F469032
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 611 | 301 | 599 | 206 |
Family's Representative Sequence
| Representative Sequence | 3300005289|Ga0065704_10194096|Ga0065704_101940962 |
| Length | 242 |
| Sequence | MYILDGYPDRGAKRWLESRPIISPLSFVMARSKSSGQWLQQHINDPYVKQAQKDGYRSRSAYKLIQLNEKDRLIRPGMLVVDLGSSPGGWSQVAGRLVGARGRVVATDILPMDSLTNVEFIQGDFTDDSVLAQILEALGGNKPDLVICDIAPNITGIDSADQAASMYLVELALDLVRQVIKPSGNFVTKVFQGAGSDDYLKQVRTSFEKVSVRKPAASRPRSREVYIVAKGFKPDPVAETLL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886006 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 4 | 2510065053 | Pseudomonas sp. MOIL14HWK12:I1 | Isolate | Rhizosphere |
| 5 | 2510065055 | Pseudomonas sp. MOIL14HWK12:I2 | Isolate | Rhizosphere |
| 6 | 2510065058 | Pseudomonas oleovorans MOIL14HWK12 | Isolate | Rhizosphere |
| 7 | 2738541276 | Cellvibrio sp. YR554 | Isolate | Unclassified |
| 8 | 2773857672 | Pseudomonas sp. 1766 | Isolate | Unclassified |
| 9 | 2808606373 | Pseudomonas sp. SLBN-2 | Isolate | Unclassified |
| 10 | 2917832318 | Pseudomonas rhizoryzae RY24 | Isolate | Unclassified |
| 11 | 2919125081 | Pseudomonas psychrotolerans 1545 | Isolate | Rhizosphere |
| 12 | 2974298342 | Pseudomonas sp. SORGH_AS 211 | Isolate | Unclassified |
| 13 | 2984499530 | Pseudomonas sp. SORGH_AS199 | Isolate | Aerial Root |
| 14 | 2984504281 | Pseudomonas psychrotolerans SORGH_AS201 | Isolate | Aerial Root |
| 15 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 25 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 47 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 51 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 57 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 59 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 60 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 61 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 62 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 63 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 64 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 65 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 66 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 71 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 76 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 77 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 78 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 79 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 107 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 163 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 164 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 165 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 166 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 167 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 168 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 169 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 170 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 171 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 172 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 173 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 174 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 175 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 176 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 177 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 178 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 179 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 180 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 181 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 182 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 183 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 184 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 185 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 186 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 187 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 188 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 189 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 190 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 191 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 192 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 193 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 194 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 195 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 196 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 197 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 198 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 199 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 200 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 201 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 202 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 203 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 204 | 3300042132 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 | Metagenome | Rhizosphere |
| 205 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 206 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 207 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 208 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 209 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 210 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 211 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 212 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 251 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 252 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 253 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 254 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 255 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 256 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 257 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 258 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 259 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 260 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 261 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 262 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 263 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 264 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 265 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 266 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 267 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 268 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 269 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 287 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 289 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 290 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 291 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 292 | 3300053124 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere | Metagenome | Endosphere |
| 293 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 294 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 295 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 296 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 297 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 298 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 299 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 301 | 8016728285 | Pseudomonas psychrotolerans SORGH_AS 227 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.87 |
| Metatranscriptomes | 0.16 |
| Isolates | 1.96 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.33 |
| Bulb | 0 |
| Endosphere | 2.29 |
| Nodule | 0 |
| Rhizoplane | 5.4 |
| Rhizosphere | 86.25 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.73 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL3b_contig_688512 | 2162886006 | Bacteria | 1153 |
| 2 | SwRhRL2b_contig_1007197 | 2162886007 | Bacteria | 1875 |
| 3 | MBSR1b_contig_4575008 | 2162886012 | Bacteria | 1222 |
| 4 | Ga0065704_10080259 | 3300005289 | Bacteria | 3981 |
| 5 | Ga0065704_10194096 | 3300005289 | Bacteria | 1176 |
| 6 | Ga0065704_10205487 | 3300005289 | Bacteria | 1129 |
| 7 | Ga0065707_10082291 | 3300005295 | Bacteria | 17356 |
| 8 | Ga0070683_100075371 | 3300005329 | Bacteria | 3152 |
| 9 | Ga0070690_100295160 | 3300005330 | Bacteria | 1160 |
| 10 | Ga0070690_100643858 | 3300005330 | Bacteria | 809 |
| 11 | Ga0070670_100000026 | 3300005331 | Bacteria | 187946 |
| 12 | Ga0070670_100059702 | 3300005331 | Bacteria | 3274 |
| 13 | Ga0070670_100125563 | 3300005331 | Bacteria | 2215 |
| 14 | Ga0070670_100443998 | 3300005331 | Unclassified | 1149 |
| 15 | Ga0070677_10016480 | 3300005333 | Unclassified | 2632 |
| 16 | Ga0070677_10017058 | 3300005333 | Bacteria | 2594 |
| 17 | Ga0070666_10124124 | 3300005335 | Bacteria | 1791 |
| 18 | Ga0070666_10140565 | 3300005335 | Bacteria | 1681 |
| 19 | Ga0070680_100021104 | 3300005336 | Bacteria | 5173 |
| 20 | Ga0070682_100046954 | 3300005337 | Bacteria | 2682 |
| 21 | Ga0070682_100048562 | 3300005337 | Bacteria | 2643 |
| 22 | Ga0070682_100076811 | 3300005337 | Bacteria | 2151 |
| 23 | Ga0070682_100108904 | 3300005337 | Bacteria | 1843 |
| 24 | Ga0068868_100204151 | 3300005338 | Bacteria | 1649 |
| 25 | Ga0068868_100322814 | 3300005338 | Bacteria | 1316 |
| 26 | Ga0070689_100360958 | 3300005340 | Bacteria | 1221 |
| 27 | Ga0070691_10038441 | 3300005341 | Bacteria | 2260 |
| 28 | Ga0070691_10062249 | 3300005341 | Bacteria | 1796 |
| 29 | Ga0070687_100135554 | 3300005343 | Unclassified | 1427 |
| 30 | Ga0070661_100156005 | 3300005344 | Bacteria | 1727 |
| 31 | Ga0070661_100177430 | 3300005344 | Bacteria | 1620 |
| 32 | Ga0070692_10193805 | 3300005345 | Bacteria | 1186 |
| 33 | Ga0070668_100635461 | 3300005347 | Bacteria | 937 |
| 34 | Ga0070675_100024236 | 3300005354 | Bacteria | 4859 |
| 35 | Ga0070675_100293661 | 3300005354 | Bacteria | 1431 |
| 36 | Ga0070671_100000058 | 3300005355 | Bacteria | 74538 |
| 37 | Ga0070671_100010865 | 3300005355 | Bacteria | 7307 |
| 38 | Ga0070674_100107537 | 3300005356 | Bacteria | 2042 |
| 39 | Ga0070674_100117125 | 3300005356 | Bacteria | 1966 |
| 40 | Ga0070673_100008710 | 3300005364 | Bacteria | 6768 |
| 41 | Ga0070673_100172465 | 3300005364 | Bacteria | 1847 |
| 42 | Ga0070673_100296696 | 3300005364 | Bacteria | 1422 |
| 43 | Ga0070673_100334286 | 3300005364 | Bacteria | 1341 |
| 44 | Ga0070673_100528335 | 3300005364 | Bacteria | 1070 |
| 45 | Ga0070688_100001801 | 3300005365 | Bacteria | 10731 |
| 46 | Ga0070659_100139973 | 3300005366 | Bacteria | 1970 |
| 47 | Ga0070667_100000002 | 3300005367 | Bacteria | 504831 |
| 48 | Ga0070667_100000052 | 3300005367 | Bacteria | 153455 |
| 49 | Ga0070667_100014844 | 3300005367 | Bacteria | 6435 |
| 50 | Ga0070667_100077403 | 3300005367 | Bacteria | 2840 |
| 51 | Ga0070667_100463521 | 3300005367 | Bacteria | 1159 |
| 52 | Ga0070667_100600681 | 3300005367 | Bacteria | 1014 |
| 53 | Ga0070714_100700776 | 3300005435 | Bacteria | 977 |
| 54 | Ga0070713_100098048 | 3300005436 | Bacteria | 2534 |
| 55 | Ga0070710_10016709 | 3300005437 | Bacteria | 3739 |
| 56 | Ga0070705_100009609 | 3300005440 | Bacteria | 4814 |
| 57 | Ga0070700_100095543 | 3300005441 | Bacteria | 1948 |
| 58 | Ga0070700_100137406 | 3300005441 | Bacteria | 1657 |
| 59 | Ga0070663_100086223 | 3300005455 | Bacteria | 2318 |
