
1070 2906418946
1071 2906434009
1072 2922136724
1073 2922151633
1074 2922159492
1075 2922173180
1076 2922180576
1077 2922186063
1078 2924717498
1079 2924720927
1080 2924728284
1081 2924733413
1082 2924747405
1083 2924754086
1084 2924756077
1085 2924768533
1086 2924779873
1087 2924790948
1088 2937822145
1089 2937823517
1090 2937839293
1091 2937854623
1092 2937868529
1093 2937869344
1094 2937880541
1095 2937894867
1096 2937974170
1097 2937982947
1098 2937998961
1099 2938015993
1100 2958035238
1101 2958042666
1102 2958044270
1103 2958065615
1104 2958072430
1105 2958087674
1106 2958103300
1107 2958108272
1108 2958120349
1109 2958130259
1110 2958130640
1111 2958140685
1112 2958150271
1113 2958160144
1114 2958169435
1115 2958176674
1116 2958179978
1117 2961077805
1118 2961121022
1119 2961135415
1120 2961136852
1121 2961167896
1122 2961173894
1123 2961185040
1124 2963645563
1125 2965022715
1126 2965026724
1127 2965033469
1128 2965043014
1129 2965054718
1130 2965062452
1131 2965091628
1132 2965107460
1133 2965123105
1134 2968000071
1135 2968006956
1136 2968023658
1137 2968085102
1138 2968093460
1139 2968098112
1140 2968117172
1141 2968122406
1142 2968129582
1143 2968145222
1144 2968176297
1145 2970476240
1146 2970493836
1147 2970506439
1148 2970512216
1149 2970526370
1150 2970544100
1151 2970550819
1152 2970559245
1153 2970594260
1154 2970623834
1155 2970632889
1156 2977823945
1157 2977835302
1158 2977844357
1159 2977854298
1160 2977859108
1161 2977865623
1162 2977875339
1163 2977899588
1164 2977910822
1165 2977921889
1166 2977929592
1167 2977938039
1168 2977945340
1169 2977957665
1170 2977959477
1171 2977973875
1172 2977987947
1173 2979712225
1174 2979743880
1175 2979766223
1176 2979772352
1177 2979780810
1178 2979796312
1179 2979811129
1180 2987641783
1181 2987647897
1182 2987654419
1183 2987663907
1184 2987670120
1185 2987680887
1186 2996339353
1187 2996346006
1188 2996354824
1189 2996389115
1190 3000137583
1191 3004173565
1192 3004192964
1193 3004197632
1194 3004209405
1195 3004218444
1196 3004219459
1197 3004237631
1198 3004241164
1199 3004254816
1200 3004269473
1201 3004281472
1202 3004295320
1203 3004336926
1204 637076745
1205 649870799
1206 8002291964
1207 8004303321
1208 8004320138
1209 8004364140
1210 8004376310
1211 8004388733
1212 8004401338
1213 8004447693
1214 8004633344
1215 8004641963
1216 8004696458
1217 8004706495
1218 8004715063
1219 8004732002
1220 8055618193

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01042

Ribonuc_L-PSP

Endoribonuclease L-PSP

25

142

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3i7t-assembly1.cif.gz_A crystal structure of rv2704, a member of highly conserved yjgf/yer057c/uk114 family, from mycobacterium tuberculosis 0.9671 1 123
3i7t-assembly1.cif.gz_A crystal structure of rv2704, a member of highly conserved yjgf/yer057c/uk114 family, from mycobacterium tuberculosis 0.9512 1 123
3k12-assembly1.cif.gz_C crystal structure of an uncharacterized protein a6v7t0 from pseudomonas aeruginosa 0.9314 19 125
5hp7-assembly1.cif.gz_A crystal structures of rida in the apo form 0.9303 18 123
6izh-assembly1.cif.gz_E crystal structure of deaminase amne from pseudomonas sp. ap-3 0.9282 19 124
ID Description Score Start End Superfamily
3i7tA00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9671 1 123 3.30.1330.40
3i7tA00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9512 1 123 3.30.1330.40
5hp8A00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9285 18 123 3.30.1330.40
3k12C00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9254 21 125 3.30.1330.40
af_A0A1D8PGY1_281_387_3.30.1330.40 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9128 20 125 3.30.1330.40
ID Description Score Start End GO Terms
AF-A0A330HL43-F1-model_v4 RidA family protein 1.002 1 127
AF-A0A1H4KL37-F1-model_v4 Enamine deaminase RidA, house cleaning of reactive enamine intermediates, YjgF/YER057c/UK114 family 1.001 1 125
AF-A0A7R7CEP1-F1-model_v4 Uncharacterized protein 1 1 127
AF-A0A526VSV3-F1-model_v4 RidA family protein 1 1 125
AF-A0A530GX07-F1-model_v4 RidA family protein 1 33 127

Map