F469032

General Info

Members Datasets Scaffolds Average Seq Length
611 301 599 206

Family's Representative Sequence

Representative Sequence 3300005289|Ga0065704_10194096|Ga0065704_101940962
Length 242
Sequence MYILDGYPDRGAKRWLESRPIISPLSFVMARSKSSGQWLQQHINDPYVKQAQKDGYRSRSAYKLIQLNEKDRLIRPGMLVVDLGSSPGGWSQVAGRLVGARGRVVATDILPMDSLTNVEFIQGDFTDDSVLAQILEALGGNKPDLVICDIAPNITGIDSADQAASMYLVELALDLVRQVIKPSGNFVTKVFQGAGSDDYLKQVRTSFEKVSVRKPAASRPRSREVYIVAKGFKPDPVAETLL

Samples

Sample ID Description Type Environment
1 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
5 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
6 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
7 2738541276 Cellvibrio sp. YR554 Isolate Unclassified
8 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
9 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
10 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
11 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
12 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
13 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
14 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
15 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
16 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
41 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
42 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
72 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
73 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
81 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
163 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
164 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
165 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
166 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
167 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
168 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
169 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
170 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
171 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
172 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
173 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
174 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
175 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
176 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
177 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
178 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
179 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
180 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
181 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
182 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
183 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
184 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
185 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
186 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
187 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
188 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
189 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
190 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
191 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
192 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
193 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
194 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
195 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
196 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
197 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
198 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
199 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
200 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
201 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
202 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
203 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
204 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
205 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
206 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
207 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
208 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
209 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
210 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
211 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
212 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
213 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
214 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
215 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
216 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
217 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
218 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
219 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
220 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
221 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
222 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
223 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
224 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
225 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
226 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
227 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
228 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
229 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
230 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
231 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
232 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
233 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
234 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
235 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
236 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
237 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
238 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
239 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
240 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
241 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
242 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
243 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
244 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
245 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
246 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
247 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
248 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
249 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
250 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
251 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
252 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
253 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
254 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
255 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
256 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
257 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
258 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
259 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
260 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
261 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
262 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
263 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
264 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
265 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
266 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
267 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
268 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
269 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
270 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
276 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
277 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
278 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
279 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
280 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
281 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
282 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
283 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
284 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
285 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
286 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
287 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
288 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
289 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
290 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
291 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
292 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
293 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
294 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
295 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
296 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
297 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
298 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
299 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
300 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
301 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.87
Metatranscriptomes 0.16
Isolates 1.96