| 60 | Ga0070663_100101924 | 3300005455 | Bacteria | 2143 |
| 61 | Ga0070678_100021992 | 3300005456 | Bacteria | 4216 |
| 62 | Ga0070678_100596251 | 3300005456 | Bacteria | 986 |
| 63 | Ga0070681_10029013 | 3300005458 | Bacteria | 5556 |
| 64 | Ga0070681_10057902 | 3300005458 | Bacteria | 3855 |
| 65 | Ga0070681_10083399 | 3300005458 | Bacteria | 3150 |
| 66 | Ga0068867_100057821 | 3300005459 | Unclassified | 2873 |
| 67 | Ga0070685_10000009 | 3300005466 | Bacteria | 166260 |
| 68 | Ga0070685_10034296 | 3300005466 | Bacteria | 2857 |
| 69 | Ga0070685_10146087 | 3300005466 | Bacteria | 1494 |
| 70 | Ga0070679_100004487 | 3300005530 | Bacteria | 12895 |
| 71 | Ga0070679_100021104 | 3300005530 | Bacteria | 6356 |
| 72 | Ga0070679_100032153 | 3300005530 | Bacteria | 5188 |
| 73 | Ga0070679_100065827 | 3300005530 | Bacteria | 3612 |
| 74 | Ga0070679_100261453 | 3300005530 | Bacteria | 1686 |
| 75 | Ga0070679_100355789 | 3300005530 | Bacteria | 1412 |
| 76 | Ga0070684_100080193 | 3300005535 | Bacteria | 2887 |
| 77 | Ga0070684_100332557 | 3300005535 | Bacteria | 1396 |
| 78 | Ga0068853_100164936 | 3300005539 | Bacteria | 2002 |
| 79 | Ga0068853_100745931 | 3300005539 | Bacteria | 935 |
| 80 | Ga0070672_100004027 | 3300005543 | Bacteria | 9586 |
| 81 | Ga0070672_100022337 | 3300005543 | Bacteria | 4646 |
| 82 | Ga0070672_100034320 | 3300005543 | Bacteria | 3850 |
| 83 | Ga0070672_100114800 | 3300005543 | Bacteria | 2199 |
| 84 | Ga0070686_100078137 | 3300005544 | Bacteria | 2184 |
| 85 | Ga0070696_100118350 | 3300005546 | Bacteria | 1915 |
| 86 | Ga0070693_100078840 | 3300005547 | Unclassified | 1958 |
| 87 | Ga0070693_100179181 | 3300005547 | Bacteria | 1363 |
| 88 | Ga0070693_100759609 | 3300005547 | Bacteria | 715 |
| 89 | Ga0070665_100005431 | 3300005548 | Bacteria | 13145 |
| 90 | Ga0070665_100017572 | 3300005548 | Bacteria | 7183 |
| 91 | Ga0070665_100021539 | 3300005548 | Bacteria | 6480 |
| 92 | Ga0070665_100026031 | 3300005548 | Bacteria | 5893 |
| 93 | Ga0070665_100040364 | 3300005548 | Bacteria | 4691 |
| 94 | Ga0070665_100291049 | 3300005548 | Bacteria | 1636 |
| 95 | Ga0070665_100611884 | 3300005548 | Bacteria | 1102 |
| 96 | Ga0068855_100007608 | 3300005563 | Bacteria | 13103 |
| 97 | Ga0068855_100062151 | 3300005563 | Bacteria | 4361 |
| 98 | Ga0068855_100106151 | 3300005563 | Bacteria | 3228 |
| 99 | Ga0068855_100116201 | 3300005563 | Bacteria | 3066 |
| 100 | Ga0070664_100042124 | 3300005564 | Bacteria | 3854 |
| 101 | Ga0068857_100418707 | 3300005577 | Bacteria | 1249 |
| 102 | Ga0068854_100054942 | 3300005578 | Bacteria | 2866 |
| 103 | Ga0068856_100042897 | 3300005614 | Bacteria | 4451 |
| 104 | Ga0068856_100121245 | 3300005614 | Bacteria | 2616 |
| 105 | Ga0068856_100142179 | 3300005614 | Bacteria | 2407 |
| 106 | Ga0068852_100968201 | 3300005616 | Bacteria | 869 |
| 107 | Ga0068859_100004165 | 3300005617 | Bacteria | 14770 |
| 108 | Ga0068859_100032042 | 3300005617 | Bacteria | 5280 |
| 109 | Ga0068859_100034325 | 3300005617 | Bacteria | 5092 |
| 110 | Ga0068859_100291642 | 3300005617 | Bacteria | 1724 |
| 111 | Ga0068859_100371832 | 3300005617 | Bacteria | 1525 |
| 112 | Ga0068859_100507112 | 3300005617 | Bacteria | 1301 |
| 113 | Ga0068864_100000002 | 3300005618 | Bacteria | 658857 |
| 114 | Ga0068864_100359696 | 3300005618 | Bacteria | 1375 |
| 115 | Ga0068861_100012556 | 3300005719 | Bacteria | 5909 |
| 116 | Ga0068861_100041647 | 3300005719 | Bacteria | 3441 |
| 117 | Ga0068861_100088371 | 3300005719 | Bacteria | 2440 |
| 118 | Ga0068861_100123964 | 3300005719 | Bacteria | 2088 |
| 119 | Ga0068861_100304550 | 3300005719 | Bacteria | 1382 |
| 120 | Ga0068851_10228226 | 3300005834 | Bacteria | 1049 |
| 121 | Ga0068870_10001989 | 3300005840 | Bacteria | 8448 |
| 122 | Ga0068870_10082565 | 3300005840 | Bacteria | 1780 |
| 123 | Ga0068863_100000939 | 3300005841 | Bacteria | 29246 |
| 124 | Ga0068863_100003628 | 3300005841 | Bacteria | 15247 |
| 125 | Ga0068863_100071918 | 3300005841 | Bacteria | 3272 |
| 126 | Ga0068858_100000632 | 3300005842 | Bacteria | 36597 |
| 127 | Ga0068858_100018434 | 3300005842 | Bacteria | 6534 |
| 128 | Ga0068858_100069744 | 3300005842 | Bacteria | 3258 |
| 129 | Ga0068858_100173808 | 3300005842 | Bacteria | 2032 |
| 130 | Ga0068858_100597097 | 3300005842 | Bacteria | 1071 |
| 131 | Ga0068860_100000274 | 3300005843 | Bacteria | 75310 |
| 132 | Ga0068860_100000684 | 3300005843 | Bacteria | 39188 |
| 133 | Ga0068860_100077579 | 3300005843 | Bacteria | 3159 |
| 134 | Ga0068860_100143532 | 3300005843 | Bacteria | 2296 |
| 135 | Ga0068860_100182139 | 3300005843 | Bacteria | 2030 |
| 136 | Ga0068860_100683029 | 3300005843 | Bacteria | 1036 |
| 137 | Ga0068862_100016178 | 3300005844 | Bacteria | 6204 |
| 138 | Ga0068862_100049028 | 3300005844 | Bacteria | 3607 |
| 139 | Ga0068862_100086644 | 3300005844 | Bacteria | 2723 |
| 140 | Ga0068862_100184704 | 3300005844 | Bacteria | 1873 |
| 141 | Ga0070715_10217577 | 3300006163 | Bacteria | 980 |
| 142 | Ga0070716_100044363 | 3300006173 | Bacteria | 2491 |
| 143 | Ga0070716_100106384 | 3300006173 | Bacteria | 1730 |
| 144 | Ga0070712_100010849 | 3300006175 | Bacteria | 5761 |
| 145 | Ga0097621_100142958 | 3300006237 | Bacteria | 2046 |
| 146 | Ga0097621_100179596 | 3300006237 | Bacteria | 1828 |
| 147 | Ga0097621_100189645 | 3300006237 | Bacteria | 1780 |
| 148 | Ga0097621_100354410 | 3300006237 | Bacteria | 1306 |
| 149 | Ga0068871_100338738 | 3300006358 | Bacteria | 1328 |
| 150 | Ga0068871_100520568 | 3300006358 | Bacteria | 1074 |
| 151 | Ga0075430_100513442 | 3300006846 | Bacteria | 989 |
| 152 | Ga0068865_100017170 | 3300006881 | Bacteria | 4650 |
| 153 | Ga0068865_100334236 | 3300006881 | Bacteria | 1222 |
| 154 | Ga0068865_100509266 | 3300006881 | Bacteria | 1005 |
| 155 | Ga0068865_100572046 | 3300006881 | Unclassified | 952 |
| 156 | Ga0068865_100747670 | 3300006881 | Bacteria | 839 |
| 157 | Ga0075436_100074188 | 3300006914 | Bacteria | 2355 |
| 158 | Ga0097620_100004165 | 3300006931 | Bacteria | 14770 |
| 159 | Ga0097620_100032042 | 3300006931 | Bacteria | 5280 |
| 160 | Ga0097620_100034325 | 3300006931 | Bacteria | 5092 |
| 161 | Ga0097620_100291632 | 3300006931 | Bacteria | 1724 |
| 162 | Ga0097620_100371861 | 3300006931 | Bacteria | 1525 |
| 163 | Ga0097620_100507099 | 3300006931 | Bacteria | 1301 |
| 164 | Ga0097620_100545817 | 3300006931 | Bacteria | 1254 |
| 165 | Ga0105251_10008576 | 3300009011 | Bacteria | 6132 |
| 166 | Ga0105250_10075358 | 3300009092 | Bacteria | 1365 |
| 167 | Ga0105240_10008879 | 3300009093 | Bacteria | 14302 |
| 168 | Ga0105240_10016620 | 3300009093 | Bacteria | 9951 |
| 169 | Ga0105240_10017821 | 3300009093 | Bacteria | 9556 |
| 170 | Ga0105240_10037201 | 3300009093 | Bacteria | 6256 |
| 171 | Ga0105240_10095157 | 3300009093 | Bacteria | 3632 |
| 172 | Ga0105240_10133648 | 3300009093 | Bacteria | 2973 |
| 173 | Ga0105240_10154806 | 3300009093 | Bacteria | 2727 |
| 174 | Ga0105240_10294654 | 3300009093 | Bacteria | 1858 |
| 175 | Ga0105240_10304043 | 3300009093 | Bacteria | 1824 |
| 176 | Ga0105240_10497912 | 3300009093 | Bacteria | 1355 |
| 177 | Ga0111539_10607081 | 3300009094 | Bacteria | 1274 |
| 178 | Ga0111539_10939241 | 3300009094 | Bacteria | 1006 |
| 179 | Ga0105245_10283516 | 3300009098 | Bacteria | 1620 |
| 180 | Ga0105247_10000342 | 3300009101 | Bacteria | 40806 |
| 181 | Ga0105247_10020146 | 3300009101 | Bacteria | 4010 |
| 182 | Ga0105247_10029168 | 3300009101 | Bacteria | 3342 |
| 183 | Ga0105241_10058262 | 3300009174 | Bacteria | 2966 |
| 184 | Ga0105241_10180064 | 3300009174 | Bacteria | 1753 |
| 185 | Ga0105241_10251989 | 3300009174 | Bacteria | 1497 |
| 186 | Ga0105242_10371496 | 3300009176 | Bacteria | 1327 |
| 187 | Ga0105242_10552344 | 3300009176 | Bacteria | 1104 |
| 188 | Ga0105242_10869935 | 3300009176 | Bacteria | 898 |
| 189 | Ga0105248_10016662 | 3300009177 | Bacteria | 8088 |
| 190 | Ga0105248_10112443 | 3300009177 | Bacteria | 3071 |
| 191 | Ga0105248_10132383 | 3300009177 | Bacteria | 2813 |
| 192 | Ga0105248_10218175 | 3300009177 | Bacteria | 2148 |
| 193 | Ga0105248_10368724 | 3300009177 | Bacteria | 1617 |
| 194 | Ga0105237_10074676 | 3300009545 | Bacteria | 3382 |
| 195 | Ga0105237_10119763 | 3300009545 | Bacteria | 2626 |
| 196 | Ga0105237_10207353 | 3300009545 | Bacteria | 1960 |
| 197 | Ga0105237_10217420 | 3300009545 | Bacteria | 1911 |
| 198 | Ga0105237_10274087 | 3300009545 | Bacteria | 1690 |
| 199 | Ga0105237_10276752 | 3300009545 | Bacteria | 1681 |
| 200 | Ga0105237_11175503 | 3300009545 | Bacteria | 774 |
| 201 | Ga0105238_10002313 | 3300009551 | Bacteria | 19167 |
| 202 | Ga0105238_10022722 | 3300009551 | Bacteria | 6392 |
| 203 | Ga0105238_10059981 | 3300009551 | Bacteria | 3810 |
| 204 | Ga0105238_10405033 | 3300009551 | Bacteria | 1358 |
| 205 | Ga0105238_10937504 | 3300009551 | Bacteria | 885 |
| 206 | Ga0105249_10052734 | 3300009553 | Bacteria | 3715 |
| 207 | Ga0105249_10063862 | 3300009553 | Bacteria | 3383 |
| 208 | Ga0105249_10108638 | 3300009553 | Bacteria | 2619 |
| 209 | Ga0105249_10223695 | 3300009553 | Bacteria | 1853 |
| 210 | Ga0105249_10321731 | 3300009553 | Bacteria | 1558 |
| 211 | Ga0105239_10025606 | 3300010375 | Bacteria | 6495 |
| 212 | Ga0105239_10394750 | 3300010375 | Bacteria | 1565 |
| 213 | Ga0105239_10610628 | 3300010375 | Bacteria | 1244 |
| 214 | Ga0157371_10003190 | 3300013102 | Bacteria | 15054 |
| 215 | Ga0157371_10138854 | 3300013102 | Bacteria | 1731 |
| 216 | Ga0157370_10009142 | 3300013104 | Bacteria | 10624 |
| 217 | Ga0157369_10012386 | 3300013105 | Bacteria | 9682 |
| 218 | Ga0157369_10017382 | 3300013105 | Bacteria | 8084 |
| 219 | Ga0157369_10021722 | 3300013105 | Bacteria | 7178 |
| 220 | Ga0157369_10096697 | 3300013105 | Bacteria | 3150 |
| 221 | Ga0157369_10295654 | 3300013105 | Bacteria | 1685 |
| 222 | Ga0157374_10132583 | 3300013296 | Bacteria | 2412 |
| 223 | Ga0157374_10200378 | 3300013296 | Bacteria | 1954 |
| 224 | Ga0157374_10556548 | 3300013296 | Bacteria | 1155 |
| 225 | Ga0163162_10016055 | 3300013306 | Bacteria | 7318 |
| 226 | Ga0163162_10154546 | 3300013306 | Bacteria | 2414 |
| 227 | Ga0163162_10564450 | 3300013306 | Bacteria | 1266 |
| 228 | Ga0157372_10072228 | 3300013307 | Bacteria | 3888 |
| 229 | Ga0157372_10348016 | 3300013307 | Bacteria | 1726 |
| 230 | Ga0157372_10373304 | 3300013307 | Bacteria | 1662 |
| 231 | Ga0157372_10570057 | 3300013307 | Bacteria | 1319 |
| 232 | Ga0157372_10682006 | 3300013307 | Bacteria | 1196 |
| 233 | Ga0157375_10069347 | 3300013308 | Bacteria | 3531 |
| 234 | Ga0157375_11072891 | 3300013308 | Bacteria | 942 |
| 235 | Ga0163163_10000081 | 3300014325 | Bacteria | 104678 |
| 236 | Ga0163163_10087399 | 3300014325 | Bacteria | 3128 |
| 237 | Ga0163163_10131148 | 3300014325 | Bacteria | 2547 |
| 238 | Ga0163163_10141824 | 3300014325 | Bacteria | 2445 |
| 239 | Ga0163163_10476578 | 3300014325 | Bacteria | 1309 |
| 240 | Ga0163163_10970527 | 3300014325 | Bacteria | 913 |
| 241 | Ga0157380_10002827 | 3300014326 | Bacteria | 11802 |
| 242 | Ga0157380_10058159 | 3300014326 | Bacteria | 3081 |
| 243 | Ga0157380_10626218 | 3300014326 | Bacteria | 1069 |
| 244 | Ga0157380_10713779 | 3300014326 | Bacteria | 1009 |
| 245 | Ga0157380_11083546 | 3300014326 | Bacteria | 839 |
| 246 | Ga0157377_10539971 | 3300014745 | Unclassified | 822 |
| 247 | Ga0157379_10022208 | 3300014968 | Bacteria | 5622 |
| 248 | Ga0157379_10060171 | 3300014968 | Bacteria | 3395 |
| 249 | Ga0157379_10096261 | 3300014968 | Bacteria | 2657 |
| 250 | Ga0157379_10125478 | 3300014968 | Bacteria | 2310 |
| 251 | Ga0157376_10031227 | 3300014969 | Bacteria | 4263 |
| 252 | Ga0157376_10032550 | 3300014969 | Unclassified | 4187 |
| 253 | Ga0157376_10368450 | 3300014969 | Bacteria | 1380 |
| 254 | Ga0163161_10040256 | 3300017792 | Unclassified | 3356 |
| 255 | Ga0206356_10460238 | 3300020070 | Bacteria | 1449 |
| 256 | Ga0207713_1021127 | 3300025735 | Bacteria | 3129 |
| 257 | Ga0207682_10009116 | 3300025893 | Bacteria | 3920 |
| 258 | Ga0207682_10020839 | 3300025893 | Unclassified | 2576 |
| 259 | Ga0207692_10138119 | 3300025898 | Bacteria | 1383 |
| 260 | Ga0207642_10060928 | 3300025899 | Bacteria | 1752 |
| 261 | Ga0207642_10083734 | 3300025899 | Bacteria | 1556 |
| 262 | Ga0207710_10000167 | 3300025900 | Bacteria | 69349 |
| 263 | Ga0207710_10020394 | 3300025900 | Bacteria | 2833 |
| 264 | Ga0207710_10074493 | 3300025900 | Bacteria | 1563 |
| 265 | Ga0207688_10373321 | 3300025901 | Bacteria | 881 |
| 266 | Ga0207680_10030420 | 3300025903 | Bacteria | 3045 |
| 267 | Ga0207680_10215444 | 3300025903 | Bacteria | 1314 |
| 268 | Ga0207680_10250405 | 3300025903 | Bacteria | 1223 |
| 269 | Ga0207647_10051744 | 3300025904 | Bacteria | 2537 |
| 270 | Ga0207645_10122995 | 3300025907 | Bacteria | 1685 |
| 271 | Ga0207643_10009378 | 3300025908 | Bacteria | 5260 |
| 272 | Ga0207643_10050945 | 3300025908 | Bacteria | 2349 |
| 273 | Ga0207654_10303290 | 3300025911 | Unclassified | 1087 |
| 274 | Ga0207707_10005259 | 3300025912 | Bacteria | 11335 |
| 275 | Ga0207707_10012047 | 3300025912 | Bacteria | 7520 |
| 276 | Ga0207707_10031276 | 3300025912 | Bacteria | 4657 |
| 277 | Ga0207707_10163405 | 3300025912 | Bacteria | 1946 |
| 278 | Ga0207707_10744727 | 3300025912 | Bacteria | 820 |
| 279 | Ga0207695_10008742 | 3300025913 | Bacteria | 12627 |
| 280 | Ga0207695_10023623 | 3300025913 | Bacteria | 6937 |
| 281 | Ga0207695_10029601 | 3300025913 | Bacteria | 6044 |
| 282 | Ga0207695_10037335 | 3300025913 | Bacteria | 5242 |
| 283 | Ga0207695_10043328 | 3300025913 | Bacteria | 4797 |
| 284 | Ga0207695_10067312 | 3300025913 | Bacteria | 3674 |
| 285 | Ga0207695_10094419 | 3300025913 | Bacteria | 2998 |
| 286 | Ga0207695_10124600 | 3300025913 | Bacteria | 2540 |
| 287 | Ga0207695_10152530 | 3300025913 | Bacteria | 2249 |
| 288 | Ga0207695_10218862 | 3300025913 | Bacteria | 1812 |
| 289 | Ga0207695_10253613 | 3300025913 | Bacteria | 1658 |
| 290 | Ga0207671_10150471 | 3300025914 | Bacteria | 1798 |
| 291 | Ga0207671_10183755 | 3300025914 | Bacteria | 1628 |
| 292 | Ga0207671_10189717 | 3300025914 | Bacteria | 1602 |
| 293 | Ga0207671_10457199 | 3300025914 | Bacteria | 1017 |
| 294 | Ga0207671_10463989 | 3300025914 | Bacteria | 1009 |
| 295 | Ga0207693_10004507 | 3300025915 | Bacteria | 11782 |
| 296 | Ga0207660_10004159 | 3300025917 | Bacteria | 9419 |
| 297 | Ga0207660_10372958 | 3300025917 | Bacteria | 1146 |
| 298 | Ga0207662_10034463 | 3300025918 | Bacteria | 2955 |
| 299 | Ga0207662_10170287 | 3300025918 | Unclassified | 1396 |
| 300 | Ga0207657_10666860 | 3300025919 | Unclassified | 809 |
| 301 | Ga0207649_10084219 | 3300025920 | Bacteria | 2066 |
| 302 | Ga0207652_10044475 | 3300025921 | Bacteria | 3783 |
| 303 | Ga0207652_10102243 | 3300025921 | Bacteria | 2532 |
| 304 | Ga0207652_10231361 | 3300025921 | Bacteria | 1666 |
| 305 | Ga0207652_10976386 | 3300025921 | Bacteria | 745 |
| 306 | Ga0207681_10297283 | 3300025923 | Bacteria | 1276 |
| 307 | Ga0207694_10103459 | 3300025924 | Bacteria | 2258 |
| 308 | Ga0207694_10186287 | 3300025924 | Bacteria | 1685 |
| 309 | Ga0207694_10288215 | 3300025924 | Bacteria | 1350 |
| 310 | Ga0207650_10000002 | 3300025925 | Bacteria | 1439222 |
| 311 | Ga0207650_10046571 | 3300025925 | Bacteria | 3193 |
| 312 | Ga0207650_10529205 | 3300025925 | Bacteria | 987 |
| 313 | Ga0207659_10032055 | 3300025926 | Bacteria | 3603 |
| 314 | Ga0207659_10332095 | 3300025926 | Bacteria | 1257 |
| 315 | Ga0207700_10095529 | 3300025928 | Bacteria | 2358 |
| 316 | Ga0207644_10000020 | 3300025931 | Bacteria | 165455 |
| 317 | Ga0207644_10005739 | 3300025931 | Bacteria | 8076 |
| 318 | Ga0207644_10032383 | 3300025931 | Bacteria | 3647 |
| 319 | Ga0207644_10398026 | 3300025931 | Bacteria | 1125 |
| 320 | Ga0207706_10309385 | 3300025933 | Bacteria | 1376 |
| 321 | Ga0207686_10137264 | 3300025934 | Bacteria | 1686 |
| 322 | Ga0207686_10466315 | 3300025934 | Bacteria | 974 |
| 323 | Ga0207670_10086143 | 3300025936 | Bacteria | 2209 |
| 324 | Ga0207704_10356298 | 3300025938 | Bacteria | 1141 |
| 325 | Ga0207704_10640822 | 3300025938 | Bacteria | 874 |
| 326 | Ga0207665_10018494 | 3300025939 | Bacteria | 4578 |
| 327 | Ga0207691_10003456 | 3300025940 | Bacteria | 15367 |
| 328 | Ga0207691_10013427 | 3300025940 | Bacteria | 7840 |
| 329 | Ga0207691_10145671 | 3300025940 | Bacteria | 2085 |
| 330 | Ga0207711_10000619 | 3300025941 | Bacteria | 35743 |
| 331 | Ga0207711_10115420 | 3300025941 | Bacteria | 2393 |
| 332 | Ga0207689_10090719 | 3300025942 | Bacteria | 2511 |
| 333 | Ga0207661_10227983 | 3300025944 | Bacteria | 1649 |
| 334 | Ga0207679_10126867 | 3300025945 | Bacteria | 2040 |
| 335 | Ga0207679_10480313 | 3300025945 | Bacteria | 1106 |
| 336 | Ga0207667_10006536 | 3300025949 | Bacteria | 14097 |
| 337 | Ga0207667_10024211 | 3300025949 | Bacteria | 6671 |
| 338 | Ga0207667_10186652 | 3300025949 | Bacteria | 2128 |
| 339 | Ga0207651_10031031 | 3300025960 | Bacteria | 3411 |
| 340 | Ga0207651_10045213 | 3300025960 | Bacteria | 2952 |
| 341 | Ga0207651_10273063 | 3300025960 | Bacteria | 1393 |
| 342 | Ga0207651_10653585 | 3300025960 | Bacteria | 923 |
| 343 | Ga0207712_10038119 | 3300025961 | Bacteria | 3285 |
| 344 | Ga0207712_10132619 | 3300025961 | Bacteria | 1900 |
| 345 | Ga0207712_10190539 | 3300025961 | Bacteria | 1618 |
| 346 | Ga0207712_10893522 | 3300025961 | Bacteria | 785 |
| 347 | Ga0207640_10050142 | 3300025981 | Bacteria | 2707 |
| 348 | Ga0207640_10374339 | 3300025981 | Bacteria | 1152 |
| 349 | Ga0207658_10000001 | 3300025986 | Bacteria | 1439333 |
| 350 | Ga0207658_10000250 | 3300025986 | Bacteria | 56198 |
| 351 | Ga0207658_10352747 | 3300025986 | Bacteria | 1281 |
| 352 | Ga0207658_10447122 | 3300025986 | Bacteria | 1143 |
| 353 | Ga0207658_11032027 | 3300025986 | Bacteria | 751 |
| 354 | Ga0207677_10054642 | 3300026023 | Bacteria | 2726 |
| 355 | Ga0207677_10210816 | 3300026023 | Bacteria | 1551 |
| 356 | Ga0207703_10001048 | 3300026035 | Bacteria | 26350 |
| 357 | Ga0207703_10001570 | 3300026035 | Bacteria | 20718 |
| 358 | Ga0207703_10020650 | 3300026035 | Bacteria | 5152 |
| 359 | Ga0207703_10165873 | 3300026035 | Bacteria | 1938 |
| 360 | Ga0207703_10180767 | 3300026035 | Bacteria | 1861 |
| 361 | Ga0207703_10332801 | 3300026035 | Bacteria | 1393 |
| 362 | Ga0207703_10709624 | 3300026035 | Bacteria | 957 |
| 363 | Ga0207678_10140164 | 3300026067 | Bacteria | 2064 |
| 364 | Ga0207678_10312040 | 3300026067 | Bacteria | 1352 |
| 365 | Ga0207678_10968639 | 3300026067 | Unclassified | 753 |
| 366 | Ga0207708_10054431 | 3300026075 | Bacteria | 3051 |
| 367 | Ga0207708_10063667 | 3300026075 | Bacteria | 2817 |
| 368 | Ga0207708_10182924 | 3300026075 | Bacteria | 1665 |
| 369 | Ga0207702_10059039 | 3300026078 | Bacteria | 3266 |
| 370 | Ga0207702_10199566 | 3300026078 | Bacteria | 1853 |
| 371 | Ga0207702_11151143 | 3300026078 | Bacteria | 770 |
| 372 | Ga0207641_10000290 | 3300026088 | Bacteria | 62711 |
| 373 | Ga0207641_10016513 | 3300026088 | Bacteria | 6045 |
| 374 | Ga0207641_10020410 | 3300026088 | Bacteria | 5441 |
| 375 | Ga0207641_10043240 | 3300026088 | Bacteria | 3782 |
| 376 | Ga0207641_10074438 | 3300026088 | Bacteria | 2929 |
| 377 | Ga0207648_10032625 | 3300026089 | Bacteria | 4596 |
| 378 | Ga0207676_10000001 | 3300026095 | Bacteria | 1439222 |
| 379 | Ga0207676_10157103 | 3300026095 | Bacteria | 1966 |
| 380 | Ga0207676_11002915 | 3300026095 | Bacteria | 823 |
| 381 | Ga0207674_10658252 | 3300026116 | Bacteria | 1011 |
| 382 | Ga0207675_100004052 | 3300026118 | Bacteria | 14192 |
| 383 | Ga0207675_100004461 | 3300026118 | Bacteria | 13527 |
| 384 | Ga0207675_100050538 | 3300026118 | Bacteria | 3879 |
| 385 | Ga0207675_100080746 | 3300026118 | Bacteria | 3049 |
| 386 | Ga0207675_100130703 | 3300026118 | Bacteria | 2381 |
| 387 | Ga0207683_10008549 | 3300026121 | Bacteria | 8763 |
| 388 | Ga0207683_10054110 | 3300026121 | Bacteria | 3519 |
| 389 | Ga0207683_10081437 | 3300026121 | Bacteria | 2873 |
| 390 | Ga0207683_10265491 | 3300026121 | Bacteria | 1568 |
| 391 | Ga0268266_10000704 | 3300028379 | Bacteria | 45162 |
| 392 | Ga0268266_10010219 | 3300028379 | Bacteria | 8222 |
| 393 | Ga0268265_10000258 | 3300028380 | Bacteria | 60430 |
| 394 | Ga0268265_10006412 | 3300028380 | Bacteria | 7976 |
| 395 | Ga0268265_10068570 | 3300028380 | Bacteria | 2751 |
| 396 | Ga0268265_10865062 | 3300028380 | Bacteria | 885 |
| 397 | Ga0268264_10000004 | 3300028381 | Bacteria | 1116842 |
| 398 | Ga0268264_10000058 | 3300028381 | Bacteria | 308956 |
| 399 | Ga0268264_10000060 | 3300028381 | Bacteria | 305056 |
| 400 | Ga0268264_10053062 | 3300028381 | Bacteria | 3382 |
| 401 | Ga0268264_10163449 | 3300028381 | Bacteria | 2008 |
| 402 | Ga0268264_10552696 | 3300028381 | Bacteria | 1129 |
| 403 | Ga0265334_10031480 | 3300028573 | Bacteria | 2120 |
| 404 | Ga0307515_10070359 | 3300028794 | Bacteria | 4763 |
| 405 | Ga0265338_10027456 | 3300028800 | Bacteria | 5711 |
| 406 | Ga0307511_10022320 | 3300030521 | Bacteria | 5933 |
| 407 | Ga0265340_10030088 | 3300031247 | Bacteria | 2724 |
| 408 | Ga0265331_10027150 | 3300031250 | Bacteria | 2873 |
| 409 | Ga0265327_10000282 | 3300031251 | Bacteria | 100324 |
| 410 | Ga0307513_10084125 | 3300031456 | Bacteria | 3269 |
| 411 | Ga0307513_10150915 | 3300031456 | Bacteria | 2233 |
| 412 | Ga0307513_10505620 | 3300031456 | Bacteria | 925 |
| 413 | Ga0307513_10519368 | 3300031456 | Unclassified | 906 |
| 414 | Ga0307509_10000048 | 3300031507 | Bacteria | 167101 |
| 415 | Ga0307509_10000074 | 3300031507 | Bacteria | 140111 |
| 416 | Ga0307509_10321086 | 3300031507 | Bacteria | 1285 |
| 417 | Ga0307408_100000721 | 3300031548 | Bacteria | 26773 |
| 418 | Ga0307408_100043705 | 3300031548 | Bacteria | 3189 |
| 419 | Ga0307413_10007099 | 3300031824 | Bacteria | 5172 |
| 420 | Ga0307413_10250470 | 3300031824 | Bacteria | 1314 |
| 421 | Ga0307410_10069546 | 3300031852 | Bacteria | 2436 |
| 422 | Ga0307410_10373237 | 3300031852 | Bacteria | 1146 |
| 423 | Ga0307410_10411932 | 3300031852 | Bacteria | 1094 |
| 424 | Ga0307406_10993697 | 3300031901 | Bacteria | 719 |
| 425 | Ga0307407_10098790 | 3300031903 | Bacteria | 1807 |
| 426 | Ga0307412_10197362 | 3300031911 | Bacteria | 1526 |
| 427 | Ga0307409_100156196 | 3300031995 | Bacteria | 1988 |
| 428 | Ga0307409_100193094 | 3300031995 | Bacteria | 1814 |
| 429 | Ga0307409_100315927 | 3300031995 | Bacteria | 1460 |
| 430 | Ga0307416_100036124 | 3300032002 | Bacteria | 3785 |
| 431 | Ga0307416_100357846 | 3300032002 | Bacteria | 1480 |