Biome Distribution

Category Percentage (%)
Aerial Root 0.33
Bulb 0
Endosphere 2.29
Nodule 0
Rhizoplane 5.4
Rhizosphere 86.25
Stem 0
Stem Tuber 0
Unclassified 5.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL3b_contig_688512 2162886006 Bacteria 1153
2 SwRhRL2b_contig_1007197 2162886007 Bacteria 1875
3 MBSR1b_contig_4575008 2162886012 Bacteria 1222
4 Ga0065704_10080259 3300005289 Bacteria 3981
5 Ga0065704_10194096 3300005289 Bacteria 1176
6 Ga0065704_10205487 3300005289 Bacteria 1129
7 Ga0065707_10082291 3300005295 Bacteria 17356
8 Ga0070683_100075371 3300005329 Bacteria 3152
9 Ga0070690_100295160 3300005330 Bacteria 1160
10 Ga0070690_100643858 3300005330 Bacteria 809
11 Ga0070670_100000026 3300005331 Bacteria 187946
12 Ga0070670_100059702 3300005331 Bacteria 3274
13 Ga0070670_100125563 3300005331 Bacteria 2215
14 Ga0070670_100443998 3300005331 Unclassified 1149
15 Ga0070677_10016480 3300005333 Unclassified 2632
16 Ga0070677_10017058 3300005333 Bacteria 2594
17 Ga0070666_10124124 3300005335 Bacteria 1791
18 Ga0070666_10140565 3300005335 Bacteria 1681
19 Ga0070680_100021104 3300005336 Bacteria 5173
20 Ga0070682_100046954 3300005337 Bacteria 2682
21 Ga0070682_100048562 3300005337 Bacteria 2643
22 Ga0070682_100076811 3300005337 Bacteria 2151
23 Ga0070682_100108904 3300005337 Bacteria 1843
24 Ga0068868_100204151 3300005338 Bacteria 1649
25 Ga0068868_100322814 3300005338 Bacteria 1316
26 Ga0070689_100360958 3300005340 Bacteria 1221
27 Ga0070691_10038441 3300005341 Bacteria 2260
28 Ga0070691_10062249 3300005341 Bacteria 1796
29 Ga0070687_100135554 3300005343 Unclassified 1427
30 Ga0070661_100156005 3300005344 Bacteria 1727
31 Ga0070661_100177430 3300005344 Bacteria 1620
32 Ga0070692_10193805 3300005345 Bacteria 1186
33 Ga0070668_100635461 3300005347 Bacteria 937
34 Ga0070675_100024236 3300005354 Bacteria 4859
35 Ga0070675_100293661 3300005354 Bacteria 1431
36 Ga0070671_100000058 3300005355 Bacteria 74538
37 Ga0070671_100010865 3300005355 Bacteria 7307
38 Ga0070674_100107537 3300005356 Bacteria 2042
39 Ga0070674_100117125 3300005356 Bacteria 1966
40 Ga0070673_100008710 3300005364 Bacteria 6768
41 Ga0070673_100172465 3300005364 Bacteria 1847
42 Ga0070673_100296696 3300005364 Bacteria 1422
43 Ga0070673_100334286 3300005364 Bacteria 1341
44 Ga0070673_100528335 3300005364 Bacteria 1070
45 Ga0070688_100001801 3300005365 Bacteria 10731
46 Ga0070659_100139973 3300005366 Bacteria 1970
47 Ga0070667_100000002 3300005367 Bacteria 504831
48 Ga0070667_100000052 3300005367 Bacteria 153455
49 Ga0070667_100014844 3300005367 Bacteria 6435
50 Ga0070667_100077403 3300005367 Bacteria 2840
51 Ga0070667_100463521 3300005367 Bacteria 1159
52 Ga0070667_100600681 3300005367 Bacteria 1014
53 Ga0070714_100700776 3300005435 Bacteria 977
54 Ga0070713_100098048 3300005436 Bacteria 2534
55 Ga0070710_10016709 3300005437 Bacteria 3739
56 Ga0070705_100009609 3300005440 Bacteria 4814
57 Ga0070700_100095543 3300005441 Bacteria 1948
58 Ga0070700_100137406 3300005441 Bacteria 1657
59 Ga0070663_100086223 3300005455 Bacteria 2318
60 Ga0070663_100101924 3300005455 Bacteria 2143
61 Ga0070678_100021992 3300005456 Bacteria 4216
62 Ga0070678_100596251 3300005456 Bacteria 986
63 Ga0070681_10029013 3300005458 Bacteria 5556
64 Ga0070681_10057902 3300005458 Bacteria 3855
65 Ga0070681_10083399 3300005458 Bacteria 3150
66 Ga0068867_100057821 3300005459 Unclassified 2873
67 Ga0070685_10000009 3300005466 Bacteria 166260
68 Ga0070685_10034296 3300005466 Bacteria 2857
69 Ga0070685_10146087 3300005466 Bacteria 1494
70 Ga0070679_100004487 3300005530 Bacteria 12895
71 Ga0070679_100021104 3300005530 Bacteria 6356
72 Ga0070679_100032153 3300005530 Bacteria 5188
73 Ga0070679_100065827 3300005530 Bacteria 3612
74 Ga0070679_100261453 3300005530 Bacteria 1686
75 Ga0070679_100355789 3300005530 Bacteria 1412
76 Ga0070684_100080193 3300005535 Bacteria 2887
77 Ga0070684_100332557 3300005535 Bacteria 1396
78 Ga0068853_100164936 3300005539 Bacteria 2002
79 Ga0068853_100745931 3300005539 Bacteria 935
80 Ga0070672_100004027 3300005543 Bacteria 9586
81 Ga0070672_100022337 3300005543 Bacteria 4646
82 Ga0070672_100034320 3300005543 Bacteria 3850
83 Ga0070672_100114800 3300005543 Bacteria 2199
84 Ga0070686_100078137 3300005544 Bacteria 2184
85 Ga0070696_100118350 3300005546 Bacteria 1915
86 Ga0070693_100078840 3300005547 Unclassified 1958
87 Ga0070693_100179181 3300005547 Bacteria 1363
88 Ga0070693_100759609 3300005547 Bacteria 715
89 Ga0070665_100005431 3300005548 Bacteria 13145
90 Ga0070665_100017572 3300005548 Bacteria 7183
91 Ga0070665_100021539 3300005548 Bacteria 6480
92 Ga0070665_100026031 3300005548 Bacteria 5893
93 Ga0070665_100040364 3300005548 Bacteria 4691
94 Ga0070665_100291049 3300005548 Bacteria 1636
95 Ga0070665_100611884 3300005548 Bacteria 1102
96 Ga0068855_100007608 3300005563 Bacteria 13103
97 Ga0068855_100062151 3300005563 Bacteria 4361
98 Ga0068855_100106151 3300005563 Bacteria 3228
99 Ga0068855_100116201 3300005563 Bacteria 3066
100 Ga0070664_100042124 3300005564 Bacteria 3854
101 Ga0068857_100418707 3300005577 Bacteria 1249
102 Ga0068854_100054942 3300005578 Bacteria 2866
103 Ga0068856_100042897 3300005614 Bacteria 4451
104 Ga0068856_100121245 3300005614 Bacteria 2616
105 Ga0068856_100142179 3300005614 Bacteria 2407
106 Ga0068852_100968201 3300005616 Bacteria 869
107 Ga0068859_100004165 3300005617 Bacteria 14770
108 Ga0068859_100032042 3300005617 Bacteria 5280
109 Ga0068859_100034325 3300005617 Bacteria 5092
110 Ga0068859_100291642 3300005617 Bacteria 1724
111 Ga0068859_100371832 3300005617 Bacteria 1525
112 Ga0068859_100507112 3300005617 Bacteria 1301
113 Ga0068864_100000002 3300005618 Bacteria 658857
114 Ga0068864_100359696 3300005618 Bacteria 1375
115 Ga0068861_100012556 3300005719 Bacteria 5909
116 Ga0068861_100041647 3300005719 Bacteria 3441
117 Ga0068861_100088371 3300005719 Bacteria 2440
118 Ga0068861_100123964 3300005719 Bacteria 2088
119 Ga0068861_100304550 3300005719 Bacteria 1382
120 Ga0068851_10228226 3300005834 Bacteria 1049
121 Ga0068870_10001989 3300005840 Bacteria 8448
122 Ga0068870_10082565 3300005840 Bacteria 1780
123 Ga0068863_100000939 3300005841 Bacteria 29246
124 Ga0068863_100003628 3300005841 Bacteria 15247
125 Ga0068863_100071918 3300005841 Bacteria 3272
126 Ga0068858_100000632 3300005842 Bacteria 36597
127 Ga0068858_100018434 3300005842 Bacteria 6534
128 Ga0068858_100069744 3300005842 Bacteria 3258
129 Ga0068858_100173808 3300005842 Bacteria 2032
130 Ga0068858_100597097 3300005842 Bacteria 1071
131 Ga0068860_100000274 3300005843 Bacteria 75310
132 Ga0068860_100000684 3300005843 Bacteria 39188
133 Ga0068860_100077579 3300005843 Bacteria 3159
134 Ga0068860_100143532 3300005843 Bacteria 2296
135 Ga0068860_100182139 3300005843 Bacteria 2030
136 Ga0068860_100683029 3300005843 Bacteria 1036
137 Ga0068862_100016178 3300005844 Bacteria 6204
138 Ga0068862_100049028 3300005844 Bacteria 3607
139 Ga0068862_100086644 3300005844 Bacteria 2723
140 Ga0068862_100184704 3300005844 Bacteria 1873
141 Ga0070715_10217577 3300006163 Bacteria 980
142 Ga0070716_100044363 3300006173 Bacteria 2491
143 Ga0070716_100106384 3300006173 Bacteria 1730
144 Ga0070712_100010849 3300006175 Bacteria 5761
145 Ga0097621_100142958 3300006237 Bacteria 2046
146 Ga0097621_100179596 3300006237 Bacteria 1828
147 Ga0097621_100189645 3300006237 Bacteria 1780
148 Ga0097621_100354410 3300006237 Bacteria 1306
149 Ga0068871_100338738 3300006358 Bacteria 1328
150 Ga0068871_100520568 3300006358 Bacteria 1074
151 Ga0075430_100513442 3300006846 Bacteria 989
152 Ga0068865_100017170 3300006881 Bacteria 4650
153 Ga0068865_100334236 3300006881 Bacteria 1222
154 Ga0068865_100509266 3300006881 Bacteria 1005
155 Ga0068865_100572046 3300006881 Unclassified 952
156 Ga0068865_100747670 3300006881 Bacteria 839
157 Ga0075436_100074188 3300006914 Bacteria 2355
158 Ga0097620_100004165 3300006931 Bacteria 14770
159 Ga0097620_100032042 3300006931 Bacteria 5280
160 Ga0097620_100034325 3300006931 Bacteria 5092
161 Ga0097620_100291632 3300006931 Bacteria 1724
162 Ga0097620_100371861 3300006931 Bacteria 1525
163 Ga0097620_100507099 3300006931 Bacteria 1301
164 Ga0097620_100545817 3300006931 Bacteria 1254
165 Ga0105251_10008576 3300009011 Bacteria 6132
166 Ga0105250_10075358 3300009092 Bacteria 1365
167 Ga0105240_10008879 3300009093 Bacteria 14302
168 Ga0105240_10016620 3300009093 Bacteria 9951
169 Ga0105240_10017821 3300009093 Bacteria 9556
170 Ga0105240_10037201 3300009093 Bacteria 6256
171 Ga0105240_10095157 3300009093 Bacteria 3632
172 Ga0105240_10133648 3300009093 Bacteria 2973
173 Ga0105240_10154806 3300009093 Bacteria 2727
174 Ga0105240_10294654 3300009093 Bacteria 1858
175 Ga0105240_10304043 3300009093 Bacteria 1824
176 Ga0105240_10497912 3300009093 Bacteria 1355
177 Ga0111539_10607081 3300009094 Bacteria 1274
178 Ga0111539_10939241 3300009094 Bacteria 1006
179 Ga0105245_10283516 3300009098 Bacteria 1620
180 Ga0105247_10000342 3300009101 Bacteria 40806
181 Ga0105247_10020146 3300009101 Bacteria 4010
182 Ga0105247_10029168 3300009101 Bacteria 3342
183 Ga0105241_10058262 3300009174 Bacteria 2966
184 Ga0105241_10180064 3300009174 Bacteria 1753
185 Ga0105241_10251989 3300009174 Bacteria 1497
186 Ga0105242_10371496 3300009176 Bacteria 1327
187 Ga0105242_10552344 3300009176 Bacteria 1104
188 Ga0105242_10869935 3300009176 Bacteria 898
189 Ga0105248_10016662 3300009177 Bacteria 8088
190 Ga0105248_10112443 3300009177 Bacteria 3071
191 Ga0105248_10132383 3300009177 Bacteria 2813
192 Ga0105248_10218175 3300009177 Bacteria 2148
193 Ga0105248_10368724 3300009177 Bacteria 1617
194 Ga0105237_10074676 3300009545 Bacteria 3382
195 Ga0105237_10119763 3300009545 Bacteria 2626