| 432 | Ga0307411_10011187 | 3300032005 | Bacteria | 4828 |
| 433 | Ga0307411_10684534 | 3300032005 | Bacteria | 891 |
| 434 | Ga0307411_10685378 | 3300032005 | Bacteria | 891 |
| 435 | Ga0307510_10017304 | 3300033180 | Bacteria | 8505 |
| 436 | Ga0373934_0212027 | 3300035086 | Bacteria | 798 |
| 437 | Ga0373936_0001995 | 3300035113 | Bacteria | 7555 |
| 438 | Ga0373954_0046888 | 3300035118 | Bacteria | 2021 |
| 439 | Ga0373933_0191147 | 3300035724 | Bacteria | 1308 |
| 440 | Ga0373937_0009441 | 3300036401 | Bacteria | 8481 |
| 441 | Ga0373937_0047167 | 3300036401 | Bacteria | 3941 |
| 442 | Ga0373925_0064459 | 3300037068 | Bacteria | 2758 |
| 443 | Ga0373925_0362882 | 3300037068 | Bacteria | 1178 |
| 444 | Ga0395900_0331445 | 3300037418 | Bacteria | 1500 |
| 445 | Ga0395900_0985223 | 3300037418 | Bacteria | 763 |
| 446 | Ga0395898_0030669 | 3300037466 | Bacteria | 5379 |
| 447 | Ga0395898_0103282 | 3300037466 | Bacteria | 2735 |
| 448 | Ga0436364_0130364 | 3300037853 | Bacteria | 1163 |
| 449 | Ga0436361_0268579 | 3300039447 | Bacteria | 899 |
| 450 | Ga0436361_0990724 | 3300039447 | Unclassified | 855 |
| 451 | Ga0436363_0120822 | 3300039450 | Bacteria | 3115 |
| 452 | Ga0451789_0468735 | 3300041443 | Bacteria | 912 |
| 453 | Ga0451789_0554294 | 3300041443 | Bacteria | 1430 |
| 454 | Ga0451791_1713758 | 3300041451 | Bacteria | 2126 |
| 455 | Ga0451791_1935231 | 3300041451 | Bacteria | 1548 |
| 456 | Ga0451793_0376710 | 3300041452 | Bacteria | 999 |
| 457 | Ga0451793_1836681 | 3300041452 | Bacteria | 1102 |
| 458 | Ga0451800_0252305 | 3300041459 | Bacteria | 2961 |
| 459 | Ga0451802_0702001 | 3300041460 | Bacteria | 918 |
| 460 | Ga0451807_0279481 | 3300041486 | Bacteria | 2891 |
| 461 | Ga0451807_0302049 | 3300041486 | Bacteria | 2322 |
| 462 | Ga0451807_1583312 | 3300041486 | Bacteria | 1828 |
| 463 | Ga0451837_1191953 | 3300041494 | Bacteria | 3977 |
| 464 | Ga0451853_3663875 | 3300041512 | Bacteria | 745 |
| 465 | Ga0439431_0004348 | 3300041997 | Bacteria | 3114 |
| 466 | Ga0439437_007994 | 3300042000 | Bacteria | 1185 |
| 467 | Ga0439455_0003927 | 3300042012 | Bacteria | 2897 |
| 468 | Ga0450911_000015 | 3300042115 | Bacteria | 109635 |
| 469 | Ga0450895_003648 | 3300042132 | Bacteria | 1195 |
| 470 | Ga0450900_024920 | 3300042136 | Bacteria | 850 |
| 471 | Ga0450904_000005 | 3300042139 | Bacteria | 60724 |
| 472 | Ga0439446_0011153 | 3300042156 | Bacteria | 2436 |
| 473 | Ga0439459_0003543 | 3300042438 | Bacteria | 2485 |
| 474 | Ga0439459_0042345 | 3300042438 | Bacteria | 972 |
| 475 | Ga0450916_000847 | 3300042530 | Bacteria | 2876 |
| 476 | Ga0450916_001487 | 3300042530 | Bacteria | 2349 |
| 477 | Ga0466961_0102542 | 3300044693 | Bacteria | 1802 |
| 478 | Ga0466959_0558925 | 3300045049 | Bacteria | 771 |
| 479 | Ga0495603_0417240 | 3300046455 | Bacteria | 769 |
| 480 | Ga0495591_048591 | 3300046458 | Bacteria | 1169 |
| 481 | Ga0495629_0059962 | 3300046459 | Bacteria | 2660 |
| 482 | Ga0495638_0063954 | 3300046460 | Bacteria | 2267 |
| 483 | Ga0495638_0342626 | 3300046460 | Bacteria | 792 |
| 484 | Ga0495580_0000463 | 3300046472 | Bacteria | 33704 |
| 485 | Ga0495580_0018248 | 3300046472 | Bacteria | 5226 |
| 486 | Ga0495580_0022811 | 3300046472 | Bacteria | 4602 |
| 487 | Ga0495639_0173725 | 3300046475 | Bacteria | 1047 |
| 488 | Ga0495584_0076955 | 3300046491 | Bacteria | 1678 |
| 489 | Ga0495594_0509490 | 3300046499 | Unclassified | 683 |
| 490 | Ga0495596_0121296 | 3300046500 | Bacteria | 1015 |
| 491 | Ga0495583_0193873 | 3300046506 | Bacteria | 828 |
| 492 | Ga0495606_0054418 | 3300046507 | Bacteria | 2592 |
| 493 | Ga0495606_0154118 | 3300046507 | Bacteria | 1346 |
| 494 | Ga0495608_0465624 | 3300046511 | Bacteria | 768 |
| 495 | Ga0495616_0003020 | 3300046513 | Bacteria | 10926 |
| 496 | Ga0495620_0043086 | 3300046515 | Bacteria | 1968 |
| 497 | Ga0495630_0035598 | 3300046517 | Bacteria | 3720 |
| 498 | Ga0495632_0013127 | 3300046519 | Bacteria | 4744 |
| 499 | Ga0495644_0003534 | 3300046523 | Bacteria | 6179 |
| 500 | Ga0495648_0283056 | 3300046524 | Bacteria | 785 |
| 501 | Ga0495652_0457956 | 3300046529 | Bacteria | 892 |
| 502 | Ga0495586_0464502 | 3300046535 | Bacteria | 730 |
| 503 | Ga0495621_0004122 | 3300046539 | Bacteria | 4051 |
| 504 | Ga0495645_0153953 | 3300046543 | Bacteria | 1595 |
| 505 | Ga0495656_0005412 | 3300046615 | Bacteria | 4406 |
| 506 | Ga0495668_0022887 | 3300046616 | Bacteria | 3569 |
| 507 | Ga0495668_0069294 | 3300046616 | Bacteria | 1940 |
| 508 | Ga0495611_0255898 | 3300046648 | Bacteria | 811 |
| 509 | Ga0495611_0389583 | 3300046648 | Bacteria | 637 |
| 510 | Ga0495625_0022716 | 3300046660 | Bacteria | 4804 |
| 511 | Ga0495625_0030402 | 3300046660 | Bacteria | 4031 |
| 512 | Ga0495599_0189339 | 3300046678 | Bacteria | 1266 |
| 513 | Ga0495647_0011153 | 3300046681 | Bacteria | 3074 |
| 514 | Ga0495658_0080882 | 3300046683 | Bacteria | 1907 |
| 515 | Ga0495669_0176108 | 3300046684 | Bacteria | 1019 |
| 516 | Ga0495624_0379951 | 3300046690 | Bacteria | 849 |
| 517 | Ga0495671_0015030 | 3300046692 | Bacteria | 4158 |
| 518 | Ga0495649_0001072 | 3300046694 | Bacteria | 21366 |
| 519 | Ga0495649_0136398 | 3300046694 | Bacteria | 1293 |
| 520 | Ga0495672_0158277 | 3300047320 | Bacteria | 1167 |
| 521 | Ga0495687_090888 | 3300047443 | Bacteria | 1169 |
| 522 | Ga0495681_0009447 | 3300047470 | Bacteria | 6009 |
| 523 | Ga0495686_0281442 | 3300047472 | Bacteria | 924 |
| 524 | Ga0495602_0423440 | 3300048088 | Bacteria | 945 |
| 525 | Ga0496100_0036452 | 3300048903 | Bacteria | 3102 |
| 526 | Ga0496101_0084436 | 3300048904 | Bacteria | 2351 |
| 527 | Ga0496102_0021940 | 3300048905 | Bacteria | 5654 |
| 528 | Ga0496102_0031702 | 3300048905 | Bacteria | 4744 |
| 529 | Ga0496102_0080064 | 3300048905 | Bacteria | 3009 |
| 530 | Ga0496104_0067057 | 3300048907 | Bacteria | 3408 |
| 531 | Ga0496104_0392440 | 3300048907 | Bacteria | 1300 |
| 532 | Ga0496106_0034604 | 3300048909 | Bacteria | 3774 |
| 533 | Ga0496106_0119110 | 3300048909 | Bacteria | 2062 |
| 534 | Ga0496106_0509748 | 3300048909 | Bacteria | 966 |
| 535 | Ga0496107_0028231 | 3300048910 | Bacteria | 3987 |
| 536 | Ga0496107_0110958 | 3300048910 | Bacteria | 2016 |
| 537 | Ga0496108_0025478 | 3300048911 | Bacteria | 4875 |
| 538 | Ga0496108_0093701 | 3300048911 | Bacteria | 2555 |
| 539 | Ga0496109_0235104 | 3300048912 | Bacteria | 1724 |
| 540 | Ga0496111_0019598 | 3300048914 | Bacteria | 4703 |
| 541 | Ga0496113_0262365 | 3300048916 | Bacteria | 1380 |
| 542 | Ga0496113_0657191 | 3300048916 | Bacteria | 838 |
| 543 | Ga0496114_0675054 | 3300048917 | Bacteria | 907 |
| 544 | Ga0496115_0057745 | 3300048918 | Bacteria | 3121 |
| 545 | Ga0496115_0353388 | 3300048918 | Bacteria | 1198 |
| 546 | Ga0496115_0711228 | 3300048918 | Bacteria | 789 |
| 547 | Ga0496117_0000090 | 3300048920 | Bacteria | 206388 |
| 548 | Ga0496117_0181589 | 3300048920 | Bacteria | 1209 |
| 549 | Ga0496118_0000032 | 3300048921 | Bacteria | 330072 |
| 550 | Ga0496118_0086731 | 3300048921 | Bacteria | 2174 |
| 551 | Ga0496120_0023689 | 3300048923 | Bacteria | 3839 |
| 552 | Ga0496121_0001021 | 3300048924 | Bacteria | 49886 |
| 553 | Ga0496121_0084783 | 3300048924 | Bacteria | 2496 |
| 554 | Ga0496124_0031151 | 3300048927 | Bacteria | 4724 |
| 555 | Ga0496124_0080960 | 3300048927 | Bacteria | 2671 |
| 556 | Ga0496125_0000592 | 3300048928 | Bacteria | 61806 |
| 557 | Ga0496125_0095016 | 3300048928 | Bacteria | 2219 |
| 558 | Ga0496125_0295350 | 3300048928 | Bacteria | 995 |
| 559 | Ga0496126_0007351 | 3300048929 | Bacteria | 12088 |
| 560 | Ga0496126_0021320 | 3300048929 | Bacteria | 6329 |
| 561 | Ga0496126_0164527 | 3300048929 | Bacteria | 1894 |
| 562 | Ga0495682_0062585 | 3300049460 | Bacteria | 1343 |
| 563 | Ga0501036_0238443 | 3300049572 | Bacteria | 1526 |
| 564 | Ga0501036_0802485 | 3300049572 | Bacteria | 775 |
| 565 | Ga0501038_0692991 | 3300049574 | Bacteria | 764 |
| 566 | Ga0501039_0163988 | 3300049575 | Bacteria | 1747 |
| 567 | Ga0501042_0134422 | 3300049578 | Bacteria | 1783 |
| 568 | Ga0501047_0683745 | 3300049581 | Bacteria | 844 |
| 569 | Ga0501067_0015730 | 3300049583 | Bacteria | 4186 |
| 570 | Ga0501068_0007768 | 3300049584 | Bacteria | 5940 |
| 571 | Ga0501068_0314765 | 3300049584 | Bacteria | 1003 |
| 572 | Ga0501070_0302956 | 3300049586 | Bacteria | 1302 |
| 573 | Ga0501071_0020960 | 3300049587 | Bacteria | 4549 |
| 574 | Ga0501072_0063844 | 3300049588 | Bacteria | 2905 |
| 575 | Ga0501073_0002449 | 3300049589 | Bacteria | 13864 |
| 576 | Ga0501074_0011278 | 3300049590 | Bacteria | 6497 |
| 577 | Ga0501076_0052837 | 3300049592 | Bacteria | 3219 |
| 578 | Ga0501077_0004270 | 3300049593 | Bacteria | 8639 |
| 579 | Ga0501079_0000699 | 3300049741 | Bacteria | 22677 |
| 580 | Ga0501083_0108265 | 3300049744 | Bacteria | 1828 |
| 581 | Ga0501226_000009 | 3300049853 | Bacteria | 194138 |
| 582 | nmdc:mga08x19_63809_c1 | 3300050514 | Bacteria | 2390 |
| 583 | Ga0500583_0077839 | 3300053092 | Bacteria | 1597 |
| 584 | Ga0500641_0047339 | 3300053096 | Bacteria | 1758 |
| 585 | Ga0500650_0000086 | 3300053098 | Bacteria | 26596 |
| 586 | Ga0500556_0001046 | 3300053104 | Bacteria | 14342 |
| 587 | Ga0500617_054048 | 3300053124 | Bacteria | 1787 |
| 588 | Ga0500628_107180 | 3300053129 | Bacteria | 746 |
| 589 | Ga0500655_067047 | 3300053133 | Bacteria | 728 |
| 590 | Ga0500658_0010613 | 3300053134 | Bacteria | 3398 |
| 591 | Ga0500568_0036073 | 3300053139 | Bacteria | 2014 |
| 592 | Ga0500568_0125454 | 3300053139 | Bacteria | 956 |
| 593 | Ga0500616_0000075 | 3300053153 | Bacteria | 221455 |
| 594 | Ga0500616_0046892 | 3300053153 | Bacteria | 2296 |
| 595 | Ga0500616_0255531 | 3300053153 | Bacteria | 746 |
| 596 | Ga0500656_002360 | 3300053732 | Bacteria | 1706 |
| 597 | Ga0501084_0024083 | 3300054114 | Bacteria | 5077 |
| 598 | Ga0501084_0277629 | 3300054114 | Bacteria | 1415 |
| 599 | Ga0501082_0375004 | 3300060353 | Bacteria | 1241 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046506 | Ga0495583_0193873 | Ga0495583_0193873_73_693 | 195 |
| 2 | 3300005330 | Ga0070690_100643858 | Ga0070690_1006438581 | 196 |
| 3 | 3300005331 | Ga0070670_100125563 | Ga0070670_1001255632 | 196 |
| 4 | 3300005331 | Ga0070670_100443998 | Ga0070670_1004439982 | 196 |
| 5 | 3300005333 | Ga0070677_10016480 | Ga0070677_100164804 | 196 |
| 6 | 3300005333 | Ga0070677_10017058 | Ga0070677_100170583 | 196 |
| 7 | 3300005338 | Ga0068868_100322814 | Ga0068868_1003228142 | 196 |
| 8 | 3300005354 | Ga0070675_100024236 | Ga0070675_1000242363 | 196 |
| 9 | 3300005356 | Ga0070674_100107537 | Ga0070674_1001075371 | 196 |
| 10 | 3300005356 | Ga0070674_100117125 | Ga0070674_1001171251 | 196 |
| 11 | 3300005364 | Ga0070673_100008710 | Ga0070673_1000087102 | 196 |
| 12 | 3300005364 | Ga0070673_100296696 | Ga0070673_1002966962 | 196 |
| 13 | 3300005441 | Ga0070700_100137406 | Ga0070700_1001374062 | 196 |
| 14 | 3300005456 | Ga0070678_100021992 | Ga0070678_1000219924 | 196 |
| 15 | 3300005459 | Ga0068867_100057821 | Ga0068867_1000578212 | 196 |
| 16 | 3300005466 | Ga0070685_10034296 | Ga0070685_100342962 | 196 |
| 17 | 3300005543 | Ga0070672_100004027 | Ga0070672_1000040274 | 196 |
| 18 | 3300005543 | Ga0070672_100022337 | Ga0070672_1000223375 | 196 |
| 19 | 3300005548 | Ga0070665_100611884 | Ga0070665_1006118841 | 196 |
| 20 | 3300005614 | Ga0068856_100121245 | Ga0068856_1001212452 | 196 |
| 21 | 3300005617 | Ga0068859_100032042 | Ga0068859_1000320423 | 196 |
| 22 | 3300005719 | Ga0068861_100304550 | Ga0068861_1003045502 | 196 |
| 23 | 3300005834 | Ga0068851_10228226 | Ga0068851_102282261 | 196 |
| 24 | 3300005840 | Ga0068870_10001989 | Ga0068870_100019896 | 196 |
| 25 | 3300005840 | Ga0068870_10082565 | Ga0068870_100825652 | 196 |
| 26 | 3300005841 | Ga0068863_100003628 | Ga0068863_1000036284 | 196 |
| 27 | 3300005841 | Ga0068863_100071918 | Ga0068863_1000719182 | 196 |
| 28 | 3300005842 | Ga0068858_100018434 | Ga0068858_1000184342 | 196 |
| 29 | 3300005843 | Ga0068860_100000274 | Ga0068860_10000027441 | 196 |
| 30 | 3300006163 | Ga0070715_10217577 | Ga0070715_102175772 | 196 |
| 31 | 3300006237 | Ga0097621_100179596 | Ga0097621_1001795962 | 196 |
| 32 | 3300006881 | Ga0068865_100509266 | Ga0068865_1005092662 | 196 |
| 33 | 3300006881 | Ga0068865_100572046 | Ga0068865_1005720462 | 196 |
| 34 | 3300006931 | Ga0097620_100032042 | Ga0097620_1000320422 | 196 |
| 35 | 3300009093 | Ga0105240_10008879 | Ga0105240_100088799 | 196 |
| 36 | 3300009176 | Ga0105242_10552344 | Ga0105242_105523442 | 196 |
| 37 | 3300010375 | Ga0105239_10025606 | Ga0105239_100256063 | 196 |
| 38 | 3300013296 | Ga0157374_10132583 | Ga0157374_101325831 | 196 |
| 39 | 3300014969 | Ga0157376_10031227 | Ga0157376_100312271 | 196 |
| 40 | 3300014969 | Ga0157376_10032550 | Ga0157376_100325505 | 196 |
| 41 | 3300017792 | Ga0163161_10040256 | Ga0163161_100402565 | 196 |
| 42 | 3300025893 | Ga0207682_10009116 | Ga0207682_100091161 | 196 |
| 43 | 3300025893 | Ga0207682_10020839 | Ga0207682_100208394 | 196 |
| 44 | 3300025899 | Ga0207642_10083734 | Ga0207642_100837342 | 196 |
| 45 | 3300025900 | Ga0207710_10074493 | Ga0207710_100744932 | 196 |
| 46 | 3300025908 | Ga0207643_10009378 | Ga0207643_100093783 | 196 |
| 47 | 3300025908 | Ga0207643_10050945 | Ga0207643_100509452 | 196 |
| 48 | 3300025913 | Ga0207695_10037335 | Ga0207695_100373353 | 196 |
| 49 | 3300025913 | Ga0207695_10067312 | Ga0207695_100673122 | 196 |
| 50 | 3300025923 | Ga0207681_10297283 | Ga0207681_102972831 | 196 |
| 51 | 3300025925 | Ga0207650_10529205 | Ga0207650_105292051 | 196 |
| 52 | 3300025926 | Ga0207659_10032055 | Ga0207659_100320554 | 196 |
| 53 | 3300025931 | Ga0207644_10398026 | Ga0207644_103980262 | 196 |
| 54 | 3300025933 | Ga0207706_10309385 | Ga0207706_103093852 | 196 |
| 55 | 3300025934 | Ga0207686_10137264 | Ga0207686_101372642 | 196 |
| 56 | 3300025940 | Ga0207691_10003456 | Ga0207691_1000345611 | 196 |
| 57 | 3300025942 | Ga0207689_10090719 | Ga0207689_100907193 | 196 |
| 58 | 3300025960 | Ga0207651_10031031 | Ga0207651_100310312 | 196 |
| 59 | 3300025960 | Ga0207651_10045213 | Ga0207651_100452132 | 196 |
| 60 | 3300025981 | Ga0207640_10374339 | Ga0207640_103743391 | 196 |
| 61 | 3300025986 | Ga0207658_10352747 | Ga0207658_103527472 | 196 |
| 62 | 3300026023 | Ga0207677_10210816 | Ga0207677_102108162 | 196 |
| 63 | 3300026035 | Ga0207703_10001570 | Ga0207703_1000157016 | 196 |
| 64 | 3300026067 | Ga0207678_10968639 | Ga0207678_109686391 | 196 |
| 65 | 3300026075 | Ga0207708_10182924 | Ga0207708_101829242 | 196 |
| 66 | 3300026078 | Ga0207702_10199566 | Ga0207702_101995662 | 196 |
| 67 | 3300026088 | Ga0207641_10000290 | Ga0207641_1000029030 | 196 |
| 68 | 3300026088 | Ga0207641_10074438 | Ga0207641_100744384 | 196 |
| 69 | 3300026089 | Ga0207648_10032625 | Ga0207648_100326252 | 196 |
| 70 | 3300026095 | Ga0207676_10157103 | Ga0207676_101571032 | 196 |
| 71 | 3300026118 | Ga0207675_100080746 | Ga0207675_1000807464 | 196 |
| 72 | 3300026121 | Ga0207683_10054110 | Ga0207683_100541102 | 196 |
| 73 | 3300026121 | Ga0207683_10081437 | Ga0207683_100814374 | 196 |
| 74 | 3300028381 | Ga0268264_10000058 | Ga0268264_10000058292 | 196 |
| 75 | 3300028381 | Ga0268264_10000060 | Ga0268264_10000060286 | 196 |
| 76 | 3300031824 | Ga0307413_10250470 | Ga0307413_102504701 | 196 |
| 77 | 3300031852 | Ga0307410_10069546 | Ga0307410_100695462 | 196 |
| 78 | 3300031852 | Ga0307410_10373237 | Ga0307410_103732371 | 196 |
| 79 | 3300031911 | Ga0307412_10197362 | Ga0307412_101973622 | 196 |
| 80 | 3300041460 | Ga0451802_0702001 | Ga0451802_0702001_77_667 | 196 |
| 81 | 3300046519 | Ga0495632_0013127 | Ga0495632_0013127_392_982 | 196 |
| 82 | 3300046648 | Ga0495611_0389583 | Ga0495611_0389583_14_604 | 196 |
| 83 | 3300046660 | Ga0495625_0022716 | Ga0495625_0022716_1979_2569 | 196 |
| 84 | 3300046684 | Ga0495669_0176108 | Ga0495669_0176108_57_647 | 196 |
| 85 | 3300049581 | Ga0501047_0683745 | Ga0501047_0683745_173_763 | 196 |
| 86 | 3300053129 | Ga0500628_107180 | Ga0500628_107180_119_709 | 196 |
| 87 | 3300028794 | Ga0307515_10070359 | Ga0307515_100703592 | 197 |
| 88 | 3300025986 | Ga0207658_11032027 | Ga0207658_110320271 | 198 |
| 89 | 3300026067 | Ga0207678_10312040 | Ga0207678_103120402 | 198 |
| 90 | 3300046455 | Ga0495603_0417240 | Ga0495603_0417240_162_758 | 198 |
| 91 | 3300046616 | Ga0495668_0022887 | Ga0495668_0022887_1666_2262 | 198 |
| 92 | 3300048088 | Ga0495602_0423440 | Ga0495602_0423440_303_899 | 198 |
| 93 | 3300041452 | Ga0451793_1836681 | Ga0451793_1836681_253_855 | 200 |
| 94 | iso_pu_bacteria | 2510065053 | 2510281765 | 202 |
| 95 | iso_pu_bacteria | 2510065055 | 2510292068 | 202 |
| 96 | iso_pu_bacteria | 2510065058 | 2510309913 | 202 |
| 97 | iso_pu_bacteria | 2738541276 | 2738716297 | 202 |
| 98 | iso_pu_bacteria | 2773857672 | 2774130087 | 202 |
| 99 | iso_pu_bacteria | 2808606373 | 2808907782 | 202 |
| 100 | iso_pu_bacteria | 2917832318 | 2917832595 | 202 |
| 101 | iso_pu_bacteria | 2919125081 | 2919125369 | 202 |
| 102 | iso_pu_bacteria | 2974298342 | 2974300460 | 202 |
| 103 | iso_pu_bacteria | 2984504281 | 2984508573 | 202 |
| 104 | iso_pu_bacteria | 8016728285 | 8016729169 | 202 |
| 105 | 3300048920 | Ga0496117_0181589 | Ga0496117_0181589_539_1150 | 203 |
| 106 | 3300025920 | Ga0207649_10084219 | Ga0207649_100842193 | 204 |
| 107 | iso_pu_bacteria | 2984499530 | 2984502852 | 204 |
| 108 | 3300037853 | Ga0436364_0130364 | Ga0436364_0130364_140_757 | 205 |
| 109 | 3300039447 | Ga0436361_0990724 | Ga0436361_0990724_119_736 | 205 |
| 110 | 3300005329 | Ga0070683_100075371 | Ga0070683_1000753714 | 206 |
| 111 | 3300005331 | Ga0070670_100000026 | Ga0070670_10000002677 | 206 |
| 112 | 3300005335 | Ga0070666_10140565 | Ga0070666_101405652 | 206 |
| 113 | 3300005336 | Ga0070680_100021104 | Ga0070680_1000211042 | 206 |
| 114 | 3300005337 | Ga0070682_100048562 | Ga0070682_1000485622 | 206 |
| 115 | 3300005347 | Ga0070668_100635461 | Ga0070668_1006354611 | 206 |
| 116 | 3300005355 | Ga0070671_100000058 | Ga0070671_10000005816 | 206 |
| 117 | 3300005365 | Ga0070688_100001801 | Ga0070688_10000180111 | 206 |
| 118 | 3300005367 | Ga0070667_100000002 | Ga0070667_100000002226 | 206 |
| 119 | 3300005367 | Ga0070667_100463521 | Ga0070667_1004635212 | 206 |
| 120 | 3300005367 | Ga0070667_100600681 | Ga0070667_1006006812 | 206 |
| 121 | 3300005435 | Ga0070714_100700776 | Ga0070714_1007007761 | 206 |
| 122 | 3300005436 | Ga0070713_100098048 | Ga0070713_1000980482 | 206 |
| 123 | 3300005455 | Ga0070663_100086223 | Ga0070663_1000862232 | 206 |
| 124 | 3300005458 | Ga0070681_10029013 | Ga0070681_100290132 | 206 |
| 125 | 3300005458 | Ga0070681_10057902 | Ga0070681_100579024 | 206 |
| 126 | 3300005458 | Ga0070681_10083399 | Ga0070681_100833994 | 206 |
| 127 | 3300005466 | Ga0070685_10000009 | Ga0070685_1000000925 | 206 |
| 128 | 3300005530 | Ga0070679_100004487 | Ga0070679_1000044878 | 206 |
| 129 | 3300005530 | Ga0070679_100021104 | Ga0070679_1000211042 | 206 |
| 130 | 3300005530 | Ga0070679_100032153 | Ga0070679_1000321535 | 206 |
| 131 | 3300005530 | Ga0070679_100065827 | Ga0070679_1000658273 | 206 |
| 132 | 3300005530 | Ga0070679_100261453 | Ga0070679_1002614532 | 206 |
| 133 | 3300005530 | Ga0070679_100355789 | Ga0070679_1003557892 | 206 |
| 134 | 3300005535 | Ga0070684_100080193 | Ga0070684_1000801934 | 206 |
| 135 | 3300005535 | Ga0070684_100332557 | Ga0070684_1003325572 | 206 |
| 136 | 3300005539 | Ga0068853_100164936 | Ga0068853_1001649362 | 206 |
| 137 | 3300005547 | Ga0070693_100078840 | Ga0070693_1000788402 | 206 |
| 138 | 3300005548 | Ga0070665_100005431 | Ga0070665_1000054319 | 206 |
| 139 | 3300005548 | Ga0070665_100021539 | Ga0070665_1000215395 | 206 |
| 140 | 3300005548 | Ga0070665_100026031 | Ga0070665_1000260317 | 206 |
| 141 | 3300005548 | Ga0070665_100291049 | Ga0070665_1002910491 | 206 |
| 142 | 3300005563 | Ga0068855_100007608 | Ga0068855_1000076085 | 206 |
| 143 | 3300005563 | Ga0068855_100062151 | Ga0068855_1000621512 | 206 |
| 144 | 3300005563 | Ga0068855_100106151 | Ga0068855_1001061511 | 206 |
| 145 | 3300005563 | Ga0068855_100116201 | Ga0068855_1001162013 | 206 |
| 146 | 3300005578 | Ga0068854_100054942 | Ga0068854_1000549422 | 206 |
| 147 | 3300005614 | Ga0068856_100142179 | Ga0068856_1001421792 | 206 |
| 148 | 3300005617 | Ga0068859_100034325 | Ga0068859_1000343252 | 206 |
| 149 | 3300005618 | Ga0068864_100000002 | Ga0068864_100000002251 | 206 |
| 150 | 3300005719 | Ga0068861_100012556 | Ga0068861_1000125566 | 206 |
| 151 | 3300005719 | Ga0068861_100123964 | Ga0068861_1001239642 | 206 |
| 152 | 3300005842 | Ga0068858_100173808 | Ga0068858_1001738082 | 206 |
| 153 | 3300005842 | Ga0068858_100597097 | Ga0068858_1005970972 | 206 |
| 154 | 3300005843 | Ga0068860_100000684 | Ga0068860_10000068433 | 206 |
| 155 | 3300005844 | Ga0068862_100016178 | Ga0068862_1000161782 | 206 |
| 156 | 3300005844 | Ga0068862_100184704 | Ga0068862_1001847042 | 206 |
| 157 | 3300006237 | Ga0097621_100354410 | Ga0097621_1003544102 | 206 |
| 158 | 3300006358 | Ga0068871_100338738 | Ga0068871_1003387382 | 206 |
| 159 | 3300006358 | Ga0068871_100520568 | Ga0068871_1005205682 | 206 |
| 160 | 3300006881 | Ga0068865_100334236 | Ga0068865_1003342362 | 206 |
| 161 | 3300006931 | Ga0097620_100034325 | Ga0097620_1000343255 | 206 |
| 162 | 3300009093 | Ga0105240_10016620 | Ga0105240_100166202 | 206 |
| 163 | 3300009093 | Ga0105240_10017821 | Ga0105240_100178216 | 206 |
| 164 | 3300009093 | Ga0105240_10095157 | Ga0105240_100951573 | 206 |
| 165 | 3300009093 | Ga0105240_10133648 | Ga0105240_101336482 | 206 |
| 166 | 3300009093 | Ga0105240_10154806 | Ga0105240_101548062 | 206 |
| 167 | 3300009093 | Ga0105240_10294654 | Ga0105240_102946542 | 206 |
| 168 | 3300009093 | Ga0105240_10497912 | Ga0105240_104979122 | 206 |
| 169 | 3300009094 | Ga0111539_10607081 | Ga0111539_106070813 | 206 |
| 170 | 3300009094 | Ga0111539_10939241 | Ga0111539_109392412 | 206 |
| 171 | 3300009101 | Ga0105247_10029168 | Ga0105247_100291681 | 206 |
| 172 | 3300009174 | Ga0105241_10180064 | Ga0105241_101800642 | 206 |
| 173 | 3300009176 | Ga0105242_10371496 | Ga0105242_103714962 | 206 |
| 174 | 3300009177 | Ga0105248_10112443 | Ga0105248_101124432 | 206 |
| 175 | 3300009177 | Ga0105248_10132383 | Ga0105248_101323832 | 206 |
| 176 | 3300009177 | Ga0105248_10368724 | Ga0105248_103687242 | 206 |
| 177 | 3300009545 | Ga0105237_10074676 | Ga0105237_100746764 | 206 |
| 178 | 3300009545 | Ga0105237_10207353 | Ga0105237_102073532 | 206 |
| 179 | 3300009545 | Ga0105237_10217420 | Ga0105237_102174202 | 206 |