196 Ga0105237_10207353 3300009545 Bacteria 1960
197 Ga0105237_10217420 3300009545 Bacteria 1911
198 Ga0105237_10274087 3300009545 Bacteria 1690
199 Ga0105237_10276752 3300009545 Bacteria 1681
200 Ga0105237_11175503 3300009545 Bacteria 774
201 Ga0105238_10002313 3300009551 Bacteria 19167
202 Ga0105238_10022722 3300009551 Bacteria 6392
203 Ga0105238_10059981 3300009551 Bacteria 3810
204 Ga0105238_10405033 3300009551 Bacteria 1358
205 Ga0105238_10937504 3300009551 Bacteria 885
206 Ga0105249_10052734 3300009553 Bacteria 3715
207 Ga0105249_10063862 3300009553 Bacteria 3383
208 Ga0105249_10108638 3300009553 Bacteria 2619
209 Ga0105249_10223695 3300009553 Bacteria 1853
210 Ga0105249_10321731 3300009553 Bacteria 1558
211 Ga0105239_10025606 3300010375 Bacteria 6495
212 Ga0105239_10394750 3300010375 Bacteria 1565
213 Ga0105239_10610628 3300010375 Bacteria 1244
214 Ga0157371_10003190 3300013102 Bacteria 15054
215 Ga0157371_10138854 3300013102 Bacteria 1731
216 Ga0157370_10009142 3300013104 Bacteria 10624
217 Ga0157369_10012386 3300013105 Bacteria 9682
218 Ga0157369_10017382 3300013105 Bacteria 8084
219 Ga0157369_10021722 3300013105 Bacteria 7178
220 Ga0157369_10096697 3300013105 Bacteria 3150
221 Ga0157369_10295654 3300013105 Bacteria 1685
222 Ga0157374_10132583 3300013296 Bacteria 2412
223 Ga0157374_10200378 3300013296 Bacteria 1954
224 Ga0157374_10556548 3300013296 Bacteria 1155
225 Ga0163162_10016055 3300013306 Bacteria 7318
226 Ga0163162_10154546 3300013306 Bacteria 2414
227 Ga0163162_10564450 3300013306 Bacteria 1266
228 Ga0157372_10072228 3300013307 Bacteria 3888
229 Ga0157372_10348016 3300013307 Bacteria 1726
230 Ga0157372_10373304 3300013307 Bacteria 1662
231 Ga0157372_10570057 3300013307 Bacteria 1319
232 Ga0157372_10682006 3300013307 Bacteria 1196
233 Ga0157375_10069347 3300013308 Bacteria 3531
234 Ga0157375_11072891 3300013308 Bacteria 942
235 Ga0163163_10000081 3300014325 Bacteria 104678
236 Ga0163163_10087399 3300014325 Bacteria 3128
237 Ga0163163_10131148 3300014325 Bacteria 2547
238 Ga0163163_10141824 3300014325 Bacteria 2445
239 Ga0163163_10476578 3300014325 Bacteria 1309
240 Ga0163163_10970527 3300014325 Bacteria 913
241 Ga0157380_10002827 3300014326 Bacteria 11802
242 Ga0157380_10058159 3300014326 Bacteria 3081
243 Ga0157380_10626218 3300014326 Bacteria 1069
244 Ga0157380_10713779 3300014326 Bacteria 1009
245 Ga0157380_11083546 3300014326 Bacteria 839
246 Ga0157377_10539971 3300014745 Unclassified 822
247 Ga0157379_10022208 3300014968 Bacteria 5622
248 Ga0157379_10060171 3300014968 Bacteria 3395
249 Ga0157379_10096261 3300014968 Bacteria 2657
250 Ga0157379_10125478 3300014968 Bacteria 2310
251 Ga0157376_10031227 3300014969 Bacteria 4263
252 Ga0157376_10032550 3300014969 Unclassified 4187
253 Ga0157376_10368450 3300014969 Bacteria 1380
254 Ga0163161_10040256 3300017792 Unclassified 3356
255 Ga0206356_10460238 3300020070 Bacteria 1449
256 Ga0207713_1021127 3300025735 Bacteria 3129
257 Ga0207682_10009116 3300025893 Bacteria 3920
258 Ga0207682_10020839 3300025893 Unclassified 2576
259 Ga0207692_10138119 3300025898 Bacteria 1383
260 Ga0207642_10060928 3300025899 Bacteria 1752
261 Ga0207642_10083734 3300025899 Bacteria 1556
262 Ga0207710_10000167 3300025900 Bacteria 69349
263 Ga0207710_10020394 3300025900 Bacteria 2833
264 Ga0207710_10074493 3300025900 Bacteria 1563
265 Ga0207688_10373321 3300025901 Bacteria 881
266 Ga0207680_10030420 3300025903 Bacteria 3045
267 Ga0207680_10215444 3300025903 Bacteria 1314
268 Ga0207680_10250405 3300025903 Bacteria 1223
269 Ga0207647_10051744 3300025904 Bacteria 2537
270 Ga0207645_10122995 3300025907 Bacteria 1685
271 Ga0207643_10009378 3300025908 Bacteria 5260
272 Ga0207643_10050945 3300025908 Bacteria 2349
273 Ga0207654_10303290 3300025911 Unclassified 1087
274 Ga0207707_10005259 3300025912 Bacteria 11335
275 Ga0207707_10012047 3300025912 Bacteria 7520
276 Ga0207707_10031276 3300025912 Bacteria 4657
277 Ga0207707_10163405 3300025912 Bacteria 1946
278 Ga0207707_10744727 3300025912 Bacteria 820
279 Ga0207695_10008742 3300025913 Bacteria 12627
280 Ga0207695_10023623 3300025913 Bacteria 6937
281 Ga0207695_10029601 3300025913 Bacteria 6044
282 Ga0207695_10037335 3300025913 Bacteria 5242
283 Ga0207695_10043328 3300025913 Bacteria 4797
284 Ga0207695_10067312 3300025913 Bacteria 3674
285 Ga0207695_10094419 3300025913 Bacteria 2998
286 Ga0207695_10124600 3300025913 Bacteria 2540
287 Ga0207695_10152530 3300025913 Bacteria 2249
288 Ga0207695_10218862 3300025913 Bacteria 1812
289 Ga0207695_10253613 3300025913 Bacteria 1658
290 Ga0207671_10150471 3300025914 Bacteria 1798
291 Ga0207671_10183755 3300025914 Bacteria 1628
292 Ga0207671_10189717 3300025914 Bacteria 1602
293 Ga0207671_10457199 3300025914 Bacteria 1017
294 Ga0207671_10463989 3300025914 Bacteria 1009
295 Ga0207693_10004507 3300025915 Bacteria 11782
296 Ga0207660_10004159 3300025917 Bacteria 9419
297 Ga0207660_10372958 3300025917 Bacteria 1146
298 Ga0207662_10034463 3300025918 Bacteria 2955
299 Ga0207662_10170287 3300025918 Unclassified 1396
300 Ga0207657_10666860 3300025919 Unclassified 809
301 Ga0207649_10084219 3300025920 Bacteria 2066
302 Ga0207652_10044475 3300025921 Bacteria 3783
303 Ga0207652_10102243 3300025921 Bacteria 2532
304 Ga0207652_10231361 3300025921 Bacteria 1666
305 Ga0207652_10976386 3300025921 Bacteria 745
306 Ga0207681_10297283 3300025923 Bacteria 1276
307 Ga0207694_10103459 3300025924 Bacteria 2258
308 Ga0207694_10186287 3300025924 Bacteria 1685
309 Ga0207694_10288215 3300025924 Bacteria 1350
310 Ga0207650_10000002 3300025925 Bacteria 1439222
311 Ga0207650_10046571 3300025925 Bacteria 3193
312 Ga0207650_10529205 3300025925 Bacteria 987
313 Ga0207659_10032055 3300025926 Bacteria 3603
314 Ga0207659_10332095 3300025926 Bacteria 1257
315 Ga0207700_10095529 3300025928 Bacteria 2358
316 Ga0207644_10000020 3300025931 Bacteria 165455
317 Ga0207644_10005739 3300025931 Bacteria 8076
318 Ga0207644_10032383 3300025931 Bacteria 3647
319 Ga0207644_10398026 3300025931 Bacteria 1125
320 Ga0207706_10309385 3300025933 Bacteria 1376
321 Ga0207686_10137264 3300025934 Bacteria 1686
322 Ga0207686_10466315 3300025934 Bacteria 974
323 Ga0207670_10086143 3300025936 Bacteria 2209
324 Ga0207704_10356298 3300025938 Bacteria 1141
325 Ga0207704_10640822 3300025938 Bacteria 874
326 Ga0207665_10018494 3300025939 Bacteria 4578
327 Ga0207691_10003456 3300025940 Bacteria 15367
328 Ga0207691_10013427 3300025940 Bacteria 7840
329 Ga0207691_10145671 3300025940 Bacteria 2085
330 Ga0207711_10000619 3300025941 Bacteria 35743
331 Ga0207711_10115420 3300025941 Bacteria 2393
332 Ga0207689_10090719 3300025942 Bacteria 2511
333 Ga0207661_10227983 3300025944 Bacteria 1649
334 Ga0207679_10126867 3300025945 Bacteria 2040
335 Ga0207679_10480313 3300025945 Bacteria 1106
336 Ga0207667_10006536 3300025949 Bacteria 14097
337 Ga0207667_10024211 3300025949 Bacteria 6671
338 Ga0207667_10186652 3300025949 Bacteria 2128
339 Ga0207651_10031031 3300025960 Bacteria 3411
340 Ga0207651_10045213 3300025960 Bacteria 2952
341 Ga0207651_10273063 3300025960 Bacteria 1393
342 Ga0207651_10653585 3300025960 Bacteria 923
343 Ga0207712_10038119 3300025961 Bacteria 3285
344 Ga0207712_10132619 3300025961 Bacteria 1900
345 Ga0207712_10190539 3300025961 Bacteria 1618
346 Ga0207712_10893522 3300025961 Bacteria 785
347 Ga0207640_10050142 3300025981 Bacteria 2707
348 Ga0207640_10374339 3300025981 Bacteria 1152
349 Ga0207658_10000001 3300025986 Bacteria 1439333
350 Ga0207658_10000250 3300025986 Bacteria 56198
351 Ga0207658_10352747 3300025986 Bacteria 1281
352 Ga0207658_10447122 3300025986 Bacteria 1143
353 Ga0207658_11032027 3300025986 Bacteria 751
354 Ga0207677_10054642 3300026023 Bacteria 2726
355 Ga0207677_10210816 3300026023 Bacteria 1551
356 Ga0207703_10001048 3300026035 Bacteria 26350
357 Ga0207703_10001570 3300026035 Bacteria 20718
358 Ga0207703_10020650 3300026035 Bacteria 5152
359 Ga0207703_10165873 3300026035 Bacteria 1938
360 Ga0207703_10180767 3300026035 Bacteria 1861
361 Ga0207703_10332801 3300026035 Bacteria 1393
362 Ga0207703_10709624 3300026035 Bacteria 957
363 Ga0207678_10140164 3300026067 Bacteria 2064
364 Ga0207678_10312040 3300026067 Bacteria 1352
365 Ga0207678_10968639 3300026067 Unclassified 753
366 Ga0207708_10054431 3300026075 Bacteria 3051
367 Ga0207708_10063667 3300026075 Bacteria 2817
368 Ga0207708_10182924 3300026075 Bacteria 1665
369 Ga0207702_10059039 3300026078 Bacteria 3266
370 Ga0207702_10199566 3300026078 Bacteria 1853
371 Ga0207702_11151143 3300026078 Bacteria 770
372 Ga0207641_10000290 3300026088 Bacteria 62711
373 Ga0207641_10016513 3300026088 Bacteria 6045
374 Ga0207641_10020410 3300026088 Bacteria 5441
375 Ga0207641_10043240 3300026088 Bacteria 3782
376 Ga0207641_10074438 3300026088 Bacteria 2929
377 Ga0207648_10032625 3300026089 Bacteria 4596
378 Ga0207676_10000001 3300026095 Bacteria 1439222
379 Ga0207676_10157103 3300026095 Bacteria 1966
380 Ga0207676_11002915 3300026095 Bacteria 823
381 Ga0207674_10658252 3300026116 Bacteria 1011
382 Ga0207675_100004052 3300026118 Bacteria 14192
383 Ga0207675_100004461 3300026118 Bacteria 13527
384 Ga0207675_100050538 3300026118 Bacteria 3879
385 Ga0207675_100080746 3300026118 Bacteria 3049
386 Ga0207675_100130703 3300026118 Bacteria 2381
387 Ga0207683_10008549 3300026121 Bacteria 8763
388 Ga0207683_10054110 3300026121 Bacteria 3519
389 Ga0207683_10081437 3300026121 Bacteria 2873
390 Ga0207683_10265491 3300026121 Bacteria 1568
391 Ga0268266_10000704 3300028379 Bacteria 45162
392 Ga0268266_10010219 3300028379 Bacteria 8222
393 Ga0268265_10000258 3300028380 Bacteria 60430
394 Ga0268265_10006412 3300028380 Bacteria 7976
395 Ga0268265_10068570 3300028380 Bacteria 2751