| 180 | 3300009545 | Ga0105237_10274087 | Ga0105237_102740872 | 206 |
| 181 | 3300009545 | Ga0105237_10276752 | Ga0105237_102767522 | 206 |
| 182 | 3300009545 | Ga0105237_11175503 | Ga0105237_111755031 | 206 |
| 183 | 3300009551 | Ga0105238_10002313 | Ga0105238_1000231311 | 206 |
| 184 | 3300009551 | Ga0105238_10022722 | Ga0105238_100227223 | 206 |
| 185 | 3300009551 | Ga0105238_10059981 | Ga0105238_100599812 | 206 |
| 186 | 3300009551 | Ga0105238_10937504 | Ga0105238_109375041 | 206 |
| 187 | 3300009553 | Ga0105249_10108638 | Ga0105249_101086382 | 206 |
| 188 | 3300009553 | Ga0105249_10321731 | Ga0105249_103217312 | 206 |
| 189 | 3300010375 | Ga0105239_10394750 | Ga0105239_103947502 | 206 |
| 190 | 3300010375 | Ga0105239_10610628 | Ga0105239_106106282 | 206 |
| 191 | 3300013102 | Ga0157371_10003190 | Ga0157371_100031902 | 206 |
| 192 | 3300013104 | Ga0157370_10009142 | Ga0157370_100091424 | 206 |
| 193 | 3300013105 | Ga0157369_10017382 | Ga0157369_100173822 | 206 |
| 194 | 3300013105 | Ga0157369_10021722 | Ga0157369_100217223 | 206 |
| 195 | 3300013105 | Ga0157369_10096697 | Ga0157369_100966972 | 206 |
| 196 | 3300013105 | Ga0157369_10295654 | Ga0157369_102956542 | 206 |
| 197 | 3300013296 | Ga0157374_10200378 | Ga0157374_102003782 | 206 |
| 198 | 3300013306 | Ga0163162_10016055 | Ga0163162_100160556 | 206 |
| 199 | 3300013307 | Ga0157372_10072228 | Ga0157372_100722284 | 206 |
| 200 | 3300013307 | Ga0157372_10348016 | Ga0157372_103480162 | 206 |
| 201 | 3300013307 | Ga0157372_10373304 | Ga0157372_103733042 | 206 |
| 202 | 3300013307 | Ga0157372_10570057 | Ga0157372_105700572 | 206 |
| 203 | 3300013307 | Ga0157372_10682006 | Ga0157372_106820061 | 206 |
| 204 | 3300014325 | Ga0163163_10000081 | Ga0163163_1000008193 | 206 |
| 205 | 3300014325 | Ga0163163_10131148 | Ga0163163_101311482 | 206 |
| 206 | 3300014325 | Ga0163163_10476578 | Ga0163163_104765782 | 206 |
| 207 | 3300014325 | Ga0163163_10970527 | Ga0163163_109705272 | 206 |
| 208 | 3300014326 | Ga0157380_10058159 | Ga0157380_100581594 | 206 |
| 209 | 3300014326 | Ga0157380_10713779 | Ga0157380_107137791 | 206 |
| 210 | 3300014326 | Ga0157380_11083546 | Ga0157380_110835462 | 206 |
| 211 | 3300014745 | Ga0157377_10539971 | Ga0157377_105399712 | 206 |
| 212 | 3300014968 | Ga0157379_10022208 | Ga0157379_100222084 | 206 |
| 213 | 3300014968 | Ga0157379_10060171 | Ga0157379_100601712 | 206 |
| 214 | 3300014969 | Ga0157376_10368450 | Ga0157376_103684502 | 206 |
| 215 | 3300020070 | Ga0206356_10460238 | Ga0206356_104602382 | 206 |
| 216 | 3300025898 | Ga0207692_10138119 | Ga0207692_101381192 | 206 |
| 217 | 3300025900 | Ga0207710_10020394 | Ga0207710_100203942 | 206 |
| 218 | 3300025903 | Ga0207680_10030420 | Ga0207680_100304202 | 206 |
| 219 | 3300025904 | Ga0207647_10051744 | Ga0207647_100517442 | 206 |
| 220 | 3300025912 | Ga0207707_10005259 | Ga0207707_1000525911 | 206 |
| 221 | 3300025912 | Ga0207707_10012047 | Ga0207707_100120474 | 206 |
| 222 | 3300025912 | Ga0207707_10031276 | Ga0207707_100312762 | 206 |
| 223 | 3300025912 | Ga0207707_10163405 | Ga0207707_101634053 | 206 |
| 224 | 3300025912 | Ga0207707_10744727 | Ga0207707_107447271 | 206 |
| 225 | 3300025913 | Ga0207695_10008742 | Ga0207695_100087425 | 206 |
| 226 | 3300025913 | Ga0207695_10023623 | Ga0207695_100236236 | 206 |
| 227 | 3300025913 | Ga0207695_10029601 | Ga0207695_100296012 | 206 |
| 228 | 3300025913 | Ga0207695_10043328 | Ga0207695_100433282 | 206 |
| 229 | 3300025913 | Ga0207695_10094419 | Ga0207695_100944192 | 206 |
| 230 | 3300025913 | Ga0207695_10124600 | Ga0207695_101246002 | 206 |
| 231 | 3300025913 | Ga0207695_10218862 | Ga0207695_102188622 | 206 |
| 232 | 3300025914 | Ga0207671_10150471 | Ga0207671_101504712 | 206 |
| 233 | 3300025914 | Ga0207671_10183755 | Ga0207671_101837551 | 206 |
| 234 | 3300025914 | Ga0207671_10189717 | Ga0207671_101897172 | 206 |
| 235 | 3300025917 | Ga0207660_10004159 | Ga0207660_100041593 | 206 |
| 236 | 3300025917 | Ga0207660_10372958 | Ga0207660_103729582 | 206 |
| 237 | 3300025921 | Ga0207652_10044475 | Ga0207652_100444752 | 206 |
| 238 | 3300025921 | Ga0207652_10102243 | Ga0207652_101022432 | 206 |
| 239 | 3300025921 | Ga0207652_10231361 | Ga0207652_102313612 | 206 |
| 240 | 3300025921 | Ga0207652_10976386 | Ga0207652_109763861 | 206 |
| 241 | 3300025924 | Ga0207694_10103459 | Ga0207694_101034592 | 206 |
| 242 | 3300025924 | Ga0207694_10186287 | Ga0207694_101862872 | 206 |
| 243 | 3300025924 | Ga0207694_10288215 | Ga0207694_102882152 | 206 |
| 244 | 3300025925 | Ga0207650_10000002 | Ga0207650_10000002247 | 206 |
| 245 | 3300025928 | Ga0207700_10095529 | Ga0207700_100955292 | 206 |
| 246 | 3300025931 | Ga0207644_10000020 | Ga0207644_1000002081 | 206 |
| 247 | 3300025941 | Ga0207711_10000619 | Ga0207711_1000061916 | 206 |
| 248 | 3300025944 | Ga0207661_10227983 | Ga0207661_102279832 | 206 |
| 249 | 3300025949 | Ga0207667_10006536 | Ga0207667_100065362 | 206 |
| 250 | 3300025949 | Ga0207667_10024211 | Ga0207667_100242112 | 206 |
| 251 | 3300025949 | Ga0207667_10186652 | Ga0207667_101866522 | 206 |
| 252 | 3300025961 | Ga0207712_10190539 | Ga0207712_101905392 | 206 |
| 253 | 3300025981 | Ga0207640_10050142 | Ga0207640_100501423 | 206 |
| 254 | 3300025986 | Ga0207658_10000001 | Ga0207658_100000011105 | 206 |
| 255 | 3300026035 | Ga0207703_10020650 | Ga0207703_100206504 | 206 |
| 256 | 3300026035 | Ga0207703_10180767 | Ga0207703_101807672 | 206 |
| 257 | 3300026078 | Ga0207702_10059039 | Ga0207702_100590393 | 206 |
| 258 | 3300026078 | Ga0207702_11151143 | Ga0207702_111511431 | 206 |
| 259 | 3300026088 | Ga0207641_10016513 | Ga0207641_100165134 | 206 |
| 260 | 3300026088 | Ga0207641_10043240 | Ga0207641_100432404 | 206 |
| 261 | 3300026095 | Ga0207676_10000001 | Ga0207676_10000001247 | 206 |
| 262 | 3300026116 | Ga0207674_10658252 | Ga0207674_106582521 | 206 |
| 263 | 3300026118 | Ga0207675_100004461 | Ga0207675_1000044617 | 206 |
| 264 | 3300026118 | Ga0207675_100050538 | Ga0207675_1000505382 | 206 |
| 265 | 3300028379 | Ga0268266_10000704 | Ga0268266_100007042 | 206 |
| 266 | 3300028379 | Ga0268266_10010219 | Ga0268266_100102198 | 206 |
| 267 | 3300028380 | Ga0268265_10000258 | Ga0268265_1000025842 | 206 |
| 268 | 3300028380 | Ga0268265_10865062 | Ga0268265_108650622 | 206 |
| 269 | 3300028381 | Ga0268264_10000004 | Ga0268264_10000004247 | 206 |
| 270 | 3300028573 | Ga0265334_10031480 | Ga0265334_100314802 | 206 |
| 271 | 3300028800 | Ga0265338_10027456 | Ga0265338_100274564 | 206 |
| 272 | 3300030521 | Ga0307511_10022320 | Ga0307511_100223204 | 206 |
| 273 | 3300031247 | Ga0265340_10030088 | Ga0265340_100300883 | 206 |
| 274 | 3300031250 | Ga0265331_10027150 | Ga0265331_100271502 | 206 |
| 275 | 3300031251 | Ga0265327_10000282 | Ga0265327_100002826 | 206 |
| 276 | 3300031456 | Ga0307513_10084125 | Ga0307513_100841252 | 206 |
| 277 | 3300031456 | Ga0307513_10505620 | Ga0307513_105056201 | 206 |
| 278 | 3300031456 | Ga0307513_10519368 | Ga0307513_105193682 | 206 |
| 279 | 3300031507 | Ga0307509_10000048 | Ga0307509_1000004854 | 206 |
| 280 | 3300031548 | Ga0307408_100000721 | Ga0307408_10000072116 | 206 |
| 281 | 3300031901 | Ga0307406_10993697 | Ga0307406_109936971 | 206 |
| 282 | 3300031903 | Ga0307407_10098790 | Ga0307407_100987902 | 206 |
| 283 | 3300031995 | Ga0307409_100156196 | Ga0307409_1001561961 | 206 |
| 284 | 3300031995 | Ga0307409_100315927 | Ga0307409_1003159272 | 206 |
| 285 | 3300032002 | Ga0307416_100357846 | Ga0307416_1003578462 | 206 |
| 286 | 3300032005 | Ga0307411_10685378 | Ga0307411_106853781 | 206 |
| 287 | 3300035724 | Ga0373933_0191147 | Ga0373933_0191147_270_890 | 206 |
| 288 | 3300037068 | Ga0373925_0362882 | Ga0373925_0362882_462_1082 | 206 |
| 289 | 3300037418 | Ga0395900_0331445 | Ga0395900_0331445_301_921 | 206 |
| 290 | 3300037418 | Ga0395900_0985223 | Ga0395900_0985223_103_723 | 206 |
| 291 | 3300037466 | Ga0395898_0030669 | Ga0395898_0030669_2002_2622 | 206 |
| 292 | 3300037466 | Ga0395898_0103282 | Ga0395898_0103282_916_1536 | 206 |
| 293 | 3300041451 | Ga0451791_1935231 | Ga0451791_1935231_723_1343 | 206 |
| 294 | 3300041452 | Ga0451793_0376710 | Ga0451793_0376710_101_721 | 206 |
| 295 | 3300041486 | Ga0451807_0279481 | Ga0451807_0279481_808_1428 | 206 |
| 296 | 3300041494 | Ga0451837_1191953 | Ga0451837_1191953_708_1328 | 206 |
| 297 | 3300041997 | Ga0439431_0004348 | Ga0439431_0004348_1179_1799 | 206 |
| 298 | 3300042000 | Ga0439437_007994 | Ga0439437_007994_324_944 | 206 |
| 299 | 3300042012 | Ga0439455_0003927 | Ga0439455_0003927_547_1167 | 206 |
| 300 | 3300042115 | Ga0450911_000015 | Ga0450911_000015_20993_21613 | 206 |
| 301 | 3300042132 | Ga0450895_003648 | Ga0450895_003648_441_1061 | 206 |
| 302 | 3300042136 | Ga0450900_024920 | Ga0450900_024920_13_633 | 206 |
| 303 | 3300042139 | Ga0450904_000005 | Ga0450904_000005_42163_42783 | 206 |
| 304 | 3300042156 | Ga0439446_0011153 | Ga0439446_0011153_434_1054 | 206 |
| 305 | 3300042438 | Ga0439459_0003543 | Ga0439459_0003543_542_1162 | 206 |
| 306 | 3300042438 | Ga0439459_0042345 | Ga0439459_0042345_106_726 | 206 |
| 307 | 3300042530 | Ga0450916_000847 | Ga0450916_000847_1072_1692 | 206 |
| 308 | 3300042530 | Ga0450916_001487 | Ga0450916_001487_876_1496 | 206 |
| 309 | 3300044693 | Ga0466961_0102542 | Ga0466961_0102542_465_1085 | 206 |
| 310 | 3300045049 | Ga0466959_0558925 | Ga0466959_0558925_31_651 | 206 |
| 311 | 3300046458 | Ga0495591_048591 | Ga0495591_048591_519_1139 | 206 |
| 312 | 3300046459 | Ga0495629_0059962 | Ga0495629_0059962_1261_1881 | 206 |
| 313 | 3300046460 | Ga0495638_0063954 | Ga0495638_0063954_238_858 | 206 |
| 314 | 3300046475 | Ga0495639_0173725 | Ga0495639_0173725_389_1009 | 206 |
| 315 | 3300046491 | Ga0495584_0076955 | Ga0495584_0076955_294_914 | 206 |
| 316 | 3300046499 | Ga0495594_0509490 | Ga0495594_0509490_18_638 | 206 |
| 317 | 3300046500 | Ga0495596_0121296 | Ga0495596_0121296_83_703 | 206 |
| 318 | 3300046507 | Ga0495606_0054418 | Ga0495606_0054418_1356_1976 | 206 |
| 319 | 3300046507 | Ga0495606_0154118 | Ga0495606_0154118_334_954 | 206 |
| 320 | 3300046511 | Ga0495608_0465624 | Ga0495608_0465624_101_721 | 206 |
| 321 | 3300046513 | Ga0495616_0003020 | Ga0495616_0003020_3833_4453 | 206 |
| 322 | 3300046515 | Ga0495620_0043086 | Ga0495620_0043086_1216_1836 | 206 |
| 323 | 3300046523 | Ga0495644_0003534 | Ga0495644_0003534_3790_4410 | 206 |
| 324 | 3300046524 | Ga0495648_0283056 | Ga0495648_0283056_135_755 | 206 |
| 325 | 3300046535 | Ga0495586_0464502 | Ga0495586_0464502_54_674 | 206 |
| 326 | 3300046539 | Ga0495621_0004122 | Ga0495621_0004122_276_896 | 206 |
| 327 | 3300046543 | Ga0495645_0153953 | Ga0495645_0153953_490_1110 | 206 |
| 328 | 3300046615 | Ga0495656_0005412 | Ga0495656_0005412_1197_1817 | 206 |
| 329 | 3300046616 | Ga0495668_0069294 | Ga0495668_0069294_1111_1731 | 206 |
| 330 | 3300046660 | Ga0495625_0030402 | Ga0495625_0030402_2245_2865 | 206 |
| 331 | 3300046681 | Ga0495647_0011153 | Ga0495647_0011153_2035_2655 | 206 |
| 332 | 3300046683 | Ga0495658_0080882 | Ga0495658_0080882_532_1152 | 206 |
| 333 | 3300046690 | Ga0495624_0379951 | Ga0495624_0379951_202_822 | 206 |
| 334 | 3300046692 | Ga0495671_0015030 | Ga0495671_0015030_583_1203 | 206 |
| 335 | 3300046694 | Ga0495649_0001072 | Ga0495649_0001072_16577_17197 | 206 |
| 336 | 3300046694 | Ga0495649_0136398 | Ga0495649_0136398_617_1237 | 206 |
| 337 | 3300047320 | Ga0495672_0158277 | Ga0495672_0158277_157_777 | 206 |
| 338 | 3300047443 | Ga0495687_090888 | Ga0495687_090888_16_636 | 206 |
| 339 | 3300047470 | Ga0495681_0009447 | Ga0495681_0009447_477_1097 | 206 |
| 340 | 3300048905 | Ga0496102_0031702 | Ga0496102_0031702_4021_4641 | 206 |
| 341 | 3300048909 | Ga0496106_0509748 | Ga0496106_0509748_147_767 | 206 |
| 342 | 3300048917 | Ga0496114_0675054 | Ga0496114_0675054_200_820 | 206 |
| 343 | 3300048918 | Ga0496115_0353388 | Ga0496115_0353388_490_1110 | 206 |
| 344 | 3300048918 | Ga0496115_0711228 | Ga0496115_0711228_151_771 | 206 |
| 345 | 3300048920 | Ga0496117_0000090 | Ga0496117_0000090_42553_43173 | 206 |
| 346 | 3300048921 | Ga0496118_0000032 | Ga0496118_0000032_161864_162484 | 206 |
| 347 | 3300048921 | Ga0496118_0086731 | Ga0496118_0086731_723_1343 | 206 |
| 348 | 3300048923 | Ga0496120_0023689 | Ga0496120_0023689_210_830 | 206 |
| 349 | 3300048924 | Ga0496121_0084783 | Ga0496121_0084783_1604_2224 | 206 |
| 350 | 3300048927 | Ga0496124_0080960 | Ga0496124_0080960_1275_1895 | 206 |
| 351 | 3300048928 | Ga0496125_0000592 | Ga0496125_0000592_36751_37371 | 206 |
| 352 | 3300048928 | Ga0496125_0295350 | Ga0496125_0295350_248_868 | 206 |
| 353 | 3300048929 | Ga0496126_0021320 | Ga0496126_0021320_213_833 | 206 |
| 354 | 3300048929 | Ga0496126_0164527 | Ga0496126_0164527_943_1563 | 206 |
| 355 | 3300049460 | Ga0495682_0062585 | Ga0495682_0062585_403_1023 | 206 |
| 356 | 3300049572 | Ga0501036_0238443 | Ga0501036_0238443_663_1283 | 206 |
| 357 | 3300049572 | Ga0501036_0802485 | Ga0501036_0802485_114_734 | 206 |
| 358 | 3300049574 | Ga0501038_0692991 | Ga0501038_0692991_99_719 | 206 |
| 359 | 3300049578 | Ga0501042_0134422 | Ga0501042_0134422_1066_1686 | 206 |
| 360 | 3300049586 | Ga0501070_0302956 | Ga0501070_0302956_479_1099 | 206 |
| 361 | 3300049853 | Ga0501226_000009 | Ga0501226_000009_87923_88543 | 206 |
| 362 | 3300053092 | Ga0500583_0077839 | Ga0500583_0077839_260_880 | 206 |
| 363 | 3300053096 | Ga0500641_0047339 | Ga0500641_0047339_354_974 | 206 |
| 364 | 3300053124 | Ga0500617_054048 | Ga0500617_054048_49_669 | 206 |
| 365 | 3300053133 | Ga0500655_067047 | Ga0500655_067047_65_685 | 206 |
| 366 | 3300053134 | Ga0500658_0010613 | Ga0500658_0010613_1234_1854 | 206 |
| 367 | 3300053139 | Ga0500568_0036073 | Ga0500568_0036073_405_1025 | 206 |
| 368 | 3300053139 | Ga0500568_0125454 | Ga0500568_0125454_39_659 | 206 |
| 369 | 3300053153 | Ga0500616_0000075 | Ga0500616_0000075_71283_71903 | 206 |
| 370 | 3300053153 | Ga0500616_0255531 | Ga0500616_0255531_44_664 | 206 |
| 371 | 3300053732 | Ga0500656_002360 | Ga0500656_002360_535_1155 | 206 |
| 372 | 3300054114 | Ga0501084_0277629 | Ga0501084_0277629_157_777 | 206 |
| 373 | 3300005330 | Ga0070690_100295160 | Ga0070690_1002951601 | 207 |
| 374 | 3300005337 | Ga0070682_100076811 | Ga0070682_1000768112 | 207 |
| 375 | 3300005341 | Ga0070691_10062249 | Ga0070691_100622492 | 207 |
| 376 | 3300005343 | Ga0070687_100135554 | Ga0070687_1001355542 | 207 |
| 377 | 3300005364 | Ga0070673_100528335 | Ga0070673_1005283352 | 207 |
| 378 | 3300005440 | Ga0070705_100009609 | Ga0070705_1000096094 | 207 |
| 379 | 3300005441 | Ga0070700_100095543 | Ga0070700_1000955432 | 207 |
| 380 | 3300005543 | Ga0070672_100034320 | Ga0070672_1000343204 | 207 |
| 381 | 3300005544 | Ga0070686_100078137 | Ga0070686_1000781372 | 207 |
| 382 | 3300005547 | Ga0070693_100179181 | Ga0070693_1001791812 | 207 |
| 383 | 3300005617 | Ga0068859_100291642 | Ga0068859_1002916422 | 207 |
| 384 | 3300005719 | Ga0068861_100088371 | Ga0068861_1000883711 | 207 |
| 385 | 3300005843 | Ga0068860_100143532 | Ga0068860_1001435322 | 207 |
| 386 | 3300006881 | Ga0068865_100747670 | Ga0068865_1007476701 | 207 |
| 387 | 3300006931 | Ga0097620_100291632 | Ga0097620_1002916322 | 207 |
| 388 | 3300009093 | Ga0105240_10304043 | Ga0105240_103040432 | 207 |
| 389 | 3300013308 | Ga0157375_10069347 | Ga0157375_100693474 | 207 |
| 390 | 3300025913 | Ga0207695_10253613 | Ga0207695_102536132 | 207 |
| 391 | 3300025914 | Ga0207671_10463989 | Ga0207671_104639891 | 207 |
| 392 | 3300025918 | Ga0207662_10170287 | Ga0207662_101702871 | 207 |
| 393 | 3300025936 | Ga0207670_10086143 | Ga0207670_100861432 | 207 |
| 394 | 3300025938 | Ga0207704_10640822 | Ga0207704_106408222 | 207 |
| 395 | 3300025940 | Ga0207691_10013427 | Ga0207691_100134275 | 207 |
| 396 | 3300025960 | Ga0207651_10273063 | Ga0207651_102730632 | 207 |
| 397 | 3300026035 | Ga0207703_10332801 | Ga0207703_103328012 | 207 |
| 398 | 3300026075 | Ga0207708_10054431 | Ga0207708_100544314 | 207 |
| 399 | 3300026118 | Ga0207675_100004052 | Ga0207675_10000405212 | 207 |
| 400 | 3300028381 | Ga0268264_10552696 | Ga0268264_105526962 | 207 |
| 401 | 3300031507 | Ga0307509_10000074 | Ga0307509_1000007437 | 207 |
| 402 | 3300033180 | Ga0307510_10017304 | Ga0307510_100173046 | 207 |
| 403 | 3300046648 | Ga0495611_0255898 | Ga0495611_0255898_22_645 | 207 |
| 404 | 3300047472 | Ga0495686_0281442 | Ga0495686_0281442_95_718 | 207 |
| 405 | 3300048929 | Ga0496126_0007351 | Ga0496126_0007351_8455_9078 | 207 |
| 406 | 3300005367 | Ga0070667_100014844 | Ga0070667_1000148443 | 208 |
| 407 | 3300005456 | Ga0070678_100596251 | Ga0070678_1005962512 | 208 |
| 408 | 3300005466 | Ga0070685_10146087 | Ga0070685_101460872 | 208 |
| 409 | 3300005548 | Ga0070665_100017572 | Ga0070665_1000175727 | 208 |
| 410 | 3300005617 | Ga0068859_100004165 | Ga0068859_10000416512 | 208 |
| 411 | 3300005841 | Ga0068863_100000939 | Ga0068863_10000093926 | 208 |
| 412 | 3300005842 | Ga0068858_100000632 | Ga0068858_10000063232 | 208 |
| 413 | 3300005843 | Ga0068860_100077579 | Ga0068860_1000775792 | 208 |
| 414 | 3300006931 | Ga0097620_100004165 | Ga0097620_1000041652 | 208 |
| 415 | 3300009011 | Ga0105251_10008576 | Ga0105251_100085763 | 208 |
| 416 | 3300009092 | Ga0105250_10075358 | Ga0105250_100753582 | 208 |
| 417 | 3300009101 | Ga0105247_10000342 | Ga0105247_100003424 | 208 |
| 418 | 3300009177 | Ga0105248_10016662 | Ga0105248_100166622 | 208 |
| 419 | 3300009553 | Ga0105249_10052734 | Ga0105249_100527343 | 208 |
| 420 | 3300013102 | Ga0157371_10138854 | Ga0157371_101388542 | 208 |
| 421 | 3300013105 | Ga0157369_10012386 | Ga0157369_100123861 | 208 |
| 422 | 3300013306 | Ga0163162_10154546 | Ga0163162_101545462 | 208 |
| 423 | 3300014968 | Ga0157379_10096261 | Ga0157379_100962612 | 208 |
| 424 | 3300025735 | Ga0207713_1021127 | Ga0207713_10211271 | 208 |
| 425 | 3300025900 | Ga0207710_10000167 | Ga0207710_1000016757 | 208 |
| 426 | 3300025903 | Ga0207680_10215444 | Ga0207680_102154442 | 208 |
| 427 | 3300025931 | Ga0207644_10005739 | Ga0207644_100057396 | 208 |
| 428 | 3300025941 | Ga0207711_10115420 | Ga0207711_101154202 | 208 |
| 429 | 3300025961 | Ga0207712_10038119 | Ga0207712_100381192 | 208 |
| 430 | 3300026035 | Ga0207703_10001048 | Ga0207703_1000104814 | 208 |
| 431 | 3300026088 | Ga0207641_10020410 | Ga0207641_100204103 | 208 |
| 432 | 3300026121 | Ga0207683_10265491 | Ga0207683_102654912 | 208 |
| 433 | 3300028381 | Ga0268264_10053062 | Ga0268264_100530622 | 208 |
| 434 | 3300031456 | Ga0307513_10150915 | Ga0307513_101509152 | 208 |
| 435 | 3300048905 | Ga0496102_0021940 | Ga0496102_0021940_1409_2035 | 208 |
| 436 | 3300048909 | Ga0496106_0119110 | Ga0496106_0119110_377_1003 | 208 |
| 437 | 3300048910 | Ga0496107_0110958 | Ga0496107_0110958_112_738 | 208 |
| 438 | 3300048911 | Ga0496108_0025478 | Ga0496108_0025478_460_1086 | 208 |
| 439 | 3300048916 | Ga0496113_0657191 | Ga0496113_0657191_57_683 | 208 |
| 440 | 3300048924 | Ga0496121_0001021 | Ga0496121_0001021_7334_7960 | 208 |
| 441 | 3300048928 | Ga0496125_0095016 | Ga0496125_0095016_279_905 | 208 |
| 442 | 3300053098 | Ga0500650_0000086 | Ga0500650_0000086_8860_9486 | 208 |
| 443 | 3300053153 | Ga0500616_0046892 | Ga0500616_0046892_27_653 | 208 |
| 444 | 3300006237 | Ga0097621_100189645 | Ga0097621_1001896452 | 209 |
| 445 | 3300009176 | Ga0105242_10869935 | Ga0105242_108699351 | 209 |
| 446 | 3300031507 | Ga0307509_10321086 | Ga0307509_103210862 | 209 |
| 447 | 3300039447 | Ga0436361_0268579 | Ga0436361_0268579_165_794 | 209 |
| 448 | 3300039450 | Ga0436363_0120822 | Ga0436363_0120822_2384_3013 | 209 |
| 449 | 3300048927 | Ga0496124_0031151 | Ga0496124_0031151_3948_4577 | 209 |
| 450 | 2162886007 | SwRhRL2b_contig_1007197 | SwRhRL2b_0251.00008130 | 210 |
| 451 | 3300005289 | Ga0065704_10080259 | Ga0065704_100802595 | 210 |
| 452 | 3300005331 | Ga0070670_100059702 | Ga0070670_1000597023 | 210 |
| 453 | 3300005337 | Ga0070682_100046954 | Ga0070682_1000469543 | 210 |
| 454 | 3300005337 | Ga0070682_100108904 | Ga0070682_1001089042 | 210 |
| 455 | 3300005340 | Ga0070689_100360958 | Ga0070689_1003609582 | 210 |
| 456 | 3300005341 | Ga0070691_10038441 | Ga0070691_100384413 | 210 |
| 457 | 3300005344 | Ga0070661_100177430 | Ga0070661_1001774302 | 210 |
| 458 | 3300005345 | Ga0070692_10193805 | Ga0070692_101938052 | 210 |
| 459 | 3300005354 | Ga0070675_100293661 | Ga0070675_1002936612 | 210 |
| 460 | 3300005364 | Ga0070673_100172465 | Ga0070673_1001724652 | 210 |
| 461 | 3300005366 | Ga0070659_100139973 | Ga0070659_1001399732 | 210 |
| 462 | 3300005455 | Ga0070663_100101924 | Ga0070663_1001019245 | 210 |
| 463 | 3300005539 | Ga0068853_100745931 | Ga0068853_1007459312 | 210 |
| 464 | 3300005543 | Ga0070672_100114800 | Ga0070672_1001148004 | 210 |
| 465 | 3300005564 | Ga0070664_100042124 | Ga0070664_1000421245 | 210 |
| 466 | 3300005577 | Ga0068857_100418707 | Ga0068857_1004187073 | 210 |
| 467 | 3300005617 | Ga0068859_100507112 | Ga0068859_1005071122 | 210 |
| 468 | 3300005719 | Ga0068861_100041647 | Ga0068861_1000416475 | 210 |
| 469 | 3300005843 | Ga0068860_100683029 | Ga0068860_1006830292 | 210 |
| 470 | 3300005844 | Ga0068862_100049028 | Ga0068862_1000490282 | 210 |
| 471 | 3300006237 | Ga0097621_100142958 | Ga0097621_1001429582 | 210 |
| 472 | 3300006846 | Ga0075430_100513442 | Ga0075430_1005134422 | 210 |
| 473 | 3300006931 | Ga0097620_100507099 | Ga0097620_1005070992 | 210 |
| 474 | 3300013308 | Ga0157375_11072891 | Ga0157375_110728911 | 210 |
| 475 | 3300014325 | Ga0163163_10087399 | Ga0163163_100873993 | 210 |
| 476 | 3300014326 | Ga0157380_10002827 | Ga0157380_100028274 | 210 |
| 477 | 3300014326 | Ga0157380_10626218 | Ga0157380_106262181 | 210 |
| 478 | 3300025901 | Ga0207688_10373321 | Ga0207688_103733212 | 210 |
| 479 | 3300025907 | Ga0207645_10122995 | Ga0207645_101229951 | 210 |
| 480 | 3300025918 | Ga0207662_10034463 | Ga0207662_100344635 | 210 |
| 481 | 3300025919 | Ga0207657_10666860 | Ga0207657_106668601 | 210 |
| 482 | 3300025925 | Ga0207650_10046571 | Ga0207650_100465713 | 210 |
| 483 | 3300025926 | Ga0207659_10332095 | Ga0207659_103320952 | 210 |
| 484 | 3300025938 | Ga0207704_10356298 | Ga0207704_103562982 | 210 |
| 485 | 3300025940 | Ga0207691_10145671 | Ga0207691_101456714 | 210 |
| 486 | 3300025945 | Ga0207679_10126867 | Ga0207679_101268673 | 210 |
| 487 | 3300025945 | Ga0207679_10480313 | Ga0207679_104803132 | 210 |
| 488 | 3300025960 | Ga0207651_10653585 | Ga0207651_106535852 | 210 |
| 489 | 3300025961 | Ga0207712_10893522 | Ga0207712_108935221 | 210 |
| 490 | 3300026035 | Ga0207703_10709624 | Ga0207703_107096242 | 210 |