396 Ga0268265_10865062 3300028380 Bacteria 885
397 Ga0268264_10000004 3300028381 Bacteria 1116842
398 Ga0268264_10000058 3300028381 Bacteria 308956
399 Ga0268264_10000060 3300028381 Bacteria 305056
400 Ga0268264_10053062 3300028381 Bacteria 3382
401 Ga0268264_10163449 3300028381 Bacteria 2008
402 Ga0268264_10552696 3300028381 Bacteria 1129
403 Ga0265334_10031480 3300028573 Bacteria 2120
404 Ga0307515_10070359 3300028794 Bacteria 4763
405 Ga0265338_10027456 3300028800 Bacteria 5711
406 Ga0307511_10022320 3300030521 Bacteria 5933
407 Ga0265340_10030088 3300031247 Bacteria 2724
408 Ga0265331_10027150 3300031250 Bacteria 2873
409 Ga0265327_10000282 3300031251 Bacteria 100324
410 Ga0307513_10084125 3300031456 Bacteria 3269
411 Ga0307513_10150915 3300031456 Bacteria 2233
412 Ga0307513_10505620 3300031456 Bacteria 925
413 Ga0307513_10519368 3300031456 Unclassified 906
414 Ga0307509_10000048 3300031507 Bacteria 167101
415 Ga0307509_10000074 3300031507 Bacteria 140111
416 Ga0307509_10321086 3300031507 Bacteria 1285
417 Ga0307408_100000721 3300031548 Bacteria 26773
418 Ga0307408_100043705 3300031548 Bacteria 3189
419 Ga0307413_10007099 3300031824 Bacteria 5172
420 Ga0307413_10250470 3300031824 Bacteria 1314
421 Ga0307410_10069546 3300031852 Bacteria 2436
422 Ga0307410_10373237 3300031852 Bacteria 1146
423 Ga0307410_10411932 3300031852 Bacteria 1094
424 Ga0307406_10993697 3300031901 Bacteria 719
425 Ga0307407_10098790 3300031903 Bacteria 1807
426 Ga0307412_10197362 3300031911 Bacteria 1526
427 Ga0307409_100156196 3300031995 Bacteria 1988
428 Ga0307409_100193094 3300031995 Bacteria 1814
429 Ga0307409_100315927 3300031995 Bacteria 1460
430 Ga0307416_100036124 3300032002 Bacteria 3785
431 Ga0307416_100357846 3300032002 Bacteria 1480
432 Ga0307411_10011187 3300032005 Bacteria 4828
433 Ga0307411_10684534 3300032005 Bacteria 891
434 Ga0307411_10685378 3300032005 Bacteria 891
435 Ga0307510_10017304 3300033180 Bacteria 8505
436 Ga0373934_0212027 3300035086 Bacteria 798
437 Ga0373936_0001995 3300035113 Bacteria 7555
438 Ga0373954_0046888 3300035118 Bacteria 2021
439 Ga0373933_0191147 3300035724 Bacteria 1308
440 Ga0373937_0009441 3300036401 Bacteria 8481
441 Ga0373937_0047167 3300036401 Bacteria 3941
442 Ga0373925_0064459 3300037068 Bacteria 2758
443 Ga0373925_0362882 3300037068 Bacteria 1178
444 Ga0395900_0331445 3300037418 Bacteria 1500
445 Ga0395900_0985223 3300037418 Bacteria 763
446 Ga0395898_0030669 3300037466 Bacteria 5379
447 Ga0395898_0103282 3300037466 Bacteria 2735
448 Ga0436364_0130364 3300037853 Bacteria 1163
449 Ga0436361_0268579 3300039447 Bacteria 899
450 Ga0436361_0990724 3300039447 Unclassified 855
451 Ga0436363_0120822 3300039450 Bacteria 3115
452 Ga0451789_0468735 3300041443 Bacteria 912
453 Ga0451789_0554294 3300041443 Bacteria 1430
454 Ga0451791_1713758 3300041451 Bacteria 2126
455 Ga0451791_1935231 3300041451 Bacteria 1548
456 Ga0451793_0376710 3300041452 Bacteria 999
457 Ga0451793_1836681 3300041452 Bacteria 1102
458 Ga0451800_0252305 3300041459 Bacteria 2961
459 Ga0451802_0702001 3300041460 Bacteria 918
460 Ga0451807_0279481 3300041486 Bacteria 2891
461 Ga0451807_0302049 3300041486 Bacteria 2322
462 Ga0451807_1583312 3300041486 Bacteria 1828
463 Ga0451837_1191953 3300041494 Bacteria 3977
464 Ga0451853_3663875 3300041512 Bacteria 745
465 Ga0439431_0004348 3300041997 Bacteria 3114
466 Ga0439437_007994 3300042000 Bacteria 1185
467 Ga0439455_0003927 3300042012 Bacteria 2897
468 Ga0450911_000015 3300042115 Bacteria 109635
469 Ga0450895_003648 3300042132 Bacteria 1195
470 Ga0450900_024920 3300042136 Bacteria 850
471 Ga0450904_000005 3300042139 Bacteria 60724
472 Ga0439446_0011153 3300042156 Bacteria 2436
473 Ga0439459_0003543 3300042438 Bacteria 2485
474 Ga0439459_0042345 3300042438 Bacteria 972
475 Ga0450916_000847 3300042530 Bacteria 2876
476 Ga0450916_001487 3300042530 Bacteria 2349
477 Ga0466961_0102542 3300044693 Bacteria 1802
478 Ga0466959_0558925 3300045049 Bacteria 771
479 Ga0495603_0417240 3300046455 Bacteria 769
480 Ga0495591_048591 3300046458 Bacteria 1169
481 Ga0495629_0059962 3300046459 Bacteria 2660
482 Ga0495638_0063954 3300046460 Bacteria 2267
483 Ga0495638_0342626 3300046460 Bacteria 792
484 Ga0495580_0000463 3300046472 Bacteria 33704
485 Ga0495580_0018248 3300046472 Bacteria 5226
486 Ga0495580_0022811 3300046472 Bacteria 4602
487 Ga0495639_0173725 3300046475 Bacteria 1047
488 Ga0495584_0076955 3300046491 Bacteria 1678
489 Ga0495594_0509490 3300046499 Unclassified 683
490 Ga0495596_0121296 3300046500 Bacteria 1015
491 Ga0495583_0193873 3300046506 Bacteria 828
492 Ga0495606_0054418 3300046507 Bacteria 2592
493 Ga0495606_0154118 3300046507 Bacteria 1346
494 Ga0495608_0465624 3300046511 Bacteria 768
495 Ga0495616_0003020 3300046513 Bacteria 10926
496 Ga0495620_0043086 3300046515 Bacteria 1968
497 Ga0495630_0035598 3300046517 Bacteria 3720
498 Ga0495632_0013127 3300046519 Bacteria 4744
499 Ga0495644_0003534 3300046523 Bacteria 6179
500 Ga0495648_0283056 3300046524 Bacteria 785
501 Ga0495652_0457956 3300046529 Bacteria 892
502 Ga0495586_0464502 3300046535 Bacteria 730
503 Ga0495621_0004122 3300046539 Bacteria 4051
504 Ga0495645_0153953 3300046543 Bacteria 1595
505 Ga0495656_0005412 3300046615 Bacteria 4406
506 Ga0495668_0022887 3300046616 Bacteria 3569
507 Ga0495668_0069294 3300046616 Bacteria 1940
508 Ga0495611_0255898 3300046648 Bacteria 811
509 Ga0495611_0389583 3300046648 Bacteria 637
510 Ga0495625_0022716 3300046660 Bacteria 4804
511 Ga0495625_0030402 3300046660 Bacteria 4031
512 Ga0495599_0189339 3300046678 Bacteria 1266
513 Ga0495647_0011153 3300046681 Bacteria 3074
514 Ga0495658_0080882 3300046683 Bacteria 1907
515 Ga0495669_0176108 3300046684 Bacteria 1019
516 Ga0495624_0379951 3300046690 Bacteria 849
517 Ga0495671_0015030 3300046692 Bacteria 4158
518 Ga0495649_0001072 3300046694 Bacteria 21366
519 Ga0495649_0136398 3300046694 Bacteria 1293
520 Ga0495672_0158277 3300047320 Bacteria 1167
521 Ga0495687_090888 3300047443 Bacteria 1169
522 Ga0495681_0009447 3300047470 Bacteria 6009
523 Ga0495686_0281442 3300047472 Bacteria 924
524 Ga0495602_0423440 3300048088 Bacteria 945
525 Ga0496100_0036452 3300048903 Bacteria 3102
526 Ga0496101_0084436 3300048904 Bacteria 2351
527 Ga0496102_0021940 3300048905 Bacteria 5654
528 Ga0496102_0031702 3300048905 Bacteria 4744
529 Ga0496102_0080064 3300048905 Bacteria 3009
530 Ga0496104_0067057 3300048907 Bacteria 3408
531 Ga0496104_0392440 3300048907 Bacteria 1300
532 Ga0496106_0034604 3300048909 Bacteria 3774
533 Ga0496106_0119110 3300048909 Bacteria 2062
534 Ga0496106_0509748 3300048909 Bacteria 966
535 Ga0496107_0028231 3300048910 Bacteria 3987
536 Ga0496107_0110958 3300048910 Bacteria 2016
537 Ga0496108_0025478 3300048911 Bacteria 4875
538 Ga0496108_0093701 3300048911 Bacteria 2555
539 Ga0496109_0235104 3300048912 Bacteria 1724
540 Ga0496111_0019598 3300048914 Bacteria 4703
541 Ga0496113_0262365 3300048916 Bacteria 1380
542 Ga0496113_0657191 3300048916 Bacteria 838
543 Ga0496114_0675054 3300048917 Bacteria 907
544 Ga0496115_0057745 3300048918 Bacteria 3121
545 Ga0496115_0353388 3300048918 Bacteria 1198
546 Ga0496115_0711228 3300048918 Bacteria 789
547 Ga0496117_0000090 3300048920 Bacteria 206388
548 Ga0496117_0181589 3300048920 Bacteria 1209
549 Ga0496118_0000032 3300048921 Bacteria 330072
550 Ga0496118_0086731 3300048921 Bacteria 2174
551 Ga0496120_0023689 3300048923 Bacteria 3839
552 Ga0496121_0001021 3300048924 Bacteria 49886
553 Ga0496121_0084783 3300048924 Bacteria 2496
554 Ga0496124_0031151 3300048927 Bacteria 4724
555 Ga0496124_0080960 3300048927 Bacteria 2671
556 Ga0496125_0000592 3300048928 Bacteria 61806
557 Ga0496125_0095016 3300048928 Bacteria 2219
558 Ga0496125_0295350 3300048928 Bacteria 995
559 Ga0496126_0007351 3300048929 Bacteria 12088
560 Ga0496126_0021320 3300048929 Bacteria 6329
561 Ga0496126_0164527 3300048929 Bacteria 1894
562 Ga0495682_0062585 3300049460 Bacteria 1343
563 Ga0501036_0238443 3300049572 Bacteria 1526
564 Ga0501036_0802485 3300049572 Bacteria 775
565 Ga0501038_0692991 3300049574 Bacteria 764
566 Ga0501039_0163988 3300049575 Bacteria 1747
567 Ga0501042_0134422 3300049578 Bacteria 1783
568 Ga0501047_0683745 3300049581 Bacteria 844
569 Ga0501067_0015730 3300049583 Bacteria 4186
570 Ga0501068_0007768 3300049584 Bacteria 5940
571 Ga0501068_0314765 3300049584 Bacteria 1003
572 Ga0501070_0302956 3300049586 Bacteria 1302
573 Ga0501071_0020960 3300049587 Bacteria 4549
574 Ga0501072_0063844 3300049588 Bacteria 2905
575 Ga0501073_0002449 3300049589 Bacteria 13864
576 Ga0501074_0011278 3300049590 Bacteria 6497
577 Ga0501076_0052837 3300049592 Bacteria 3219
578 Ga0501077_0004270 3300049593 Bacteria 8639
579 Ga0501079_0000699 3300049741 Bacteria 22677
580 Ga0501083_0108265 3300049744 Bacteria 1828
581 Ga0501226_000009 3300049853 Bacteria 194138
582 nmdc:mga08x19_63809_c1 3300050514 Bacteria 2390
583 Ga0500583_0077839 3300053092 Bacteria 1597
584 Ga0500641_0047339 3300053096 Bacteria 1758
585 Ga0500650_0000086 3300053098 Bacteria 26596
586 Ga0500556_0001046 3300053104 Bacteria 14342
587 Ga0500617_054048 3300053124 Bacteria 1787
588 Ga0500628_107180 3300053129 Bacteria 746
589 Ga0500655_067047 3300053133 Bacteria 728
590 Ga0500658_0010613 3300053134 Bacteria 3398
591 Ga0500568_0036073 3300053139 Bacteria 2014
592 Ga0500568_0125454 3300053139 Bacteria 956
593 Ga0500616_0000075 3300053153 Bacteria 221455
594 Ga0500616_0046892 3300053153 Bacteria 2296
595 Ga0500616_0255531 3300053153 Bacteria 746
596 Ga0500656_002360 3300053732 Bacteria 1706
597 Ga0501084_0024083 3300054114 Bacteria 5077
598 Ga0501084_0277629 3300054114 Bacteria 1415
599 Ga0501082_0375004 3300060353 Bacteria 1241

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046506 Ga0495583_0193873 Ga0495583_0193873_73_693 195
2 3300005330 Ga0070690_100643858 Ga0070690_1006438581 196
3 3300005331 Ga0070670_100125563 Ga0070670_1001255632 196
4 3300005331 Ga0070670_100443998 Ga0070670_1004439982 196
5 3300005333 Ga0070677_10016480 Ga0070677_100164804 196
6 3300005333 Ga0070677_10017058 Ga0070677_100170583 196
7 3300005338 Ga0068868_100322814 Ga0068868_1003228142 196
8 3300005354 Ga0070675_100024236 Ga0070675_1000242363 196
9 3300005356 Ga0070674_100107537 Ga0070674_1001075371 196
10 3300005356 Ga0070674_100117125 Ga0070674_1001171251 196
11 3300005364 Ga0070673_100008710 Ga0070673_1000087102 196
12 3300005364 Ga0070673_100296696 Ga0070673_1002966962 196
13 3300005441 Ga0070700_100137406 Ga0070700_1001374062 196
14 3300005456 Ga0070678_100021992 Ga0070678_1000219924 196
15 3300005459 Ga0068867_100057821 Ga0068867_1000578212 196
16 3300005466 Ga0070685_10034296 Ga0070685_100342962 196
17 3300005543 Ga0070672_100004027 Ga0070672_1000040274 196
18 3300005543 Ga0070672_100022337 Ga0070672_1000223375 196
19 3300005548 Ga0070665_100611884 Ga0070665_1006118841 196
20 3300005614 Ga0068856_100121245 Ga0068856_1001212452 196
21 3300005617 Ga0068859_100032042 Ga0068859_1000320423 196
22 3300005719 Ga0068861_100304550 Ga0068861_1003045502 196
23 3300005834 Ga0068851_10228226 Ga0068851_102282261 196
24 3300005840 Ga0068870_10001989 Ga0068870_100019896 196
25 3300005840 Ga0068870_10082565 Ga0068870_100825652 196
26 3300005841 Ga0068863_100003628 Ga0068863_1000036284 196
27 3300005841 Ga0068863_100071918 Ga0068863_1000719182 196
28 3300005842 Ga0068858_100018434 Ga0068858_1000184342 196
29 3300005843 Ga0068860_100000274 Ga0068860_10000027441 196
30 3300006163 Ga0070715_10217577 Ga0070715_102175772 196
31 3300006237 Ga0097621_100179596 Ga0097621_1001795962 196
32 3300006881 Ga0068865_100509266 Ga0068865_1005092662 196
33 3300006881 Ga0068865_100572046 Ga0068865_1005720462 196
34 3300006931 Ga0097620_100032042 Ga0097620_1000320422 196
35 3300009093 Ga0105240_10008879 Ga0105240_100088799 196
36 3300009176 Ga0105242_10552344 Ga0105242_105523442 196
37 3300010375 Ga0105239_10025606 Ga0105239_100256063 196
38 3300013296 Ga0157374_10132583 Ga0157374_101325831 196
39 3300014969 Ga0157376_10031227 Ga0157376_100312271 196
40 3300014969 Ga0157376_10032550 Ga0157376_100325505 196
41 3300017792 Ga0163161_10040256 Ga0163161_100402565 196
42 3300025893 Ga0207682_10009116 Ga0207682_100091161 196
43 3300025893 Ga0207682_10020839 Ga0207682_100208394 196
44 3300025899 Ga0207642_10083734 Ga0207642_100837342 196
45 3300025900 Ga0207710_10074493 Ga0207710_100744932 196
46 3300025908 Ga0207643_10009378 Ga0207643_100093783 196
47 3300025908 Ga0207643_10050945 Ga0207643_100509452 196
48 3300025913 Ga0207695_10037335 Ga0207695_100373353 196
49 3300025913 Ga0207695_10067312 Ga0207695_100673122 196
50 3300025923 Ga0207681_10297283 Ga0207681_102972831 196
51 3300025925 Ga0207650_10529205 Ga0207650_105292051 196
52 3300025926 Ga0207659_10032055 Ga0207659_100320554 196
53 3300025931 Ga0207644_10398026 Ga0207644_103980262 196
54 3300025933 Ga0207706_10309385 Ga0207706_103093852 196
55 3300025934 Ga0207686_10137264 Ga0207686_101372642 196
56 3300025940 Ga0207691_10003456 Ga0207691_1000345611 196
57 3300025942 Ga0207689_10090719 Ga0207689_100907193 196
58 3300025960 Ga0207651_10031031 Ga0207651_100310312 196
59 3300025960 Ga0207651_10045213 Ga0207651_100452132 196
60 3300025981 Ga0207640_10374339 Ga0207640_103743391 196
61 3300025986 Ga0207658_10352747 Ga0207658_103527472 196
62 3300026023 Ga0207677_10210816 Ga0207677_102108162 196
63 3300026035 Ga0207703_10001570 Ga0207703_1000157016 196
64 3300026067 Ga0207678_10968639 Ga0207678_109686391 196
65 3300026075 Ga0207708_10182924 Ga0207708_101829242 196
66 3300026078 Ga0207702_10199566 Ga0207702_101995662 196
67 3300026088 Ga0207641_10000290 Ga0207641_1000029030 196
68 3300026088 Ga0207641_10074438 Ga0207641_100744384 196
69 3300026089 Ga0207648_10032625 Ga0207648_100326252 196
70 3300026095 Ga0207676_10157103 Ga0207676_101571032 196
71 3300026118 Ga0207675_100080746 Ga0207675_1000807464 196
72 3300026121 Ga0207683_10054110 Ga0207683_100541102 196
73 3300026121 Ga0207683_10081437 Ga0207683_100814374 196
74 3300028381 Ga0268264_10000058 Ga0268264_10000058292 196
75 3300028381 Ga0268264_10000060 Ga0268264_10000060286 196
76 3300031824 Ga0307413_10250470 Ga0307413_102504701 196
77 3300031852 Ga0307410_10069546 Ga0307410_100695462 196
78 3300031852 Ga0307410_10373237 Ga0307410_103732371 196
79 3300031911 Ga0307412_10197362 Ga0307412_101973622 196
80 3300041460 Ga0451802_0702001 Ga0451802_0702001_77_667 196
81 3300046519 Ga0495632_0013127 Ga0495632_0013127_392_982 196
82 3300046648 Ga0495611_0389583 Ga0495611_0389583_14_604 196
83 3300046660 Ga0495625_0022716 Ga0495625_0022716_1979_2569 196
84 3300046684 Ga0495669_0176108 Ga0495669_0176108_57_647 196
85 3300049581 Ga0501047_0683745 Ga0501047_0683745_173_763 196
86 3300053129 Ga0500628_107180 Ga0500628_107180_119_709 196
87 3300028794 Ga0307515_10070359 Ga0307515_100703592 197
88 3300025986 Ga0207658_11032027 Ga0207658_110320271 198
89 3300026067 Ga0207678_10312040 Ga0207678_103120402 198
90 3300046455 Ga0495603_0417240 Ga0495603_0417240_162_758 198
91 3300046616 Ga0495668_0022887 Ga0495668_0022887_1666_2262 198
92 3300048088 Ga0495602_0423440 Ga0495602_0423440_303_899 198
93 3300041452 Ga0451793_1836681 Ga0451793_1836681_253_855 200
94 iso_pu_bacteria 2510065053 2510281765 202
95 iso_pu_bacteria 2510065055 2510292068 202
96 iso_pu_bacteria 2510065058 2510309913 202
97 iso_pu_bacteria 2738541276 2738716297 202
98 iso_pu_bacteria 2773857672 2774130087 202
99 iso_pu_bacteria 2808606373 2808907782 202
100 iso_pu_bacteria 2917832318 2917832595 202
101 iso_pu_bacteria 2919125081 2919125369 202
102 iso_pu_bacteria 2974298342 2974300460 202
103 iso_pu_bacteria 2984504281 2984508573 202
104 iso_pu_bacteria 8016728285 8016729169 202
105 3300048920 Ga0496117_0181589 Ga0496117_0181589_539_1150 203
106 3300025920 Ga0207649_10084219 Ga0207649_100842193 204
107 iso_pu_bacteria 2984499530 2984502852 204
108 3300037853 Ga0436364_0130364 Ga0436364_0130364_140_757 205
109 3300039447 Ga0436361_0990724 Ga0436361_0990724_119_736 205
110 3300005329 Ga0070683_100075371 Ga0070683_1000753714 206
111 3300005331 Ga0070670_100000026 Ga0070670_10000002677 206
112 3300005335 Ga0070666_10140565 Ga0070666_101405652 206
113 3300005336 Ga0070680_100021104 Ga0070680_1000211042 206
114 3300005337 Ga0070682_100048562 Ga0070682_1000485622 206
115 3300005347 Ga0070668_100635461 Ga0070668_1006354611 206
116 3300005355 Ga0070671_100000058 Ga0070671_10000005816 206
117 3300005365 Ga0070688_100001801 Ga0070688_10000180111 206
118 3300005367 Ga0070667_100000002 Ga0070667_100000002226 206
119 3300005367 Ga0070667_100463521 Ga0070667_1004635212 206
120 3300005367 Ga0070667_100600681 Ga0070667_1006006812 206
121 3300005435 Ga0070714_100700776 Ga0070714_1007007761 206
122 3300005436 Ga0070713_100098048 Ga0070713_1000980482 206
123 3300005455 Ga0070663_100086223 Ga0070663_1000862232 206
124 3300005458 Ga0070681_10029013 Ga0070681_100290132 206
125 3300005458 Ga0070681_10057902 Ga0070681_100579024 206
126 3300005458 Ga0070681_10083399 Ga0070681_100833994 206
127 3300005466 Ga0070685_10000009 Ga0070685_1000000925 206
128 3300005530 Ga0070679_100004487 Ga0070679_1000044878 206
129 3300005530 Ga0070679_100021104 Ga0070679_1000211042 206
130 3300005530 Ga0070679_100032153 Ga0070679_1000321535 206
131 3300005530 Ga0070679_100065827 Ga0070679_1000658273 206
132 3300005530 Ga0070679_100261453 Ga0070679_1002614532 206
133 3300005530 Ga0070679_100355789 Ga0070679_1003557892 206
134 3300005535 Ga0070684_100080193 Ga0070684_1000801934 206
135 3300005535 Ga0070684_100332557 Ga0070684_1003325572 206
136 3300005539 Ga0068853_100164936 Ga0068853_1001649362 206
137 3300005547 Ga0070693_100078840 Ga0070693_1000788402 206
138 3300005548 Ga0070665_100005431 Ga0070665_1000054319 206
139 3300005548 Ga0070665_100021539 Ga0070665_1000215395 206
140 3300005548 Ga0070665_100026031 Ga0070665_1000260317 206
141 3300005548 Ga0070665_100291049 Ga0070665_1002910491 206
142 3300005563 Ga0068855_100007608 Ga0068855_1000076085 206
143 3300005563 Ga0068855_100062151 Ga0068855_1000621512 206
144 3300005563 Ga0068855_100106151 Ga0068855_1001061511 206
145 3300005563 Ga0068855_100116201 Ga0068855_1001162013 206
146 3300005578 Ga0068854_100054942 Ga0068854_1000549422 206
147 3300005614 Ga0068856_100142179 Ga0068856_1001421792 206
148 3300005617 Ga0068859_100034325 Ga0068859_1000343252 206
149 3300005618 Ga0068864_100000002 Ga0068864_100000002251 206
150 3300005719 Ga0068861_100012556 Ga0068861_1000125566 206
151 3300005719 Ga0068861_100123964 Ga0068861_1001239642 206
152 3300005842 Ga0068858_100173808 Ga0068858_1001738082 206
153 3300005842 Ga0068858_100597097 Ga0068858_1005970972 206
154 3300005843 Ga0068860_100000684 Ga0068860_10000068433 206
155 3300005844 Ga0068862_100016178 Ga0068862_1000161782 206
156 3300005844 Ga0068862_100184704 Ga0068862_1001847042 206
157 3300006237 Ga0097621_100354410 Ga0097621_1003544102 206
158 3300006358 Ga0068871_100338738 Ga0068871_1003387382 206
159 3300006358 Ga0068871_100520568 Ga0068871_1005205682 206
160 3300006881 Ga0068865_100334236 Ga0068865_1003342362 206
161 3300006931 Ga0097620_100034325 Ga0097620_1000343255 206
162 3300009093 Ga0105240_10016620 Ga0105240_100166202 206
163 3300009093 Ga0105240_10017821 Ga0105240_100178216 206
164 3300009093 Ga0105240_10095157 Ga0105240_100951573 206
165 3300009093 Ga0105240_10133648 Ga0105240_101336482 206
166 3300009093 Ga0105240_10154806 Ga0105240_101548062 206
167 3300009093 Ga0105240_10294654 Ga0105240_102946542 206
168 3300009093 Ga0105240_10497912 Ga0105240_104979122 206
169 3300009094 Ga0111539_10607081 Ga0111539_106070813 206
170 3300009094 Ga0111539_10939241 Ga0111539_109392412 206
171 3300009101 Ga0105247_10029168 Ga0105247_100291681 206
172 3300009174 Ga0105241_10180064 Ga0105241_101800642 206
173 3300009176 Ga0105242_10371496 Ga0105242_103714962 206
174 3300009177 Ga0105248_10112443 Ga0105248_101124432 206
175 3300009177 Ga0105248_10132383 Ga0105248_101323832 206
176 3300009177 Ga0105248_10368724 Ga0105248_103687242 206
177 3300009545 Ga0105237_10074676 Ga0105237_100746764 206
178 3300009545 Ga0105237_10207353 Ga0105237_102073532 206
179 3300009545 Ga0105237_10217420 Ga0105237_102174202 206
180 3300009545 Ga0105237_10274087 Ga0105237_102740872 206
181 3300009545 Ga0105237_10276752 Ga0105237_102767522 206
182 3300009545 Ga0105237_11175503 Ga0105237_111755031 206
183 3300009551 Ga0105238_10002313 Ga0105238_1000231311 206
184 3300009551 Ga0105238_10022722 Ga0105238_100227223 206
185 3300009551 Ga0105238_10059981 Ga0105238_100599812 206
186 3300009551 Ga0105238_10937504 Ga0105238_109375041 206
187 3300009553 Ga0105249_10108638 Ga0105249_101086382 206
188 3300009553 Ga0105249_10321731 Ga0105249_103217312 206
189 3300010375 Ga0105239_10394750 Ga0105239_103947502 206
190 3300010375 Ga0105239_10610628 Ga0105239_106106282 206
191 3300013102 Ga0157371_10003190 Ga0157371_100031902 206
192 3300013104 Ga0157370_10009142 Ga0157370_100091424 206
193 3300013105 Ga0157369_10017382 Ga0157369_100173822 206
194 3300013105 Ga0157369_10021722 Ga0157369_100217223 206
195 3300013105 Ga0157369_10096697 Ga0157369_100966972 206
196 3300013105 Ga0157369_10295654 Ga0157369_102956542 206
197 3300013296 Ga0157374_10200378 Ga0157374_102003782 206
198 3300013306 Ga0163162_10016055 Ga0163162_100160556 206
199 3300013307 Ga0157372_10072228 Ga0157372_100722284 206
200 3300013307 Ga0157372_10348016 Ga0157372_103480162 206
201 3300013307 Ga0157372_10373304 Ga0157372_103733042 206
202 3300013307 Ga0157372_10570057 Ga0157372_105700572 206
203 3300013307 Ga0157372_10682006 Ga0157372_106820061 206
204 3300014325 Ga0163163_10000081 Ga0163163_1000008193 206
205 3300014325 Ga0163163_10131148 Ga0163163_101311482 206
206 3300014325 Ga0163163_10476578 Ga0163163_104765782 206
207 3300014325 Ga0163163_10970527 Ga0163163_109705272 206
208 3300014326 Ga0157380_10058159 Ga0157380_100581594 206
209 3300014326 Ga0157380_10713779 Ga0157380_107137791 206
210 3300014326 Ga0157380_11083546 Ga0157380_110835462 206
211 3300014745 Ga0157377_10539971 Ga0157377_105399712 206
212 3300014968 Ga0157379_10022208 Ga0157379_100222084 206
213 3300014968 Ga0157379_10060171 Ga0157379_100601712 206
214 3300014969 Ga0157376_10368450 Ga0157376_103684502 206
215 3300020070 Ga0206356_10460238 Ga0206356_104602382 206
216 3300025898 Ga0207692_10138119 Ga0207692_101381192 206
217 3300025900 Ga0207710_10020394 Ga0207710_100203942 206
218 3300025903 Ga0207680_10030420 Ga0207680_100304202 206
219 3300025904 Ga0207647_10051744 Ga0207647_100517442 206
220 3300025912 Ga0207707_10005259 Ga0207707_1000525911 206
221 3300025912 Ga0207707_10012047 Ga0207707_100120474 206
222 3300025912 Ga0207707_10031276 Ga0207707_100312762 206
223 3300025912 Ga0207707_10163405 Ga0207707_101634053 206
224 3300025912 Ga0207707_10744727 Ga0207707_107447271 206
225 3300025913 Ga0207695_10008742 Ga0207695_100087425 206
226 3300025913 Ga0207695_10023623 Ga0207695_100236236 206
227 3300025913 Ga0207695_10029601 Ga0207695_100296012 206
228 3300025913 Ga0207695_10043328 Ga0207695_100433282 206
229 3300025913 Ga0207695_10094419 Ga0207695_100944192 206
230 3300025913 Ga0207695_10124600 Ga0207695_101246002 206
231 3300025913 Ga0207695_10218862 Ga0207695_102188622 206
232 3300025914 Ga0207671_10150471 Ga0207671_101504712 206
233 3300025914 Ga0207671_10183755 Ga0207671_101837551 206
234 3300025914 Ga0207671_10189717 Ga0207671_101897172 206
235 3300025917 Ga0207660_10004159 Ga0207660_100041593 206
236 3300025917 Ga0207660_10372958 Ga0207660_103729582 206
237 3300025921 Ga0207652_10044475 Ga0207652_100444752 206
238 3300025921 Ga0207652_10102243 Ga0207652_101022432 206
239 3300025921 Ga0207652_10231361 Ga0207652_102313612 206
240 3300025921 Ga0207652_10976386 Ga0207652_109763861 206
241 3300025924 Ga0207694_10103459 Ga0207694_101034592 206
242 3300025924 Ga0207694_10186287 Ga0207694_101862872 206
243 3300025924 Ga0207694_10288215 Ga0207694_102882152 206
244 3300025925 Ga0207650_10000002 Ga0207650_10000002247 206
245 3300025928 Ga0207700_10095529 Ga0207700_100955292 206
246 3300025931 Ga0207644_10000020 Ga0207644_1000002081 206
247 3300025941 Ga0207711_10000619 Ga0207711_1000061916 206
248 3300025944 Ga0207661_10227983 Ga0207661_102279832 206
249 3300025949 Ga0207667_10006536 Ga0207667_100065362 206
250 3300025949 Ga0207667_10024211 Ga0207667_100242112 206
251 3300025949 Ga0207667_10186652 Ga0207667_101866522 206
252 3300025961 Ga0207712_10190539 Ga0207712_101905392 206
253 3300025981 Ga0207640_10050142 Ga0207640_100501423 206
254 3300025986 Ga0207658_10000001 Ga0207658_100000011105 206
255 3300026035 Ga0207703_10020650 Ga0207703_100206504 206
256 3300026035 Ga0207703_10180767 Ga0207703_101807672 206
257 3300026078 Ga0207702_10059039 Ga0207702_100590393 206
258 3300026078 Ga0207702_11151143 Ga0207702_111511431 206
259 3300026088 Ga0207641_10016513 Ga0207641_100165134 206
260 3300026088 Ga0207641_10043240 Ga0207641_100432404 206
261 3300026095 Ga0207676_10000001 Ga0207676_10000001247 206
262 3300026116 Ga0207674_10658252 Ga0207674_106582521 206
263 3300026118 Ga0207675_100004461 Ga0207675_1000044617 206
264 3300026118 Ga0207675_100050538 Ga0207675_1000505382 206
265 3300028379 Ga0268266_10000704 Ga0268266_100007042 206
266 3300028379 Ga0268266_10010219 Ga0268266_100102198 206
267 3300028380 Ga0268265_10000258 Ga0268265_1000025842 206
268 3300028380 Ga0268265_10865062 Ga0268265_108650622 206
269 3300028381 Ga0268264_10000004 Ga0268264_10000004247 206
270 3300028573 Ga0265334_10031480 Ga0265334_100314802 206
271 3300028800 Ga0265338_10027456 Ga0265338_100274564 206
272 3300030521 Ga0307511_10022320 Ga0307511_100223204 206
273 3300031247 Ga0265340_10030088 Ga0265340_100300883 206
274 3300031250 Ga0265331_10027150 Ga0265331_100271502 206
275 3300031251 Ga0265327_10000282 Ga0265327_100002826 206
276 3300031456 Ga0307513_10084125 Ga0307513_100841252 206
277 3300031456 Ga0307513_10505620 Ga0307513_105056201 206
278 3300031456 Ga0307513_10519368 Ga0307513_105193682 206
279 3300031507 Ga0307509_10000048 Ga0307509_1000004854 206
280 3300031548 Ga0307408_100000721 Ga0307408_10000072116 206
281 3300031901 Ga0307406_10993697 Ga0307406_109936971 206
282 3300031903 Ga0307407_10098790 Ga0307407_100987902 206
283 3300031995 Ga0307409_100156196 Ga0307409_1001561961 206
284 3300031995 Ga0307409_100315927 Ga0307409_1003159272 206
285 3300032002 Ga0307416_100357846 Ga0307416_1003578462 206
286 3300032005 Ga0307411_10685378 Ga0307411_106853781 206
287 3300035724 Ga0373933_0191147 Ga0373933_0191147_270_890 206
288 3300037068 Ga0373925_0362882 Ga0373925_0362882_462_1082 206
289 3300037418 Ga0395900_0331445 Ga0395900_0331445_301_921 206
290 3300037418 Ga0395900_0985223 Ga0395900_0985223_103_723 206
291 3300037466 Ga0395898_0030669 Ga0395898_0030669_2002_2622 206
292 3300037466 Ga0395898_0103282 Ga0395898_0103282_916_1536 206
293 3300041451 Ga0451791_1935231 Ga0451791_1935231_723_1343 206
294 3300041452 Ga0451793_0376710 Ga0451793_0376710_101_721 206
295 3300041486 Ga0451807_0279481 Ga0451807_0279481_808_1428 206
296 3300041494 Ga0451837_1191953 Ga0451837_1191953_708_1328 206
297 3300041997 Ga0439431_0004348 Ga0439431_0004348_1179_1799 206
298 3300042000 Ga0439437_007994 Ga0439437_007994_324_944 206
299 3300042012 Ga0439455_0003927 Ga0439455_0003927_547_1167 206
300 3300042115 Ga0450911_000015 Ga0450911_000015_20993_21613 206
301 3300042132 Ga0450895_003648 Ga0450895_003648_441_1061 206
302 3300042136 Ga0450900_024920 Ga0450900_024920_13_633 206
303 3300042139 Ga0450904_000005 Ga0450904_000005_42163_42783 206
304 3300042156 Ga0439446_0011153 Ga0439446_0011153_434_1054 206
305 3300042438 Ga0439459_0003543 Ga0439459_0003543_542_1162 206
306 3300042438 Ga0439459_0042345 Ga0439459_0042345_106_726 206
307 3300042530 Ga0450916_000847 Ga0450916_000847_1072_1692 206
308 3300042530 Ga0450916_001487 Ga0450916_001487_876_1496 206
309 3300044693 Ga0466961_0102542 Ga0466961_0102542_465_1085 206
310 3300045049 Ga0466959_0558925 Ga0466959_0558925_31_651 206
311 3300046458 Ga0495591_048591 Ga0495591_048591_519_1139 206
312 3300046459 Ga0495629_0059962 Ga0495629_0059962_1261_1881 206
313 3300046460 Ga0495638_0063954 Ga0495638_0063954_238_858 206
314 3300046475 Ga0495639_0173725 Ga0495639_0173725_389_1009 206
315 3300046491 Ga0495584_0076955 Ga0495584_0076955_294_914 206
316 3300046499 Ga0495594_0509490 Ga0495594_0509490_18_638 206
317 3300046500 Ga0495596_0121296 Ga0495596_0121296_83_703 206
318 3300046507 Ga0495606_0054418 Ga0495606_0054418_1356_1976 206
319 3300046507 Ga0495606_0154118 Ga0495606_0154118_334_954 206
320 3300046511 Ga0495608_0465624 Ga0495608_0465624_101_721 206
321 3300046513 Ga0495616_0003020 Ga0495616_0003020_3833_4453 206
322 3300046515 Ga0495620_0043086 Ga0495620_0043086_1216_1836 206
323 3300046523 Ga0495644_0003534 Ga0495644_0003534_3790_4410 206
324 3300046524 Ga0495648_0283056 Ga0495648_0283056_135_755 206
325 3300046535 Ga0495586_0464502 Ga0495586_0464502_54_674 206
326 3300046539 Ga0495621_0004122 Ga0495621_0004122_276_896 206
327 3300046543 Ga0495645_0153953 Ga0495645_0153953_490_1110 206
328 3300046615 Ga0495656_0005412 Ga0495656_0005412_1197_1817 206
329 3300046616 Ga0495668_0069294 Ga0495668_0069294_1111_1731 206
330 3300046660 Ga0495625_0030402 Ga0495625_0030402_2245_2865 206
331 3300046681 Ga0495647_0011153 Ga0495647_0011153_2035_2655 206
332 3300046683 Ga0495658_0080882 Ga0495658_0080882_532_1152 206
333 3300046690 Ga0495624_0379951 Ga0495624_0379951_202_822 206
334 3300046692 Ga0495671_0015030 Ga0495671_0015030_583_1203 206
335 3300046694 Ga0495649_0001072 Ga0495649_0001072_16577_17197 206
336 3300046694 Ga0495649_0136398 Ga0495649_0136398_617_1237 206
337 3300047320 Ga0495672_0158277 Ga0495672_0158277_157_777 206
338 3300047443 Ga0495687_090888 Ga0495687_090888_16_636 206
339 3300047470 Ga0495681_0009447 Ga0495681_0009447_477_1097 206
340 3300048905 Ga0496102_0031702 Ga0496102_0031702_4021_4641 206
341 3300048909 Ga0496106_0509748 Ga0496106_0509748_147_767 206
342 3300048917 Ga0496114_0675054 Ga0496114_0675054_200_820 206
343 3300048918 Ga0496115_0353388 Ga0496115_0353388_490_1110 206
344 3300048918 Ga0496115_0711228 Ga0496115_0711228_151_771 206
345 3300048920 Ga0496117_0000090 Ga0496117_0000090_42553_43173 206
346 3300048921 Ga0496118_0000032 Ga0496118_0000032_161864_162484 206
347 3300048921 Ga0496118_0086731 Ga0496118_0086731_723_1343 206
348 3300048923 Ga0496120_0023689 Ga0496120_0023689_210_830 206
349 3300048924 Ga0496121_0084783 Ga0496121_0084783_1604_2224 206
350 3300048927 Ga0496124_0080960 Ga0496124_0080960_1275_1895 206
351 3300048928 Ga0496125_0000592 Ga0496125_0000592_36751_37371 206
352 3300048928 Ga0496125_0295350 Ga0496125_0295350_248_868 206
353 3300048929 Ga0496126_0021320 Ga0496126_0021320_213_833 206
354 3300048929 Ga0496126_0164527 Ga0496126_0164527_943_1563 206
355 3300049460 Ga0495682_0062585 Ga0495682_0062585_403_1023 206
356 3300049572 Ga0501036_0238443 Ga0501036_0238443_663_1283 206
357 3300049572 Ga0501036_0802485 Ga0501036_0802485_114_734 206
358 3300049574 Ga0501038_0692991 Ga0501038_0692991_99_719 206
359 3300049578 Ga0501042_0134422 Ga0501042_0134422_1066_1686 206
360 3300049586 Ga0501070_0302956 Ga0501070_0302956_479_1099 206
361 3300049853 Ga0501226_000009 Ga0501226_000009_87923_88543 206
362 3300053092 Ga0500583_0077839 Ga0500583_0077839_260_880 206
363 3300053096 Ga0500641_0047339 Ga0500641_0047339_354_974 206
364 3300053124 Ga0500617_054048 Ga0500617_054048_49_669 206
365 3300053133 Ga0500655_067047 Ga0500655_067047_65_685 206
366 3300053134 Ga0500658_0010613 Ga0500658_0010613_1234_1854 206
367 3300053139 Ga0500568_0036073 Ga0500568_0036073_405_1025 206
368 3300053139 Ga0500568_0125454 Ga0500568_0125454_39_659 206
369 3300053153 Ga0500616_0000075 Ga0500616_0000075_71283_71903 206
370 3300053153 Ga0500616_0255531 Ga0500616_0255531_44_664 206
371 3300053732 Ga0500656_002360 Ga0500656_002360_535_1155 206
372 3300054114 Ga0501084_0277629 Ga0501084_0277629_157_777 206
373 3300005330 Ga0070690_100295160 Ga0070690_1002951601 207
374 3300005337 Ga0070682_100076811 Ga0070682_1000768112 207
375 3300005341 Ga0070691_10062249 Ga0070691_100622492 207
376 3300005343 Ga0070687_100135554 Ga0070687_1001355542 207
377 3300005364 Ga0070673_100528335 Ga0070673_1005283352 207
378 3300005440 Ga0070705_100009609 Ga0070705_1000096094 207
379 3300005441 Ga0070700_100095543 Ga0070700_1000955432 207
380 3300005543 Ga0070672_100034320 Ga0070672_1000343204 207
381 3300005544 Ga0070686_100078137 Ga0070686_1000781372 207
382 3300005547 Ga0070693_100179181 Ga0070693_1001791812 207
383 3300005617 Ga0068859_100291642 Ga0068859_1002916422 207
384 3300005719 Ga0068861_100088371 Ga0068861_1000883711 207
385 3300005843 Ga0068860_100143532 Ga0068860_1001435322 207
386 3300006881 Ga0068865_100747670 Ga0068865_1007476701 207
387 3300006931 Ga0097620_100291632 Ga0097620_1002916322 207
388 3300009093 Ga0105240_10304043 Ga0105240_103040432 207
389 3300013308 Ga0157375_10069347 Ga0157375_100693474 207
390 3300025913 Ga0207695_10253613 Ga0207695_102536132 207
391 3300025914 Ga0207671_10463989 Ga0207671_104639891 207
392 3300025918 Ga0207662_10170287 Ga0207662_101702871 207
393 3300025936 Ga0207670_10086143 Ga0207670_100861432 207
394 3300025938 Ga0207704_10640822 Ga0207704_106408222 207
395 3300025940 Ga0207691_10013427 Ga0207691_100134275 207
396 3300025960 Ga0207651_10273063 Ga0207651_102730632 207
397 3300026035 Ga0207703_10332801 Ga0207703_103328012 207
398 3300026075 Ga0207708_10054431 Ga0207708_100544314 207
399 3300026118 Ga0207675_100004052 Ga0207675_10000405212 207
400 3300028381 Ga0268264_10552696 Ga0268264_105526962 207
401 3300031507 Ga0307509_10000074 Ga0307509_1000007437 207
402 3300033180 Ga0307510_10017304 Ga0307510_100173046 207
403 3300046648 Ga0495611_0255898 Ga0495611_0255898_22_645 207
404 3300047472 Ga0495686_0281442 Ga0495686_0281442_95_718 207
405 3300048929 Ga0496126_0007351 Ga0496126_0007351_8455_9078 207
406 3300005367 Ga0070667_100014844 Ga0070667_1000148443 208
407 3300005456 Ga0070678_100596251 Ga0070678_1005962512 208
408 3300005466 Ga0070685_10146087 Ga0070685_101460872 208
409 3300005548 Ga0070665_100017572 Ga0070665_1000175727 208
410 3300005617 Ga0068859_100004165 Ga0068859_10000416512 208
411 3300005841 Ga0068863_100000939 Ga0068863_10000093926 208
412 3300005842 Ga0068858_100000632 Ga0068858_10000063232 208
413 3300005843 Ga0068860_100077579 Ga0068860_1000775792 208
414 3300006931 Ga0097620_100004165 Ga0097620_1000041652 208
415 3300009011 Ga0105251_10008576 Ga0105251_100085763 208
416 3300009092 Ga0105250_10075358 Ga0105250_100753582 208
417 3300009101 Ga0105247_10000342 Ga0105247_100003424 208
418 3300009177 Ga0105248_10016662 Ga0105248_100166622 208
419 3300009553 Ga0105249_10052734 Ga0105249_100527343 208
420 3300013102 Ga0157371_10138854 Ga0157371_101388542 208
421 3300013105 Ga0157369_10012386 Ga0157369_100123861 208
422 3300013306 Ga0163162_10154546 Ga0163162_101545462 208
423 3300014968 Ga0157379_10096261 Ga0157379_100962612 208
424 3300025735 Ga0207713_1021127 Ga0207713_10211271 208
425 3300025900 Ga0207710_10000167 Ga0207710_1000016757 208
426 3300025903 Ga0207680_10215444 Ga0207680_102154442 208
427 3300025931 Ga0207644_10005739 Ga0207644_100057396 208
428 3300025941 Ga0207711_10115420 Ga0207711_101154202 208
429 3300025961 Ga0207712_10038119 Ga0207712_100381192 208
430 3300026035 Ga0207703_10001048 Ga0207703_1000104814 208
431 3300026088 Ga0207641_10020410 Ga0207641_100204103 208
432 3300026121 Ga0207683_10265491 Ga0207683_102654912 208
433 3300028381 Ga0268264_10053062 Ga0268264_100530622 208
434 3300031456 Ga0307513_10150915 Ga0307513_101509152 208
435 3300048905 Ga0496102_0021940 Ga0496102_0021940_1409_2035 208
436 3300048909 Ga0496106_0119110 Ga0496106_0119110_377_1003 208
437 3300048910 Ga0496107_0110958 Ga0496107_0110958_112_738 208
438 3300048911 Ga0496108_0025478 Ga0496108_0025478_460_1086 208
439 3300048916 Ga0496113_0657191 Ga0496113_0657191_57_683 208
440 3300048924 Ga0496121_0001021 Ga0496121_0001021_7334_7960 208
441 3300048928 Ga0496125_0095016 Ga0496125_0095016_279_905 208
442 3300053098 Ga0500650_0000086 Ga0500650_0000086_8860_9486 208
443 3300053153 Ga0500616_0046892 Ga0500616_0046892_27_653 208
444 3300006237 Ga0097621_100189645 Ga0097621_1001896452 209
445 3300009176 Ga0105242_10869935 Ga0105242_108699351 209
446 3300031507 Ga0307509_10321086 Ga0307509_103210862 209
447 3300039447 Ga0436361_0268579 Ga0436361_0268579_165_794 209
448 3300039450 Ga0436363_0120822 Ga0436363_0120822_2384_3013 209
449 3300048927 Ga0496124_0031151 Ga0496124_0031151_3948_4577 209
450 2162886007 SwRhRL2b_contig_1007197 SwRhRL2b_0251.00008130 210
451 3300005289 Ga0065704_10080259 Ga0065704_100802595 210
452 3300005331 Ga0070670_100059702 Ga0070670_1000597023 210
453 3300005337 Ga0070682_100046954 Ga0070682_1000469543 210
454 3300005337 Ga0070682_100108904 Ga0070682_1001089042 210
455 3300005340 Ga0070689_100360958 Ga0070689_1003609582 210
456 3300005341 Ga0070691_10038441 Ga0070691_100384413 210
457 3300005344 Ga0070661_100177430 Ga0070661_1001774302 210
458 3300005345 Ga0070692_10193805 Ga0070692_101938052 210
459 3300005354 Ga0070675_100293661 Ga0070675_1002936612 210
460 3300005364 Ga0070673_100172465 Ga0070673_1001724652 210
461 3300005366 Ga0070659_100139973 Ga0070659_1001399732 210
462 3300005455 Ga0070663_100101924 Ga0070663_1001019245 210
463 3300005539 Ga0068853_100745931 Ga0068853_1007459312 210
464 3300005543 Ga0070672_100114800 Ga0070672_1001148004 210
465 3300005564 Ga0070664_100042124 Ga0070664_1000421245 210
466 3300005577 Ga0068857_100418707 Ga0068857_1004187073 210
467 3300005617 Ga0068859_100507112 Ga0068859_1005071122 210
468 3300005719 Ga0068861_100041647 Ga0068861_1000416475 210
469 3300005843 Ga0068860_100683029 Ga0068860_1006830292 210
470 3300005844 Ga0068862_100049028 Ga0068862_1000490282 210
471 3300006237 Ga0097621_100142958 Ga0097621_1001429582 210
472 3300006846 Ga0075430_100513442 Ga0075430_1005134422 210
473 3300006931 Ga0097620_100507099 Ga0097620_1005070992 210
474 3300013308 Ga0157375_11072891 Ga0157375_110728911 210
475 3300014325 Ga0163163_10087399 Ga0163163_100873993 210
476 3300014326 Ga0157380_10002827 Ga0157380_100028274 210
477 3300014326 Ga0157380_10626218 Ga0157380_106262181 210
478 3300025901 Ga0207688_10373321 Ga0207688_103733212 210
479 3300025907 Ga0207645_10122995 Ga0207645_101229951 210
480 3300025918 Ga0207662_10034463 Ga0207662_100344635 210
481 3300025919 Ga0207657_10666860 Ga0207657_106668601 210
482 3300025925 Ga0207650_10046571 Ga0207650_100465713 210
483 3300025926 Ga0207659_10332095 Ga0207659_103320952 210
484 3300025938 Ga0207704_10356298 Ga0207704_103562982 210
485 3300025940 Ga0207691_10145671 Ga0207691_101456714 210
486 3300025945 Ga0207679_10126867 Ga0207679_101268673 210
487 3300025945 Ga0207679_10480313 Ga0207679_104803132 210
488 3300025960 Ga0207651_10653585 Ga0207651_106535852 210
489 3300025961 Ga0207712_10893522 Ga0207712_108935221 210
490 3300026035 Ga0207703_10709624 Ga0207703_107096242 210
491 3300026067 Ga0207678_10140164 Ga0207678_101401643 210
492 3300026075 Ga0207708_10063667 Ga0207708_100636673 210
493 3300026118 Ga0207675_100130703 Ga0207675_1001307031 210
494 3300028380 Ga0268265_10006412 Ga0268265_100064124 210
495 3300031548 Ga0307408_100043705 Ga0307408_1000437052 210
496 3300031824 Ga0307413_10007099 Ga0307413_100070995 210
497 3300031852 Ga0307410_10411932 Ga0307410_104119322 210
498 3300031995 Ga0307409_100193094 Ga0307409_1001930943 210
499 3300032002 Ga0307416_100036124 Ga0307416_1000361242 210
500 3300032005 Ga0307411_10684534 Ga0307411_106845342 210
501 3300041443 Ga0451789_0468735 Ga0451789_0468735_135_767 210
502 3300041443 Ga0451789_0554294 Ga0451789_0554294_302_934 210
503 3300041451 Ga0451791_1713758 Ga0451791_1713758_678_1310 210
504 3300041459 Ga0451800_0252305 Ga0451800_0252305_1581_2213 210
505 3300041486 Ga0451807_0302049 Ga0451807_0302049_1280_1912 210
506 3300041486 Ga0451807_1583312 Ga0451807_1583312_1130_1762 210
507 3300041512 Ga0451853_3663875 Ga0451853_3663875_15_647 210
508 3300048907 Ga0496104_0392440 Ga0496104_0392440_86_718 210
509 3300049575 Ga0501039_0163988 Ga0501039_0163988_359_991 210
510 3300049583 Ga0501067_0015730 Ga0501067_0015730_2991_3623 210
511 3300049584 Ga0501068_0007768 Ga0501068_0007768_4817_5449 210
512 3300049584 Ga0501068_0314765 Ga0501068_0314765_325_957 210
513 3300049587 Ga0501071_0020960 Ga0501071_0020960_3348_3980 210
514 3300049588 Ga0501072_0063844 Ga0501072_0063844_1581_2213 210
515 3300049589 Ga0501073_0002449 Ga0501073_0002449_11412_12044 210
516 3300049590 Ga0501074_0011278 Ga0501074_0011278_5201_5833 210
517 3300049592 Ga0501076_0052837 Ga0501076_0052837_1777_2409 210
518 3300049593 Ga0501077_0004270 Ga0501077_0004270_179_811 210
519 3300049741 Ga0501079_0000699 Ga0501079_0000699_13633_14265 210
520 3300049744 Ga0501083_0108265 Ga0501083_0108265_207_839 210
521 3300054114 Ga0501084_0024083 Ga0501084_0024083_1948_2580 210
522 3300060353 Ga0501082_0375004 Ga0501082_0375004_186_818 210
523 3300006931 Ga0097620_100545817 Ga0097620_1005458172 211
524 3300028381 Ga0268264_10163449 Ga0268264_101634492 211
525 2162886012 MBSR1b_contig_4575008 MBSR1b_0919.00000220 212
526 3300005335 Ga0070666_10124124 Ga0070666_101241242 212
527 3300005338 Ga0068868_100204151 Ga0068868_1002041512 212
528 3300005355 Ga0070671_100010865 Ga0070671_1000108657 212
529 3300005364 Ga0070673_100334286 Ga0070673_1003342862 212
530 3300005367 Ga0070667_100077403 Ga0070667_1000774032 212
531 3300005437 Ga0070710_10016709 Ga0070710_100167092 212
532 3300005546 Ga0070696_100118350 Ga0070696_1001183502 212
533 3300005547 Ga0070693_100759609 Ga0070693_1007596091 212
534 3300005614 Ga0068856_100042897 Ga0068856_1000428973 212
535 3300005617 Ga0068859_100371832 Ga0068859_1003718322 212
536 3300005842 Ga0068858_100069744 Ga0068858_1000697443 212
537 3300005843 Ga0068860_100182139 Ga0068860_1001821393 212
538 3300006173 Ga0070716_100044363 Ga0070716_1000443634 212
539 3300006173 Ga0070716_100106384 Ga0070716_1001063842 212
540 3300006175 Ga0070712_100010849 Ga0070712_1000108494 212
541 3300006881 Ga0068865_100017170 Ga0068865_1000171706 212
542 3300006914 Ga0075436_100074188 Ga0075436_1000741882 212
543 3300006931 Ga0097620_100371861 Ga0097620_1003718612 212
544 3300009098 Ga0105245_10283516 Ga0105245_102835162 212
545 3300009101 Ga0105247_10020146 Ga0105247_100201464 212
546 3300009174 Ga0105241_10058262 Ga0105241_100582625 212
547 3300009174 Ga0105241_10251989 Ga0105241_102519892 212
548 3300009177 Ga0105248_10218175 Ga0105248_102181752 212
549 3300009545 Ga0105237_10119763 Ga0105237_101197633 212
550 3300009551 Ga0105238_10405033 Ga0105238_104050332 212
551 3300009553 Ga0105249_10223695 Ga0105249_102236952 212
552 3300013306 Ga0163162_10564450 Ga0163162_105644502 212
553 3300014325 Ga0163163_10141824 Ga0163163_101418242 212
554 3300014968 Ga0157379_10125478 Ga0157379_101254782 212
555 3300025899 Ga0207642_10060928 Ga0207642_100609283 212
556 3300025903 Ga0207680_10250405 Ga0207680_102504052 212
557 3300025911 Ga0207654_10303290 Ga0207654_103032902 212
558 3300025914 Ga0207671_10457199 Ga0207671_104571991 212
559 3300025915 Ga0207693_10004507 Ga0207693_1000450711 212
560 3300025931 Ga0207644_10032383 Ga0207644_100323833 212
561 3300025934 Ga0207686_10466315 Ga0207686_104663151 212
562 3300025939 Ga0207665_10018494 Ga0207665_100184944 212
563 3300025961 Ga0207712_10132619 Ga0207712_101326192 212
564 3300025986 Ga0207658_10447122 Ga0207658_104471222 212
565 3300026023 Ga0207677_10054642 Ga0207677_100546422 212
566 3300026035 Ga0207703_10165873 Ga0207703_101658732 212
567 3300026095 Ga0207676_11002915 Ga0207676_110029151 212
568 3300026121 Ga0207683_10008549 Ga0207683_1000854910 212
569 3300035086 Ga0373934_0212027 Ga0373934_0212027_134_772 212
570 3300035118 Ga0373954_0046888 Ga0373954_0046888_736_1374 212
571 3300036401 Ga0373937_0009441 Ga0373937_0009441_3014_3652 212
572 3300036401 Ga0373937_0047167 Ga0373937_0047167_124_762 212
573 3300037068 Ga0373925_0064459 Ga0373925_0064459_741_1379 212
574 3300046460 Ga0495638_0342626 Ga0495638_0342626_50_688 212
575 3300046472 Ga0495580_0000463 Ga0495580_0000463_27469_28107 212
576 3300046472 Ga0495580_0018248 Ga0495580_0018248_757_1395 212
577 3300046472 Ga0495580_0022811 Ga0495580_0022811_346_984 212
578 3300046517 Ga0495630_0035598 Ga0495630_0035598_2966_3604 212
579 3300046529 Ga0495652_0457956 Ga0495652_0457956_204_842 212
580 3300046678 Ga0495599_0189339 Ga0495599_0189339_578_1216 212
581 3300048903 Ga0496100_0036452 Ga0496100_0036452_513_1151 212
582 3300048904 Ga0496101_0084436 Ga0496101_0084436_1525_2163 212
583 3300048905 Ga0496102_0080064 Ga0496102_0080064_964_1602 212
584 3300048907 Ga0496104_0067057 Ga0496104_0067057_2550_3188 212
585 3300048909 Ga0496106_0034604 Ga0496106_0034604_312_950 212
586 3300048910 Ga0496107_0028231 Ga0496107_0028231_2534_3172 212
587 3300048911 Ga0496108_0093701 Ga0496108_0093701_731_1369 212
588 3300048912 Ga0496109_0235104 Ga0496109_0235104_578_1216 212
589 3300048914 Ga0496111_0019598 Ga0496111_0019598_1389_2027 212
590 3300048916 Ga0496113_0262365 Ga0496113_0262365_640_1278 212
591 3300048918 Ga0496115_0057745 Ga0496115_0057745_1456_2094 212
592 3300050514 nmdc:mga08x19_63809_c1 nmdc:mga08x19_63809_c1_558_1196 212
593 3300005344 Ga0070661_100156005 Ga0070661_1001560052 214
594 3300005548 Ga0070665_100040364 Ga0070665_1000403642 214
595 3300005616 Ga0068852_100968201 Ga0068852_1009682011 214
596 3300005618 Ga0068864_100359696 Ga0068864_1003596963 214
597 3300005844 Ga0068862_100086644 Ga0068862_1000866443 214
598 3300009093 Ga0105240_10037201 Ga0105240_100372014 214
599 3300009553 Ga0105249_10063862 Ga0105249_100638623 214
600 3300013296 Ga0157374_10556548 Ga0157374_105565482 214
601 3300025913 Ga0207695_10152530 Ga0207695_101525303 214
602 3300028380 Ga0268265_10068570 Ga0268265_100685703 214
603 3300053104 Ga0500556_0001046 Ga0500556_0001046_12514_13161 214
604 3300005289 Ga0065704_10205487 Ga0065704_102054872 221
605 3300032005 Ga0307411_10011187 Ga0307411_100111877 221
606 3300035113 Ga0373936_0001995 Ga0373936_0001995_1438_2118 223
607 3300005367 Ga0070667_100000052 Ga0070667_100000052130 232
608 3300025986 Ga0207658_10000250 Ga0207658_1000025035 232
609 2162886006 SwRhRL3b_contig_688512 SwRhRL3b_0039.00001550 242
610 3300005289 Ga0065704_10194096 Ga0065704_101940962 242
611 3300005295 Ga0065707_10082291 Ga0065707_100822917 242

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01728

FtsJ

FtsJ-like methyltransferase

56

232

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ej0-assembly1.cif.gz_A ftsj rna methyltransferase complexed with s-adenosylmethionine, mercury derivative 0.9739 57 234
8i9v-assembly1.cif.gz_CS cryo-em structure of a chaetomium thermophilum pre-60s ribosomal subunit - state dbp10-2 0.9603 45 236
1ej0-assembly1.cif.gz_A ftsj rna methyltransferase complexed with s-adenosylmethionine, mercury derivative 0.958 57 234
8ia0-assembly1.cif.gz_CS cryo-em structure of a chaetomium thermophilum pre-60s ribosomal subunit - state puf6 0.9564 45 236
7nac-assembly1.cif.gz_w state e2 nucleolar 60s ribosomal biogenesis intermediate - composite model 0.9554 45 236
ID Description Score Start End Superfamily
1ej0A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9739 57 234 3.40.50.150
af_Q9VDT6_58_249_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9672 56 234 3.40.50.150
af_Q5RJT2_23_207_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9609 56 232 3.40.50.150
1ej0A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.958 57 234 3.40.50.150
af_F4JTD2_19_207_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9577 55 232 3.40.50.150
ID Description Score Start End GO Terms
AF-C6DKI3-F1-model_v4 Ribosomal RNA large subunit methyltransferase E (EC 2.1.1.166) (23S rRNA Um2552 methyltransferase) (rRNA (uridine-2'-O-)-methyltransferase) 0.9806 28 233 GO:0005737
GO:0008650
AF-A0A3E1K5Q8-F1-model_v4 Ribosomal RNA large subunit methyltransferase E (EC 2.1.1.166) (23S rRNA Um2552 methyltransferase) (rRNA (uridine-2'-O-)-methyltransferase) 0.9804 38 233 GO:0005737
GO:0008650
AF-A0A0M0BM05-F1-model_v4 Ribosomal RNA methyltransferase FtsJ domain-containing protein 0.9804 159 240 GO:0001510
GO:0006364
GO:0008173
AF-A0A844HXV2-F1-model_v4 Ribosomal RNA large subunit methyltransferase E (EC 2.1.1.166) (23S rRNA Um2552 methyltransferase) (rRNA (uridine-2'-O-)-methyltransferase) 0.98 64 233 GO:0008650
AF-B4TJ16-F1-model_v4 Ribosomal RNA large subunit methyltransferase E (EC 2.1.1.166) (23S rRNA Um2552 methyltransferase) (rRNA (uridine-2'-O-)-methyltransferase) 0.9793 26 233 GO:0005737
GO:0008650

Feature Viewer

pLDDT pTM Quality
81.76 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map