| 491 | 3300026067 | Ga0207678_10140164 | Ga0207678_101401643 | 210 |
| 492 | 3300026075 | Ga0207708_10063667 | Ga0207708_100636673 | 210 |
| 493 | 3300026118 | Ga0207675_100130703 | Ga0207675_1001307031 | 210 |
| 494 | 3300028380 | Ga0268265_10006412 | Ga0268265_100064124 | 210 |
| 495 | 3300031548 | Ga0307408_100043705 | Ga0307408_1000437052 | 210 |
| 496 | 3300031824 | Ga0307413_10007099 | Ga0307413_100070995 | 210 |
| 497 | 3300031852 | Ga0307410_10411932 | Ga0307410_104119322 | 210 |
| 498 | 3300031995 | Ga0307409_100193094 | Ga0307409_1001930943 | 210 |
| 499 | 3300032002 | Ga0307416_100036124 | Ga0307416_1000361242 | 210 |
| 500 | 3300032005 | Ga0307411_10684534 | Ga0307411_106845342 | 210 |
| 501 | 3300041443 | Ga0451789_0468735 | Ga0451789_0468735_135_767 | 210 |
| 502 | 3300041443 | Ga0451789_0554294 | Ga0451789_0554294_302_934 | 210 |
| 503 | 3300041451 | Ga0451791_1713758 | Ga0451791_1713758_678_1310 | 210 |
| 504 | 3300041459 | Ga0451800_0252305 | Ga0451800_0252305_1581_2213 | 210 |
| 505 | 3300041486 | Ga0451807_0302049 | Ga0451807_0302049_1280_1912 | 210 |
| 506 | 3300041486 | Ga0451807_1583312 | Ga0451807_1583312_1130_1762 | 210 |
| 507 | 3300041512 | Ga0451853_3663875 | Ga0451853_3663875_15_647 | 210 |
| 508 | 3300048907 | Ga0496104_0392440 | Ga0496104_0392440_86_718 | 210 |
| 509 | 3300049575 | Ga0501039_0163988 | Ga0501039_0163988_359_991 | 210 |
| 510 | 3300049583 | Ga0501067_0015730 | Ga0501067_0015730_2991_3623 | 210 |
| 511 | 3300049584 | Ga0501068_0007768 | Ga0501068_0007768_4817_5449 | 210 |
| 512 | 3300049584 | Ga0501068_0314765 | Ga0501068_0314765_325_957 | 210 |
| 513 | 3300049587 | Ga0501071_0020960 | Ga0501071_0020960_3348_3980 | 210 |
| 514 | 3300049588 | Ga0501072_0063844 | Ga0501072_0063844_1581_2213 | 210 |
| 515 | 3300049589 | Ga0501073_0002449 | Ga0501073_0002449_11412_12044 | 210 |
| 516 | 3300049590 | Ga0501074_0011278 | Ga0501074_0011278_5201_5833 | 210 |
| 517 | 3300049592 | Ga0501076_0052837 | Ga0501076_0052837_1777_2409 | 210 |
| 518 | 3300049593 | Ga0501077_0004270 | Ga0501077_0004270_179_811 | 210 |
| 519 | 3300049741 | Ga0501079_0000699 | Ga0501079_0000699_13633_14265 | 210 |
| 520 | 3300049744 | Ga0501083_0108265 | Ga0501083_0108265_207_839 | 210 |
| 521 | 3300054114 | Ga0501084_0024083 | Ga0501084_0024083_1948_2580 | 210 |
| 522 | 3300060353 | Ga0501082_0375004 | Ga0501082_0375004_186_818 | 210 |
| 523 | 3300006931 | Ga0097620_100545817 | Ga0097620_1005458172 | 211 |
| 524 | 3300028381 | Ga0268264_10163449 | Ga0268264_101634492 | 211 |
| 525 | 2162886012 | MBSR1b_contig_4575008 | MBSR1b_0919.00000220 | 212 |
| 526 | 3300005335 | Ga0070666_10124124 | Ga0070666_101241242 | 212 |
| 527 | 3300005338 | Ga0068868_100204151 | Ga0068868_1002041512 | 212 |
| 528 | 3300005355 | Ga0070671_100010865 | Ga0070671_1000108657 | 212 |
| 529 | 3300005364 | Ga0070673_100334286 | Ga0070673_1003342862 | 212 |
| 530 | 3300005367 | Ga0070667_100077403 | Ga0070667_1000774032 | 212 |
| 531 | 3300005437 | Ga0070710_10016709 | Ga0070710_100167092 | 212 |
| 532 | 3300005546 | Ga0070696_100118350 | Ga0070696_1001183502 | 212 |
| 533 | 3300005547 | Ga0070693_100759609 | Ga0070693_1007596091 | 212 |
| 534 | 3300005614 | Ga0068856_100042897 | Ga0068856_1000428973 | 212 |
| 535 | 3300005617 | Ga0068859_100371832 | Ga0068859_1003718322 | 212 |
| 536 | 3300005842 | Ga0068858_100069744 | Ga0068858_1000697443 | 212 |
| 537 | 3300005843 | Ga0068860_100182139 | Ga0068860_1001821393 | 212 |
| 538 | 3300006173 | Ga0070716_100044363 | Ga0070716_1000443634 | 212 |
| 539 | 3300006173 | Ga0070716_100106384 | Ga0070716_1001063842 | 212 |
| 540 | 3300006175 | Ga0070712_100010849 | Ga0070712_1000108494 | 212 |
| 541 | 3300006881 | Ga0068865_100017170 | Ga0068865_1000171706 | 212 |
| 542 | 3300006914 | Ga0075436_100074188 | Ga0075436_1000741882 | 212 |
| 543 | 3300006931 | Ga0097620_100371861 | Ga0097620_1003718612 | 212 |
| 544 | 3300009098 | Ga0105245_10283516 | Ga0105245_102835162 | 212 |
| 545 | 3300009101 | Ga0105247_10020146 | Ga0105247_100201464 | 212 |
| 546 | 3300009174 | Ga0105241_10058262 | Ga0105241_100582625 | 212 |
| 547 | 3300009174 | Ga0105241_10251989 | Ga0105241_102519892 | 212 |
| 548 | 3300009177 | Ga0105248_10218175 | Ga0105248_102181752 | 212 |
| 549 | 3300009545 | Ga0105237_10119763 | Ga0105237_101197633 | 212 |
| 550 | 3300009551 | Ga0105238_10405033 | Ga0105238_104050332 | 212 |
| 551 | 3300009553 | Ga0105249_10223695 | Ga0105249_102236952 | 212 |
| 552 | 3300013306 | Ga0163162_10564450 | Ga0163162_105644502 | 212 |
| 553 | 3300014325 | Ga0163163_10141824 | Ga0163163_101418242 | 212 |
| 554 | 3300014968 | Ga0157379_10125478 | Ga0157379_101254782 | 212 |
| 555 | 3300025899 | Ga0207642_10060928 | Ga0207642_100609283 | 212 |
| 556 | 3300025903 | Ga0207680_10250405 | Ga0207680_102504052 | 212 |
| 557 | 3300025911 | Ga0207654_10303290 | Ga0207654_103032902 | 212 |
| 558 | 3300025914 | Ga0207671_10457199 | Ga0207671_104571991 | 212 |
| 559 | 3300025915 | Ga0207693_10004507 | Ga0207693_1000450711 | 212 |
| 560 | 3300025931 | Ga0207644_10032383 | Ga0207644_100323833 | 212 |
| 561 | 3300025934 | Ga0207686_10466315 | Ga0207686_104663151 | 212 |
| 562 | 3300025939 | Ga0207665_10018494 | Ga0207665_100184944 | 212 |
| 563 | 3300025961 | Ga0207712_10132619 | Ga0207712_101326192 | 212 |
| 564 | 3300025986 | Ga0207658_10447122 | Ga0207658_104471222 | 212 |
| 565 | 3300026023 | Ga0207677_10054642 | Ga0207677_100546422 | 212 |
| 566 | 3300026035 | Ga0207703_10165873 | Ga0207703_101658732 | 212 |
| 567 | 3300026095 | Ga0207676_11002915 | Ga0207676_110029151 | 212 |
| 568 | 3300026121 | Ga0207683_10008549 | Ga0207683_1000854910 | 212 |
| 569 | 3300035086 | Ga0373934_0212027 | Ga0373934_0212027_134_772 | 212 |
| 570 | 3300035118 | Ga0373954_0046888 | Ga0373954_0046888_736_1374 | 212 |
| 571 | 3300036401 | Ga0373937_0009441 | Ga0373937_0009441_3014_3652 | 212 |
| 572 | 3300036401 | Ga0373937_0047167 | Ga0373937_0047167_124_762 | 212 |
| 573 | 3300037068 | Ga0373925_0064459 | Ga0373925_0064459_741_1379 | 212 |
| 574 | 3300046460 | Ga0495638_0342626 | Ga0495638_0342626_50_688 | 212 |
| 575 | 3300046472 | Ga0495580_0000463 | Ga0495580_0000463_27469_28107 | 212 |
| 576 | 3300046472 | Ga0495580_0018248 | Ga0495580_0018248_757_1395 | 212 |
| 577 | 3300046472 | Ga0495580_0022811 | Ga0495580_0022811_346_984 | 212 |
| 578 | 3300046517 | Ga0495630_0035598 | Ga0495630_0035598_2966_3604 | 212 |
| 579 | 3300046529 | Ga0495652_0457956 | Ga0495652_0457956_204_842 | 212 |
| 580 | 3300046678 | Ga0495599_0189339 | Ga0495599_0189339_578_1216 | 212 |
| 581 | 3300048903 | Ga0496100_0036452 | Ga0496100_0036452_513_1151 | 212 |
| 582 | 3300048904 | Ga0496101_0084436 | Ga0496101_0084436_1525_2163 | 212 |
| 583 | 3300048905 | Ga0496102_0080064 | Ga0496102_0080064_964_1602 | 212 |
| 584 | 3300048907 | Ga0496104_0067057 | Ga0496104_0067057_2550_3188 | 212 |
| 585 | 3300048909 | Ga0496106_0034604 | Ga0496106_0034604_312_950 | 212 |
| 586 | 3300048910 | Ga0496107_0028231 | Ga0496107_0028231_2534_3172 | 212 |
| 587 | 3300048911 | Ga0496108_0093701 | Ga0496108_0093701_731_1369 | 212 |
| 588 | 3300048912 | Ga0496109_0235104 | Ga0496109_0235104_578_1216 | 212 |
| 589 | 3300048914 | Ga0496111_0019598 | Ga0496111_0019598_1389_2027 | 212 |
| 590 | 3300048916 | Ga0496113_0262365 | Ga0496113_0262365_640_1278 | 212 |
| 591 | 3300048918 | Ga0496115_0057745 | Ga0496115_0057745_1456_2094 | 212 |
| 592 | 3300050514 | nmdc:mga08x19_63809_c1 | nmdc:mga08x19_63809_c1_558_1196 | 212 |
| 593 | 3300005344 | Ga0070661_100156005 | Ga0070661_1001560052 | 214 |
| 594 | 3300005548 | Ga0070665_100040364 | Ga0070665_1000403642 | 214 |
| 595 | 3300005616 | Ga0068852_100968201 | Ga0068852_1009682011 | 214 |
| 596 | 3300005618 | Ga0068864_100359696 | Ga0068864_1003596963 | 214 |
| 597 | 3300005844 | Ga0068862_100086644 | Ga0068862_1000866443 | 214 |
| 598 | 3300009093 | Ga0105240_10037201 | Ga0105240_100372014 | 214 |
| 599 | 3300009553 | Ga0105249_10063862 | Ga0105249_100638623 | 214 |
| 600 | 3300013296 | Ga0157374_10556548 | Ga0157374_105565482 | 214 |
| 601 | 3300025913 | Ga0207695_10152530 | Ga0207695_101525303 | 214 |
| 602 | 3300028380 | Ga0268265_10068570 | Ga0268265_100685703 | 214 |
| 603 | 3300053104 | Ga0500556_0001046 | Ga0500556_0001046_12514_13161 | 214 |
| 604 | 3300005289 | Ga0065704_10205487 | Ga0065704_102054872 | 221 |
| 605 | 3300032005 | Ga0307411_10011187 | Ga0307411_100111877 | 221 |
| 606 | 3300035113 | Ga0373936_0001995 | Ga0373936_0001995_1438_2118 | 223 |
| 607 | 3300005367 | Ga0070667_100000052 | Ga0070667_100000052130 | 232 |
| 608 | 3300025986 | Ga0207658_10000250 | Ga0207658_1000025035 | 232 |
| 609 | 2162886006 | SwRhRL3b_contig_688512 | SwRhRL3b_0039.00001550 | 242 |
| 610 | 3300005289 | Ga0065704_10194096 | Ga0065704_101940962 | 242 |
| 611 | 3300005295 | Ga0065707_10082291 | Ga0065707_100822917 | 242 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1ej0-assembly1.cif.gz_A | ftsj rna methyltransferase complexed with s-adenosylmethionine, mercury derivative | 0.9739 | 57 | 234 |
| 8i9v-assembly1.cif.gz_CS | cryo-em structure of a chaetomium thermophilum pre-60s ribosomal subunit - state dbp10-2 | 0.9603 | 45 | 236 |
| 1ej0-assembly1.cif.gz_A | ftsj rna methyltransferase complexed with s-adenosylmethionine, mercury derivative | 0.958 | 57 | 234 |
| 8ia0-assembly1.cif.gz_CS | cryo-em structure of a chaetomium thermophilum pre-60s ribosomal subunit - state puf6 | 0.9564 | 45 | 236 |
| 7nac-assembly1.cif.gz_w | state e2 nucleolar 60s ribosomal biogenesis intermediate - composite model | 0.9554 | 45 | 236 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1ej0A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9739 | 57 | 234 | 3.40.50.150 |
| af_Q9VDT6_58_249_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9672 | 56 | 234 | 3.40.50.150 |
| af_Q5RJT2_23_207_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9609 | 56 | 232 | 3.40.50.150 |
| 1ej0A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.958 | 57 | 234 | 3.40.50.150 |
| af_F4JTD2_19_207_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9577 | 55 | 232 | 3.40.50.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-C6DKI3-F1-model_v4 | Ribosomal RNA large subunit methyltransferase E (EC 2.1.1.166) (23S rRNA Um2552 methyltransferase) (rRNA (uridine-2'-O-)-methyltransferase) | 0.9806 | 28 | 233 |
GO:0005737
GO:0008650 |
| AF-A0A3E1K5Q8-F1-model_v4 | Ribosomal RNA large subunit methyltransferase E (EC 2.1.1.166) (23S rRNA Um2552 methyltransferase) (rRNA (uridine-2'-O-)-methyltransferase) | 0.9804 | 38 | 233 |
GO:0005737
GO:0008650 |
| AF-A0A0M0BM05-F1-model_v4 | Ribosomal RNA methyltransferase FtsJ domain-containing protein | 0.9804 | 159 | 240 |
GO:0001510
GO:0006364 GO:0008173 |
| AF-A0A844HXV2-F1-model_v4 | Ribosomal RNA large subunit methyltransferase E (EC 2.1.1.166) (23S rRNA Um2552 methyltransferase) (rRNA (uridine-2'-O-)-methyltransferase) | 0.98 | 64 | 233 |
GO:0008650
|
| AF-B4TJ16-F1-model_v4 | Ribosomal RNA large subunit methyltransferase E (EC 2.1.1.166) (23S rRNA Um2552 methyltransferase) (rRNA (uridine-2'-O-)-methyltransferase) | 0.9793 | 26 | 233 |
GO:0005737
GO:0008650 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar