F469038

General Info

Members Datasets Scaffolds Average Seq Length
611 304 593 361

Family's Representative Sequence

Representative Sequence 3300005339|Ga0070660_100036013|Ga0070660_1000360132
Length 406
Sequence MGILDQAGDVAASAGSGARQRRTRVEIVKIGIVKEMAPGERRVSGTPETVKKFTALGATVAVETGAGLSAAISDADYVAMGAXXXDRAATVADADIILGVQGPDAASLAGARPGAWIVAGLNPFVERARIDAYAAAGFEALAMEFMPRITRAQSMDILSSQSNLAGYKAVLDAAAEYGRSFPMMMTAAGTVSPAKAFIMGVGVAGLQAIATARRLGAQVSATDVRSATREQIESLGAKAIFVESVAGIEGEGKGGYATEMSEEYRQAQAELVSSHIAKQDIVITTALIPGKPAPRLVSDAQIASMKPGSVIVDLAVEQGGNVEGAVAGEVVERHGVKIVGHRNVPSRLAADASALFARNLYNFLSAFWNKERNAPVLDEEIGNAIRVTQGGKIVSERLLQLAGGMQ

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
3 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
4 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
5 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
6 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
7 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
8 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
9 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
10 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
11 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
12 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
13 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
14 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
15 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
16 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
17 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
18 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
19 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
20 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
21 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
22 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
23 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
24 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
25 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
26 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
27 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
28 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
29 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
30 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
31 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
32 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
33 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
34 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
35 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
36 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
37 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
38 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
39 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
40 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
41 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
42 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
43 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
44 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
45 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
46 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
47 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
48 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
49 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
50 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
51 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
52 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
53 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
54 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
55 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
56 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
57 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
58 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
59 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
60 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
61 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
62 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
63 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
64 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
65 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
66 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
67 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
68 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
69 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
70 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
71 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
72 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
73 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
74 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
75 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
76 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
77 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
78 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
79 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
80 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
81 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
82 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
83 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
117 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
118 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
119 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
120 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
121 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
123 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
124 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
126 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
127 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
128 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
129 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
130 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
132 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
183 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
187 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
188 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
189 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
190 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
191 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
192 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
193 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
194 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
195 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
196 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
197 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
198 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
199 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
200 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
201 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
202 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
203 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
204 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
205 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
206 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
207 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
208 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
209 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
210 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
211 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
212 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
213 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
214 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
215 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
216 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
217 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
218 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
219 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
220 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
221 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
222 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
223 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
224 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
225 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
226 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
227 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
228 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
229 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
230 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
231 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
232 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
233 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
234 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
235 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
236 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
237 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
238 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
239 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
240 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
241 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
242 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
243 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
244 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
245 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
246 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
247 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
248 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
249 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
250 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
251 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
252 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
253 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
254 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
255 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
256 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
257 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
258 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
259 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
260 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
261 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
262 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
263 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
264 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
265 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
266 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
267 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
268 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
269 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
270 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
271 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
272 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
273 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
274 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
278 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
279 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
280 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
281 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
282 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
283 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
284 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
285 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
286 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
287 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
288 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
289 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
290 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
291 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
292 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
293 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
294 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
295 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
296 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
297 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
298 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
299 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
300 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
301 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
302 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
303 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
304 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.89
Metatranscriptomes 0.16
Isolates 2.95

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.97
Nodule 0
Rhizoplane 3.93
Rhizosphere 74.96
Stem 0
Stem Tuber 0
Unclassified 10.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_493648 2162886007 Bacteria 5061
2 JGI24736J21556_1000479 3300001904 Bacteria 7486
3 JGI24741J21665_1000063 3300001915 Bacteria 25937
4 JGI24741J21665_1000437 3300001915 Bacteria 12597
5 JGI24741J21665_1003441 3300001915 Bacteria 3774
6 JGI24740J21852_10000017 3300001979 Bacteria 57092
7 JGI24739J22299_10007314 3300001989 Bacteria 4146
8 JGI24739J22299_10012378 3300001989 Bacteria 3135
9 JGI24737J22298_10000590 3300001990 Bacteria 12764
10 JGI24737J22298_10002013 3300001990 Bacteria 7258
11 JGI24737J22298_10003951 3300001990 Bacteria 5192
12 JGI24737J22298_10026128 3300001990 Bacteria 1844
13 JGI24743J22301_10001846 3300001991 Bacteria 3060
14 JGI24735J21928_10003325 3300002067 Bacteria 5485
15 JGI24735J21928_10006215 3300002067 Bacteria 3944
16 JGI24735J21928_10010490 3300002067 Bacteria 2953
17 JGI24735J21928_10011900 3300002067 Bacteria 2753
18 JGI24735J21928_10013206 3300002067 Bacteria 2600
19 JGI24735J21928_10026852 3300002067 Bacteria 1728
20 JGI24738J21930_10001894 3300002075 Bacteria 5653
21 JGI24738J21930_10001982 3300002075 Bacteria 5505
22 JGI24751J29686_10008002 3300002459 Bacteria 2160
23 JGI25150J39212_1000282 3300002774 Bacteria 26768
24 JGI25406J46586_10005157 3300003203 Bacteria 6064
25 JGI25165J46597_1000289 3300003214 Bacteria 63916
26 JGI25153J46596_10000032 3300003215 Bacteria 196732
27 Ga0055542_1000142 3300003762 Bacteria 89813
28 Ga0055542_1000783 3300003762 Bacteria 23812
29 Ga0055529_1000167 3300003763 Bacteria 90966
30 Ga0055526_1001776 3300003771 Bacteria 14983
31 Ga0055537_1000406 3300003773 Bacteria 28230
32 Ga0055524_1000133 3300003775 Bacteria 87720
33 Ga0055530_10000114 3300003791 Bacteria 70700
34 Ga0055540_1007630 3300003792 Bacteria 4040
35 Ga0055531_10000095 3300003794 Bacteria 96056
36 Ga0055531_10004667 3300003794 Bacteria 8213
37 Ga0065165_1004241 3300005262 Bacteria 9097
38 Ga0065165_1011769 3300005262 Bacteria 3609
39 Ga0065704_10001254 3300005289 Bacteria 12681
40 Ga0065704_10002877 3300005289 Bacteria 4914
41 Ga0065707_10102066 3300005295 Bacteria 2828
42 Ga0065707_10104178 3300005295 Bacteria 2708
43 Ga0070658_10000055 3300005327 Bacteria 114800
44 Ga0070658_10000384 3300005327 Bacteria 38496
45 Ga0070658_10001088 3300005327 Bacteria 23167
46 Ga0070658_10048616 3300005327 Bacteria 3434
47 Ga0070670_100000249 3300005331 Bacteria 48555
48 Ga0070670_100017442 3300005331 Bacteria 6159
49 Ga0070670_100079517 3300005331 Bacteria 2818
50 Ga0070670_100154909 3300005331 Bacteria 1984
51 Ga0070677_10002044 3300005333 Bacteria 6419
52 Ga0068869_100001042 3300005334 Bacteria 16130
53 Ga0070666_10000182 3300005335 Bacteria 43137
54 Ga0070666_10009675 3300005335 Bacteria 6020
55 Ga0070680_100000431 3300005336 Bacteria 28580
56 Ga0070680_100019919 3300005336 Bacteria 5319
57 Ga0068868_100000042 3300005338 Bacteria 68731
58 Ga0068868_100000516 3300005338 Bacteria 25830
59 Ga0068868_100295667 3300005338 Bacteria 1374
60 Ga0070660_100000066 3300005339 Bacteria 61587
61 Ga0070660_100007816 3300005339 Bacteria 7457
62 Ga0070660_100036013 3300005339 Bacteria 3746
63 Ga0070689_100186052 3300005340 Bacteria 1689
64 Ga0070661_100000133 3300005344 Bacteria 62182
65 Ga0070668_100000034 3300005347 Bacteria 82494
66 Ga0070668_100000993 3300005347 Bacteria 19904
67 Ga0070668_100013601 3300005347 Bacteria 6077
68 Ga0070668_100016156 3300005347 Bacteria 5586
69 Ga0070668_100028198 3300005347 Bacteria 4264
70 Ga0070668_100237360 3300005347 Bacteria 1509
71 Ga0070669_100000001 3300005353 Bacteria 537589
72 Ga0070669_100000317 3300005353 Bacteria 37676
73 Ga0070669_100089640 3300005353 Bacteria 2304
74 Ga0070675_100008635 3300005354 Bacteria 7910
75 Ga0070671_100000002 3300005355 Bacteria 292733
76 Ga0070671_100000112 3300005355 Bacteria 52171
77 Ga0070671_100000160 3300005355 Bacteria 44240
78 Ga0070671_100002059 3300005355 Bacteria 15508
79 Ga0070671_100027168 3300005355 Bacteria 4708
80 Ga0070673_100000010 3300005364 Bacteria 153851
81 Ga0070659_100000011 3300005366 Bacteria 185903
82 Ga0070659_100018071 3300005366 Bacteria 5318
83 Ga0070659_100035610 3300005366 Bacteria 3876
84 Ga0070659_100111127 3300005366 Bacteria 2212
85 Ga0070667_100000199 3300005367 Bacteria 71115
86 Ga0070667_100000570 3300005367 Bacteria 36484
87 Ga0070667_100008714 3300005367 Bacteria 8411
88 Ga0070667_100021538 3300005367 Bacteria 5351
89 Ga0070667_100035498 3300005367 Bacteria 4177
90 Ga0070667_100217414 3300005367 Bacteria 1700
91 Ga0070663_100000022 3300005455 Bacteria 111612
92 Ga0070663_100022137 3300005455 Bacteria 4243
93 Ga0070678_100002349 3300005456 Bacteria 10338
94 Ga0070662_100027437 3300005457 Bacteria 3952
95 Ga0070662_100107278 3300005457 Bacteria 2123
96 Ga0070681_10069878 3300005458 Bacteria 3477
97 Ga0068867_100000019 3300005459 Bacteria 97503
98 Ga0068867_100052229 3300005459 Bacteria 3016
99 Ga0068867_100097607 3300005459 Bacteria 2239
100 Ga0070679_100000002 3300005530 Bacteria 312066
101 Ga0070679_100163809 3300005530 Bacteria 2197
102 Ga0068853_100017380 3300005539 Bacteria 5939
103 Ga0068853_100037460 3300005539 Bacteria 4126
104 Ga0068853_100039656 3300005539 Bacteria 4017
105 Ga0068853_100115975 3300005539 Bacteria 2384
106 Ga0070672_100060355 3300005543 Bacteria 2986
107 Ga0070686_100000284 3300005544 Bacteria 34135
108 Ga0070665_100000089 3300005548 Bacteria 177659
109 Ga0070665_100000316 3300005548 Bacteria 75107
110 Ga0070665_100000972 3300005548 Bacteria 36392
111 Ga0070665_100003125 3300005548 Bacteria 17834
112 Ga0070665_100017966 3300005548 Bacteria 7101
113 Ga0070665_100340257 3300005548 Bacteria 1505
114 Ga0068855_100000123 3300005563 Bacteria 97174
115 Ga0068855_100000377 3300005563 Bacteria 55242
116 Ga0068855_100244018 3300005563 Bacteria 2006
117 Ga0068855_100275595 3300005563 Bacteria 1870
118 Ga0068857_100055682 3300005577 Bacteria 3509
119 Ga0068857_100316373 3300005577 Bacteria 1441
120 Ga0068856_100000041 3300005614 Bacteria 112613
121 Ga0068856_100003500 3300005614 Bacteria 15852
122 Ga0068856_100109937 3300005614 Bacteria 2753
123 Ga0068852_100000393 3300005616 Bacteria 29281
124 Ga0068852_100065135 3300005616 Bacteria 3178
125 Ga0068859_100001318 3300005617 Bacteria 25318
126 Ga0068859_100026537 3300005617 Bacteria 5809
127 Ga0068859_100031297 3300005617 Bacteria 5342
128 Ga0068859_100034368 3300005617 Bacteria 5088
129 Ga0068864_100000004 3300005618 Bacteria 489341
130 Ga0068864_100000800 3300005618 Bacteria 26375
131 Ga0068864_100052967 3300005618 Bacteria 3499
132 Ga0068861_100000850 3300005719 Bacteria 18510
133 Ga0068861_100025770 3300005719 Bacteria 4268
134 Ga0068863_100000002 3300005841 Bacteria 489510
135 Ga0068863_100000020 3300005841 Bacteria 198519
136 Ga0068863_100000029 3300005841 Bacteria 177191
137 Ga0068863_100008204 3300005841 Bacteria 10207
138 Ga0068863_100051605 3300005841 Bacteria 3898
139 Ga0068858_100000122 3300005842 Bacteria 80502
140 Ga0068858_100004242 3300005842 Bacteria 14102
141 Ga0068860_100002353 3300005843 Bacteria 19855
142 Ga0068860_100009823 3300005843 Bacteria 9494
143 Ga0068862_100000002 3300005844 Bacteria 489341
144 Ga0068862_100001039 3300005844 Bacteria 26612
145 Ga0068862_100013247 3300005844 Bacteria 6821
146 Ga0081539_10000086 3300005985 Bacteria 217801
147 Ga0081539_10018758 3300005985 Bacteria 4777
148 Ga0075368_10006435 3300006042 Bacteria 4103
149 Ga0075370_10074767 3300006353 Bacteria 1942
150 Ga0075434_100132799 3300006871 Bacteria 2509
151 Ga0068865_100000319 3300006881 Bacteria 26597
152 Ga0097620_100001318 3300006931 Bacteria 25318
153 Ga0097620_100026537 3300006931 Bacteria 5809
154 Ga0097620_100031299 3300006931 Bacteria 5342
155 Ga0097620_100034367 3300006931 Bacteria 5088
156 Ga0105251_10000988 3300009011 Bacteria 24969
157 Ga0105251_10003664 3300009011 Bacteria 11021
158 Ga0105240_10003584 3300009093 Bacteria 24088
159 Ga0105240_10014804 3300009093 Bacteria 10631
160 Ga0105240_10056596 3300009093 Bacteria 4906
161 Ga0105240_10099444 3300009093 Bacteria 3540
162 Ga0105245_10000582 3300009098 Bacteria 33174
163 Ga0105245_10001094 3300009098 Bacteria 24598
164 Ga0105247_10002228 3300009101 Bacteria 13346
165 Ga0105247_10028527 3300009101 Bacteria 3378
166 Ga0114129_10148369 3300009147 Bacteria 3211
167 Ga0105243_10000296 3300009148 Bacteria 55065
168 Ga0105243_10003479 3300009148 Bacteria 12715
169 Ga0105241_10000037 3300009174 Bacteria 115452
170 Ga0105241_10007488 3300009174 Bacteria 8036
171 Ga0105242_10000803 3300009176 Bacteria 24326
172 Ga0105248_10000016 3300009177 Bacteria 308151
173 Ga0105248_10006892 3300009177 Bacteria 12456
174 Ga0105248_10369541 3300009177 Bacteria 1615
175 Ga0105237_10009164 3300009545 Bacteria 10629
176 Ga0105237_10009789 3300009545 Bacteria 10248
177 Ga0105237_10037685 3300009545 Bacteria 4886
178 Ga0105237_10054919 3300009545 Bacteria 3990
179 Ga0105237_10059453 3300009545 Bacteria 3824
180 Ga0105237_10079802 3300009545 Bacteria 3263
181 Ga0105249_10000106 3300009553 Bacteria 115526
182 Ga0105249_10013461 3300009553 Bacteria 7222
183 Ga0105249_10060620 3300009553 Bacteria 3471
184 Ga0105249_10129125 3300009553 Bacteria 2411
185 Ga0105148_100043 3300009978 Bacteria 18692
186 Ga0105239_10000073 3300010375 Bacteria 140771
187 Ga0105239_10056916 3300010375 Bacteria 4288
188 Ga0105239_10130631 3300010375 Bacteria 2793
189 Ga0157373_10000046 3300013100 Bacteria 112179
190 Ga0157371_10000062 3300013102 Bacteria 169669
191 Ga0157370_10000071 3300013104 Bacteria 111640
192 Ga0157370_10000774 3300013104 Bacteria 40033
193 Ga0157369_10013976 3300013105 Bacteria 9073
194 Ga0157369_10240649 3300013105 Bacteria 1890
195 Ga0157374_10003979 3300013296 Bacteria 12416
196 Ga0157374_10015043 3300013296 Bacteria 6783
197 Ga0157374_10064473 3300013296 Bacteria 3437
198 Ga0157378_10006416 3300013297 Bacteria 10284
199 Ga0157378_10109366 3300013297 Bacteria 2532
200 Ga0163162_10014804 3300013306 Bacteria 7619
201 Ga0163162_10164516 3300013306 Bacteria 2342
202 Ga0157372_10016443 3300013307 Bacteria 7938
203 Ga0157372_10268487 3300013307 Bacteria 1982
204 Ga0157375_10003787 3300013308 Bacteria 13108
205 Ga0163163_10242394 3300014325 Bacteria 1853
206 Ga0157380_10060767 3300014326 Bacteria 3021
207 Ga0157377_10061945 3300014745 Bacteria 2139
208 Ga0157379_10033264 3300014968 Bacteria 4598
209 Ga0157376_10000245 3300014969 Bacteria 37670
210 Ga0157376_10101503 3300014969 Bacteria 2514
211 Ga0163161_10039071 3300017792 Bacteria 3405
212 Ga0206353_11089745 3300020082 Bacteria 5455
213 Ga0213873_10000007 3300021358 Bacteria 309961
214 Ga0213872_10000577 3300021361 Bacteria 28396
215 Ga0213876_10000005 3300021384 Bacteria 727326
216 Ga0213876_10003902 3300021384 Bacteria 8429
217 Ga0207427_100420 3300025231 Bacteria 24276
218 Ga0207425_1000025 3300025245 Bacteria 321872
219 Ga0209148_1000008 3300025254 Bacteria 1504371
220 Ga0209148_1000114 3300025254 Bacteria 192073
221 Ga0209148_1001403 3300025254 Bacteria 12381
222 Ga0209233_1000107 3300025261 Bacteria 267399
223 Ga0209233_1000291 3300025261 Bacteria 64111
224 Ga0209565_1000007 3300025263 Bacteria 784361
225 Ga0209565_1006830 3300025263 Bacteria 3152
226 Ga0209455_1000002 3300025272 Bacteria 1505459
227 Ga0209455_1000796 3300025272 Bacteria 17455
228 Ga0209673_1001335 3300025273 Bacteria 24658
229 Ga0207673_1002390 3300025290 Bacteria 2138
230 Ga0209025_1000663 3300025294 Bacteria 59620
231 Ga0209564_1002343 3300025295 Bacteria 15298
232 Ga0209758_1000002 3300025297 Bacteria 1400310
233 Ga0209758_1029226 3300025297 Bacteria 2310
234 Ga0209050_1000001 3300025298 Bacteria 3563507
235 Ga0209050_1000051 3300025298 Bacteria 353153
236 Ga0209050_1000350 3300025298 Bacteria 88878
237 Ga0209050_1009706 3300025298 Bacteria 4877
238 Ga0209050_1031398 3300025298 Bacteria 1655
239 Ga0209256_1000008 3300025299 Bacteria 975723
240 Ga0209051_1000689 3300025303 Bacteria 37393
241 Ga0209257_1000028 3300025304 Bacteria 699493
242 Ga0209257_1001053 3300025304 Bacteria 36546
243 Ga0209257_1001406 3300025304 Bacteria 28716
244 Ga0209257_1004469 3300025304 Bacteria 10819
245 Ga0207697_10001981 3300025315 Bacteria 10861
246 Ga0207656_10011133 3300025321 Bacteria 3390
247 Ga0207713_1023180 3300025735 Bacteria 2928
248 Ga0207710_10005939 3300025900 Bacteria 5237
249 Ga0207710_10020750 3300025900 Bacteria 2811
250 Ga0207680_10000033 3300025903 Bacteria 77177
251 Ga0207680_10002112 3300025903 Bacteria 9302
252 Ga0207647_10000812 3300025904 Bacteria 24230
253 Ga0207647_10003181 3300025904 Bacteria 12327
254 Ga0207647_10045307 3300025904 Bacteria 2745
255 Ga0207647_10049844 3300025904 Bacteria 2595
256 Ga0207645_10000492 3300025907 Bacteria 32549
257 Ga0207705_10000139 3300025909 Bacteria 78756
258 Ga0207705_10000181 3300025909 Bacteria 66244
259 Ga0207705_10000254 3300025909 Bacteria 52174
260 Ga0207705_10023327 3300025909 Bacteria 4414
261 Ga0207654_10000032 3300025911 Bacteria 120553
262 Ga0207654_10000822 3300025911 Bacteria 17099
263 Ga0207654_10032576 3300025911 Bacteria 2882
264 Ga0207707_10094305 3300025912 Bacteria 2615
265 Ga0207695_10074360 3300025913 Bacteria 3460
266 Ga0207695_10152157 3300025913 Bacteria 2252
267 Ga0207695_10153503 3300025913 Bacteria 2239
268 Ga0207695_10168710 3300025913 Bacteria 2115
269 Ga0207671_10009543 3300025914 Bacteria 8097
270 Ga0207671_10020727 3300025914 Bacteria 5000
271 Ga0207660_10003819 3300025917 Bacteria 9817
272 Ga0207657_10003028 3300025919 Bacteria 18001
273 Ga0207657_10022449 3300025919 Bacteria 5902
274 Ga0207649_10000247 3300025920 Bacteria 43791
275 Ga0207649_10000651 3300025920 Bacteria 23190
276 Ga0207652_10000001 3300025921 Bacteria 1006643
277 Ga0207652_10000002 3300025921 Bacteria 878035
278 Ga0207652_10074044 3300025921 Bacteria 2964
279 Ga0207681_10000002 3300025923 Bacteria 985597
280 Ga0207681_10002014 3300025923 Bacteria 13045
281 Ga0207681_10044883 3300025923 Bacteria 2964
282 Ga0207681_10081881 3300025923 Bacteria 2280
283 Ga0207694_10003586 3300025924 Bacteria 12309
284 Ga0207650_10000980 3300025925 Bacteria 21439
285 Ga0207650_10008717 3300025925 Bacteria 6924
286 Ga0207650_10068305 3300025925 Bacteria 2668
287 Ga0207650_10069769 3300025925 Bacteria 2641
288 Ga0207650_10074085 3300025925 Bacteria 2566
289 Ga0207650_10151670 3300025925 Bacteria 1829
290 Ga0207687_10000728 3300025927 Bacteria 22343
291 Ga0207687_10003822 3300025927 Bacteria 10117
292 Ga0207644_10000002 3300025931 Bacteria 942221
293 Ga0207644_10000097 3300025931 Bacteria 63086
294 Ga0207644_10000107 3300025931 Bacteria 61436
295 Ga0207644_10010910 3300025931 Bacteria 6002
296 Ga0207690_10000005 3300025932 Bacteria 581199
297 Ga0207690_10003702 3300025932 Bacteria 9098
298 Ga0207690_10036117 3300025932 Bacteria 3197
299 Ga0207706_10116124 3300025933 Bacteria 2354
300 Ga0207709_10000005 3300025935 Bacteria 806813
301 Ga0207709_10000050 3300025935 Bacteria 234391
302 Ga0207670_10195026 3300025936 Bacteria 1535
303 Ga0207669_10000946 3300025937 Bacteria 12295
304 Ga0207669_10004620 3300025937 Bacteria 6079
305 Ga0207669_10032133 3300025937 Bacteria 2943
306 Ga0207704_10000051 3300025938 Bacteria 81152
307 Ga0207691_10093636 3300025940 Bacteria 2689
308 Ga0207691_10131899 3300025940 Bacteria 2206
309 Ga0207691_10279725 3300025940 Bacteria 1436
310 Ga0207711_10000022 3300025941 Bacteria 340441
311 Ga0207711_10001291 3300025941 Bacteria 23744
312 Ga0207711_10048087 3300025941 Bacteria 3649
313 Ga0207711_10057663 3300025941 Bacteria 3339
314 Ga0207689_10000899 3300025942 Bacteria 28556
315 Ga0207667_10000167 3300025949 Bacteria 97188
316 Ga0207667_10000537 3300025949 Bacteria 50070
317 Ga0207667_10000852 3300025949 Bacteria 39321
318 Ga0207667_10040733 3300025949 Bacteria 4945
319 Ga0207667_10109641 3300025949 Bacteria 2847
320 Ga0207667_10215428 3300025949 Bacteria 1968
321 Ga0207667_10267390 3300025949 Bacteria 1748
322 Ga0207651_10000005 3300025960 Bacteria 246132
323 Ga0207712_10000593 3300025961 Bacteria 28979
324 Ga0207712_10005757 3300025961 Bacteria 7811
325 Ga0207712_10048491 3300025961 Bacteria 2955
326 Ga0207712_10077330 3300025961 Bacteria 2411
327 Ga0207668_10000313 3300025972 Bacteria 31786
328 Ga0207668_10000364 3300025972 Bacteria 28957
329 Ga0207668_10001089 3300025972 Bacteria 16167
330 Ga0207668_10002267 3300025972 Bacteria 11223
331 Ga0207668_10016024 3300025972 Bacteria 4669
332 Ga0207668_10071656 3300025972 Bacteria 2476
333 Ga0207640_10016378 3300025981 Bacteria 4312
334 Ga0207658_10000159 3300025986 Bacteria 71280
335 Ga0207658_10000411 3300025986 Bacteria 40690
336 Ga0207658_10007323 3300025986 Bacteria 7527
337 Ga0207658_10028416 3300025986 Bacteria 3938
338 Ga0207658_10050391 3300025986 Bacteria 3064
339 Ga0207658_10077294 3300025986 Bacteria 2539
340 Ga0207677_10000484 3300026023 Bacteria 25909
341 Ga0207703_10000159 3300026035 Bacteria 78106
342 Ga0207703_10003103 3300026035 Bacteria 14035
343 Ga0207639_10000100 3300026041 Bacteria 70921
344 Ga0207639_10000449 3300026041 Bacteria 28347
345 Ga0207639_10010202 3300026041 Bacteria 6498
346 Ga0207678_10000007 3300026067 Bacteria 179943
347 Ga0207678_10000038 3300026067 Bacteria 101262
348 Ga0207702_10000061 3300026078 Bacteria 125368
349 Ga0207702_10006464 3300026078 Bacteria 10103
350 Ga0207702_10008912 3300026078 Bacteria 8458
351 Ga0207702_10010959 3300026078 Bacteria 7563
352 Ga0207702_10028171 3300026078 Bacteria 4667
353 Ga0207702_10114574 3300026078 Bacteria 2403
354 Ga0207641_10000001 3300026088 Bacteria 1180841
355 Ga0207641_10000002 3300026088 Bacteria 981004
356 Ga0207641_10000049 3300026088 Bacteria 177222
357 Ga0207641_10014692 3300026088 Bacteria 6419
358 Ga0207641_10029503 3300026088 Bacteria 4537
359 Ga0207648_10000068 3300026089 Bacteria 97469
360 Ga0207648_10178051 3300026089 Bacteria 1881
361 Ga0207676_10000040 3300026095 Bacteria 167947
362 Ga0207676_10047729 3300026095 Bacteria 3320
363 Ga0207676_10372916 3300026095 Bacteria 1326
364 Ga0207674_10033925 3300026116 Bacteria 5339
365 Ga0207674_10058761 3300026116 Bacteria 3894
366 Ga0207674_10070451 3300026116 Bacteria 3515
367 Ga0207674_10127060 3300026116 Bacteria 2515
368 Ga0207675_100001943 3300026118 Bacteria 20638
369 Ga0207675_100002616 3300026118 Bacteria 17805
370 Ga0207683_10001115 3300026121 Bacteria 24408
371 Ga0207698_10001092 3300026142 Bacteria 15782
372 Ga0207698_10003088 3300026142 Bacteria 9988
373 Ga0209813_10000095 3300027866 Bacteria 33070
374 Ga0268266_10000002 3300028379 Bacteria 3059047
375 Ga0268266_10000083 3300028379 Bacteria 202393
376 Ga0268266_10048020 3300028379 Bacteria 3658
377 Ga0268266_10102933 3300028379 Bacteria 2519
378 Ga0268265_10000003 3300028380 Bacteria 949201
379 Ga0268265_10000116 3300028380 Bacteria 100689
380 Ga0268264_10000116 3300028381 Bacteria 198591
381 Ga0268264_10001925 3300028381 Bacteria 18720
382 Ga0268264_10040016 3300028381 Bacteria 3873
383 Ga0268264_10041890 3300028381 Bacteria 3788
384 Ga0268264_10230277 3300028381 Bacteria 1711
385 Ga0307517_10024225 3300028786 Bacteria 7496
386 Ga0265338_10117244 3300028800 Bacteria 2131
387 Ga0307512_10004811 3300030522 Bacteria 14488
388 Ga0265331_10007851 3300031250 Bacteria 6118
389 Ga0307513_10001996 3300031456 Bacteria 28859
390 Ga0307513_10267685 3300031456 Bacteria 1494
391 Ga0307408_100009178 3300031548 Bacteria 6521
392 Ga0307408_100020042 3300031548 Bacteria 4508
393 Ga0307408_100035106 3300031548 Bacteria 3516
394 Ga0307408_100111664 3300031548 Bacteria 2100
395 Ga0307508_10000302 3300031616 Bacteria 60090
396 Ga0316578_10118904 3300031728 Bacteria 1588
397 Ga0307405_10040288 3300031731 Bacteria 2828
398 Ga0307413_10117905 3300031824 Bacteria 1791
399 Ga0307410_10042175 3300031852 Bacteria 3014
400 Ga0307406_10002850 3300031901 Bacteria 9420
401 Ga0307406_10088335 3300031901 Bacteria 2080
402 Ga0307407_10004214 3300031903 Bacteria 6065
403 Ga0307412_10000304 3300031911 Bacteria 31110
404 Ga0307412_10022225 3300031911 Bacteria 3885
405 Ga0307412_10035802 3300031911 Bacteria 3174
406 Ga0307412_10196255 3300031911 Bacteria 1529
407 Ga0307409_100004393 3300031995 Bacteria 7914
408 Ga0307416_100007874 3300032002 Bacteria 6815
409 Ga0307416_100080827 3300032002 Bacteria 2745
410 Ga0307414_10003041 3300032004 Bacteria 8897
411 Ga0307411_10021077 3300032005 Bacteria 3805
412 Ga0307411_10026655 3300032005 Bacteria 3483
413 Ga0307415_100026870 3300032126 Bacteria 3638
414 Ga0307415_100058569 3300032126 Bacteria 2652
415 Ga0316584_0047411 3300036712 Bacteria 3210
416 Ga0316584_0071411 3300036712 Bacteria 2601
417 Ga0395899_0006918 3300037312 Bacteria 8785
418 Ga0395900_0228996 3300037418 Bacteria 1870
419 Ga0395905_0235788 3300037471 Bacteria 1710
420 Ga0436364_0543931 3300037853 Bacteria 2874
421 Ga0237819_00282 3300038705 Bacteria 18645
422 Ga0436365_0687780 3300039437 Bacteria 92990
423 Ga0436365_1127686 3300039437 Bacteria 20335
424 Ga0436361_0375914 3300039447 Bacteria 18209
425 Ga0436363_0926748 3300039450 Bacteria 4186
426 Ga0436362_0451893 3300039453 Bacteria 163419
427 Ga0439461_0000108 3300041410 Bacteria 10970
428 Ga0439431_0001890 3300041997 Bacteria 4646
429 Ga0439431_0018299 3300041997 Bacteria 1656
430 Ga0439445_0000054 3300042004 Bacteria 16765
431 Ga0439432_025810 3300042006 Bacteria 1925
432 Ga0439452_011683 3300042010 Bacteria 2516
433 Ga0439462_0002567 3300042015 Bacteria 4237
434 Ga0439458_0000273 3300042157 Bacteria 12703
435 Ga0439458_0003781 3300042157 Bacteria 3503
436 Ga0439458_0010727 3300042157 Bacteria 2045
437 Ga0466972_0011708 3300044658 Bacteria 4404
438 Ga0466964_0008643 3300044706 Bacteria 3829
439 Ga0466971_0057643 3300044719 Bacteria 1752
440 Ga0466968_0010087 3300044735 Bacteria 3651
441 Ga0466960_0020079 3300044901 Bacteria 2954
442 Ga0466959_0107453 3300045049 Bacteria 1994
443 Ga0466958_0026324 3300045836 Bacteria 3437
444 Ga0466967_0120728 3300045976 Bacteria 2421
445 Ga0495638_0000018 3300046460 Bacteria 389696
446 Ga0495638_0000048 3300046460 Bacteria 209787
447 Ga0495650_0000983 3300046471 Bacteria 32562
448 Ga0495650_0001327 3300046471 Bacteria 24827
449 Ga0495585_0021281 3300046492 Bacteria 3725
450 Ga0495583_0000033 3300046506 Bacteria 246882
451 Ga0495583_0003712 3300046506 Bacteria 11355
452 Ga0495583_0009207 3300046506 Bacteria 5926
453 Ga0495606_0000390 3300046507 Bacteria 74253
454 Ga0495606_0001880 3300046507 Bacteria 26312
455 Ga0495616_0098622 3300046513 Bacteria 1373
456 Ga0495631_0020539 3300046518 Bacteria 3085
457 Ga0495632_0003057 3300046519 Bacteria 12168
458 Ga0495643_0002704 3300046522 Bacteria 13657
459 Ga0495643_0003269 3300046522 Bacteria 11994
460 Ga0495643_0099436 3300046522 Bacteria 1492
461 Ga0495648_0000018 3300046524 Bacteria 282490
462 Ga0495648_0001493 3300046524 Bacteria 22886
463 Ga0495648_0100081 3300046524 Bacteria 1602
464 Ga0495648_0115237 3300046524 Bacteria 1454
465 Ga0495663_0003941 3300046525 Bacteria 4228
466 Ga0495642_0003589 3300046528 Bacteria 6102
467 Ga0495633_0004188 3300046558 Bacteria 9257
468 Ga0495633_0064781 3300046558 Bacteria 1708
469 Ga0495668_0000059 3300046616 Bacteria 194951
470 Ga0495611_0055865 3300046648 Bacteria 1787
471 Ga0495625_0001633 3300046660 Bacteria 26389
472 Ga0495625_0004059 3300046660 Bacteria 13990
473 Ga0495625_0038326 3300046660 Bacteria 3510
474 Ga0495625_0040489 3300046660 Bacteria 3397
475 Ga0495625_0047960 3300046660 Bacteria 3078
476 Ga0495670_0060090 3300046691 Bacteria 1909
477 Ga0495671_0000011 3300046692 Bacteria 365582
478 Ga0495671_0024998 3300046692 Bacteria 3107
479 Ga0495660_0072848 3300046810 Bacteria 1818
480 Ga0495677_0004297 3300047445 Bacteria 5477
481 Ga0495673_0000013 3300047469 Bacteria 612902
482 Ga0495673_0032390 3300047469 Bacteria 2438
483 Ga0495673_0043128 3300047469 Bacteria 2021
484 Ga0495681_0007069 3300047470 Bacteria 7246
485 Ga0495686_0000053 3300047472 Bacteria 259537
486 Ga0495686_0000141 3300047472 Bacteria 144510
487 Ga0495686_0000511 3300047472 Bacteria 56027
488 Ga0495686_0012386 3300047472 Bacteria 5966
489 Ga0495686_0075609 3300047472 Bacteria 2065
490 Ga0496100_0074923 3300048903 Bacteria 2268
491 Ga0496102_0000100 3300048905 Bacteria 123531
492 Ga0496102_0000184 3300048905 Bacteria 84568
493 Ga0496102_0056923 3300048905 Bacteria 3568
494 Ga0496103_0000070 3300048906 Bacteria 121077
495 Ga0496103_0000099 3300048906 Bacteria 94046
496 Ga0496103_0039775 3300048906 Bacteria 2890
497 Ga0496103_0096817 3300048906 Bacteria 1865
498 Ga0496104_0019640 3300048907 Bacteria 6186
499 Ga0496104_0166271 3300048907 Bacteria 2116
500 Ga0496105_0001784 3300048908 Bacteria 15381
501 Ga0496106_0000966 3300048909 Bacteria 20956
502 Ga0496108_0002667 3300048911 Bacteria 14298
503 Ga0496108_0017063 3300048911 Bacteria 5935
504 Ga0496108_0062901 3300048911 Bacteria 3125
505 Ga0496109_0075293 3300048912 Bacteria 3103
506 Ga0496110_0013168 3300048913 Bacteria 6830
507 Ga0496110_0063604 3300048913 Bacteria 3260
508 Ga0496110_0131343 3300048913 Bacteria 2261
509 Ga0496113_0001111 3300048916 Bacteria 14597
510 Ga0496113_0158823 3300048916 Bacteria 1786
511 Ga0496115_0000066 3300048918 Bacteria 95550
512 Ga0496116_0002164 3300048919 Bacteria 20928
513 Ga0496116_0002579 3300048919 Bacteria 18871
514 Ga0496117_0000194 3300048920 Bacteria 123531
515 Ga0496117_0000744 3300048920 Bacteria 51303
516 Ga0496117_0006172 3300048920 Bacteria 12244
517 Ga0496117_0025842 3300048920 Bacteria 4604
518 Ga0496118_0000146 3300048921 Bacteria 123531
519 Ga0496118_0000434 3300048921 Bacteria 69469
520 Ga0496118_0000852 3300048921 Bacteria 48454
521 Ga0496118_0004543 3300048921 Bacteria 16370
522 Ga0496118_0066084 3300048921 Bacteria 2641
523 Ga0496120_0017808 3300048923 Bacteria 4592
524 Ga0496120_0020134 3300048923 Bacteria 4249
525 Ga0496121_0000417 3300048924 Bacteria 84424
526 Ga0496121_0000670 3300048924 Bacteria 63957
527 Ga0496121_0001202 3300048924 Bacteria 45329
528 Ga0496121_0001743 3300048924 Bacteria 35549
529 Ga0496121_0008548 3300048924 Bacteria 12008
530 Ga0496121_0017936 3300048924 Bacteria 7179
531 Ga0496121_0112500 3300048924 Bacteria 2074
532 Ga0496121_0140707 3300048924 Bacteria 1791
533 Ga0496122_0000221 3300048925 Bacteria 127004
534 Ga0496122_0000627 3300048925 Bacteria 72195
535 Ga0496122_0021049 3300048925 Bacteria 5858
536 Ga0496123_0000833 3300048926 Bacteria 49467
537 Ga0496123_0000962 3300048926 Bacteria 44465
538 Ga0496123_0006477 3300048926 Bacteria 11332
539 Ga0496123_0012929 3300048926 Bacteria 7060
540 Ga0496123_0031843 3300048926 Bacteria 3828
541 Ga0496123_0124820 3300048926 Bacteria 1439
542 Ga0496124_0000185 3300048927 Bacteria 123531
543 Ga0496124_0000291 3300048927 Bacteria 94493
544 Ga0496124_0000648 3300048927 Bacteria 57426
545 Ga0496124_0001629 3300048927 Bacteria 32187
546 Ga0496124_0015374 3300048927 Bacteria 7339
547 Ga0496124_0022364 3300048927 Bacteria 5797
548 Ga0496124_0023699 3300048927 Bacteria 5597
549 Ga0496125_0000687 3300048928 Bacteria 56251
550 Ga0496125_0036267 3300048928 Bacteria 4309
551 Ga0496125_0079580 3300048928 Bacteria 2514
552 Ga0496126_0003758 3300048929 Bacteria 18877
553 Ga0496126_0011152 3300048929 Bacteria 9330
554 Ga0496126_0012541 3300048929 Bacteria 8676
555 Ga0496126_0126083 3300048929 Bacteria 2216
556 Ga0501034_0005895 3300049571 Bacteria 13302
557 Ga0501038_0205059 3300049574 Bacteria 1580
558 Ga0501041_0082488 3300049577 Bacteria 1981
559 Ga0501069_0060448 3300049585 Bacteria 2115
560 Ga0501070_0079042 3300049586 Bacteria 2722
561 Ga0501223_000010 3300049663 Bacteria 106901
562 Ga0501235_004353 3300049669 Bacteria 3064
563 Ga0501225_0000008 3300049705 Bacteria 95521
564 Ga0501225_0000376 3300049705 Bacteria 14073
565 Ga0501225_0004562 3300049705 Bacteria 4120
566 Ga0501081_0102784 3300049743 Bacteria 2022
567 Ga0501279_000182 3300049775 Bacteria 8660
568 Ga0501281_00290 3300049777 Bacteria 5187
569 Ga0501282_000324 3300049778 Bacteria 5782
570 Ga0501044_0375811 3300049823 Bacteria 1337
571 nmdc:mga0k408_73827_c1 3300050493 Bacteria 1992
572 nmdc:mga06z11_52_c1 3300050494 Bacteria 49109
573 nmdc:mga04h51_570_c1 3300050495 Bacteria 8813
574 nmdc:mga0n895_77889_c1 3300050512 Bacteria 3298
575 Ga0500643_000050 3300053087 Bacteria 147005
576 Ga0500643_001263 3300053087 Bacteria 14950
577 Ga0500566_0074947 3300053094 Bacteria 1894
578 Ga0500555_000742 3300053103 Bacteria 12026
579 Ga0500556_0000027 3300053104 Bacteria 165855
580 Ga0500595_000911 3300053119 Bacteria 16842
581 Ga0500595_005158 3300053119 Bacteria 5734
582 Ga0500642_0000003 3300053130 Bacteria 544899
583 Ga0500642_0000238 3300053130 Bacteria 21313
584 Ga0500658_0009654 3300053134 Bacteria 3559
585 Ga0500573_0000093 3300053140 Bacteria 40260
586 Ga0500573_0092793 3300053140 Bacteria 1704
587 Ga0500616_0007950 3300053153 Bacteria 6660
588 Ga0500624_000009 3300053157 Bacteria 178763
589 Ga0500624_000120 3300053157 Bacteria 35695
590 Ga0500636_0014724 3300053177 Bacteria 4602
591 Ga0500637_0000076 3300053178 Bacteria 35528
592 Ga0500645_000586 3300053730 Bacteria 23516
593 Ga0500601_001769 3300053737 Bacteria 2324

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053737 Ga0500601_001769 Ga0500601_001769_13_942 300
2 3300003203 JGI25406J46586_10005157 JGI25406J46586_100051574 320
3 3300005985 Ga0081539_10000086 Ga0081539_10000086113 320
4 3300005295 Ga0065707_10104178 Ga0065707_101041783 324
5 3300005563 Ga0068855_100275595 Ga0068855_1002755953 326
6 3300025949 Ga0207667_10215428 Ga0207667_102154283 326
7 3300046522 Ga0495643_0002704 Ga0495643_0002704_9037_10158 327
8 3300046507 Ga0495606_0000390 Ga0495606_0000390_65755_66876 328
9 3300046522 Ga0495643_0099436 Ga0495643_0099436_339_1460 328
10 3300046616 Ga0495668_0000059 Ga0495668_0000059_96612_97733 328
11 3300046692 Ga0495671_0024998 Ga0495671_0024998_857_1978 328
12 3300053130 Ga0500642_0000238 Ga0500642_0000238_774_1895 328
13 3300025290 Ga0207673_1002390 Ga0207673_10023903 330
14 3300053087 Ga0500643_000050 Ga0500643_000050_66101_67228 330
15 3300005458 Ga0070681_10069878 Ga0070681_100698783 331
16 3300025912 Ga0207707_10094305 Ga0207707_100943052 331
17 3300025921 Ga0207652_10074044 Ga0207652_100740444 331
18 3300048925 Ga0496122_0021049 Ga0496122_0021049_1918_3036 334
19 3300049669 Ga0501235_004353 Ga0501235_004353_52_1170 334
20 3300005331 Ga0070670_100079517 Ga0070670_1000795171 335
21 3300009148 Ga0105243_10003479 Ga0105243_1000347914 335
22 3300025925 Ga0207650_10151670 Ga0207650_101516701 335
23 3300025935 Ga0207709_10000005 Ga0207709_10000005629 335
24 3300003791 Ga0055530_10000114 Ga0055530_1000011439 336
25 3300003794 Ga0055531_10000095 Ga0055531_1000009535 336
26 3300025298 Ga0209050_1000051 Ga0209050_100005135 336
27 3300025304 Ga0209257_1000028 Ga0209257_1000028333 336
28 3300049663 Ga0501223_000010 Ga0501223_000010_92355_93479 336
29 3300049705 Ga0501225_0000008 Ga0501225_0000008_80707_81831 336
30 3300005335 Ga0070666_10009675 Ga0070666_100096755 337
31 3300005347 Ga0070668_100000993 Ga0070668_10000099311 337
32 3300005367 Ga0070667_100000199 Ga0070667_10000019948 337
33 3300005841 Ga0068863_100000029 Ga0068863_10000002922 337
34 3300005843 Ga0068860_100002353 Ga0068860_10000235312 337
35 3300025903 Ga0207680_10002112 Ga0207680_100021127 337
36 3300025972 Ga0207668_10000313 Ga0207668_1000031310 337
37 3300025986 Ga0207658_10000159 Ga0207658_1000015949 337
38 3300026088 Ga0207641_10000049 Ga0207641_1000004922 337
39 3300028381 Ga0268264_10001925 Ga0268264_100019257 337
40 3300046471 Ga0495650_0001327 Ga0495650_0001327_22672_23790 337
41 3300048924 Ga0496121_0112500 Ga0496121_0112500_185_1303 337
42 3300031824 Ga0307413_10117905 Ga0307413_101179052 338
43 3300049705 Ga0501225_0004562 Ga0501225_0004562_75_1202 338
44 3300049775 Ga0501279_000182 Ga0501279_000182_5490_6617 338
45 3300049777 Ga0501281_00290 Ga0501281_00290_1233_2360 338
46 3300049778 Ga0501282_000324 Ga0501282_000324_1756_2883 338
47 3300001990 JGI24737J22298_10002013 JGI24737J22298_100020135 339
48 3300002075 JGI24738J21930_10001894 JGI24738J21930_100018946 339
49 3300013307 Ga0157372_10268487 Ga0157372_102684873 339
50 3300025904 Ga0207647_10003181 Ga0207647_100031812 339
51 3300047469 Ga0495673_0032390 Ga0495673_0032390_467_1591 339
52 3300048925 Ga0496122_0000627 Ga0496122_0000627_50562_51689 339
53 3300048926 Ga0496123_0000962 Ga0496123_0000962_17709_18836 339
54 3300048927 Ga0496124_0001629 Ga0496124_0001629_11887_13014 339
55 3300053119 Ga0500595_000911 Ga0500595_000911_13503_14624 339
56 3300005347 Ga0070668_100016156 Ga0070668_1000161563 340
57 3300009011 Ga0105251_10003664 Ga0105251_100036646 340
58 3300025735 Ga0207713_1023180 Ga0207713_10231803 340
59 3300025972 Ga0207668_10016024 Ga0207668_100160243 340
60 3300032004 Ga0307414_10003041 Ga0307414_100030417 340
61 3300047472 Ga0495686_0000141 Ga0495686_0000141_87084_88211 340
62 3300048913 Ga0496110_0131343 Ga0496110_0131343_984_2102 340
63 3300048926 Ga0496123_0124820 Ga0496123_0124820_135_1253 340
64 3300048927 Ga0496124_0022364 Ga0496124_0022364_700_1818 340
65 3300048928 Ga0496125_0079580 Ga0496125_0079580_1144_2265 340
66 3300053157 Ga0500624_000120 Ga0500624_000120_1766_2887 340
67 3300053178 Ga0500637_0000076 Ga0500637_0000076_32566_33687 340
68 3300005289 Ga0065704_10002877 Ga0065704_100028773 341
69 3300005295 Ga0065707_10102066 Ga0065707_101020663 341
70 3300005353 Ga0070669_100000001 Ga0070669_100000001534 341
71 3300005353 Ga0070669_100089640 Ga0070669_1000896402 341
72 3300005844 Ga0068862_100001039 Ga0068862_10000103911 341
73 3300009553 Ga0105249_10013461 Ga0105249_100134618 341
74 3300009978 Ga0105148_100043 Ga0105148_1000438 341
75 3300025315 Ga0207697_10001981 Ga0207697_100019818 341
76 3300025923 Ga0207681_10000002 Ga0207681_10000002469 341
77 3300025923 Ga0207681_10081881 Ga0207681_100818812 341
78 3300025981 Ga0207640_10016378 Ga0207640_100163785 341
79 3300028380 Ga0268265_10000116 Ga0268265_1000011636 341
80 3300044735 Ga0466968_0010087 Ga0466968_0010087_1776_2903 341
81 3300048924 Ga0496121_0008548 Ga0496121_0008548_7711_8838 341
82 3300049705 Ga0501225_0000376 Ga0501225_0000376_7895_9019 341
83 3300002459 JGI24751J29686_10008002 JGI24751J29686_100080023 342
84 3300005331 Ga0070670_100017442 Ga0070670_1000174423 342
85 3300005335 Ga0070666_10000182 Ga0070666_1000018238 342
86 3300005355 Ga0070671_100000002 Ga0070671_10000000281 342
87 3300005367 Ga0070667_100021538 Ga0070667_1000215385 342
88 3300005617 Ga0068859_100031297 Ga0068859_1000312975 342
89 3300005618 Ga0068864_100000800 Ga0068864_10000080013 342
90 3300005841 Ga0068863_100008204 Ga0068863_1000082045 342
91 3300005842 Ga0068858_100004242 Ga0068858_1000042429 342
92 3300005843 Ga0068860_100009823 Ga0068860_1000098235 342
93 3300006042 Ga0075368_10006435 Ga0075368_100064353 342
94 3300006931 Ga0097620_100031299 Ga0097620_1000312995 342
95 3300009101 Ga0105247_10002228 Ga0105247_100022288 342
96 3300009545 Ga0105237_10009789 Ga0105237_100097893 342
97 3300010375 Ga0105239_10000073 Ga0105239_10000073110 342
98 3300013306 Ga0163162_10014804 Ga0163162_100148043 342
99 3300014968 Ga0157379_10033264 Ga0157379_100332643 342
100 3300025900 Ga0207710_10005939 Ga0207710_100059395 342
101 3300025903 Ga0207680_10000033 Ga0207680_1000003355 342
102 3300025913 Ga0207695_10074360 Ga0207695_100743604 342
103 3300025914 Ga0207671_10020727 Ga0207671_100207272 342
104 3300025925 Ga0207650_10008717 Ga0207650_100087178 342
105 3300025931 Ga0207644_10000002 Ga0207644_10000002473 342
106 3300025941 Ga0207711_10057663 Ga0207711_100576633 342
107 3300025961 Ga0207712_10005757 Ga0207712_100057578 342
108 3300025972 Ga0207668_10001089 Ga0207668_100010895 342
109 3300025986 Ga0207658_10007323 Ga0207658_100073238 342
110 3300026035 Ga0207703_10003103 Ga0207703_1000310312 342
111 3300026088 Ga0207641_10014692 Ga0207641_100146928 342
112 3300027866 Ga0209813_10000095 Ga0209813_100000956 342
113 3300028381 Ga0268264_10000116 Ga0268264_1000011685 342
114 3300030522 Ga0307512_10004811 Ga0307512_1000481114 342
115 3300046507 Ga0495606_0001880 Ga0495606_0001880_1130_2257 342
116 3300048924 Ga0496121_0001743 Ga0496121_0001743_11500_12627 342
117 3300048929 Ga0496126_0012541 Ga0496126_0012541_5612_6739 342
118 3300050494 nmdc:mga06z11_52_c1 nmdc:mga06z11_52_c1_47484_48605 342
119 3300050495 nmdc:mga04h51_570_c1 nmdc:mga04h51_570_c1_2658_3779 342
120 3300009093 Ga0105240_10014804 Ga0105240_100148048 343
121 3300025913 Ga0207695_10153503 Ga0207695_101535033 343
122 3300005331 Ga0070670_100154909 Ga0070670_1001549093 344
123 3300005347 Ga0070668_100000034 Ga0070668_10000003489 344
124 3300005355 Ga0070671_100000160 Ga0070671_10000016022 344
125 3300005539 Ga0068853_100017380 Ga0068853_1000173805 344
126 3300005548 Ga0070665_100340257 Ga0070665_1003402572 344
127 3300005563 Ga0068855_100000377 Ga0068855_10000037747 344
128 3300005616 Ga0068852_100065135 Ga0068852_1000651353 344
129 3300005617 Ga0068859_100026537 Ga0068859_1000265376 344
130 3300005841 Ga0068863_100000020 Ga0068863_100000020142 344
131 3300005844 Ga0068862_100013247 Ga0068862_1000132474 344
132 3300006931 Ga0097620_100026537 Ga0097620_1000265376 344
133 3300009093 Ga0105240_10003584 Ga0105240_100035843 344
134 3300009553 Ga0105249_10129125 Ga0105249_101291253 344
135 3300025913 Ga0207695_10152157 Ga0207695_101521573 344
136 3300025925 Ga0207650_10068305 Ga0207650_100683053 344
137 3300025931 Ga0207644_10000097 Ga0207644_100000979 344
138 3300025949 Ga0207667_10000537 Ga0207667_100005373 344
139 3300025961 Ga0207712_10077330 Ga0207712_100773303 344
140 3300025972 Ga0207668_10000364 Ga0207668_100003649 344
141 3300026041 Ga0207639_10000449 Ga0207639_1000044910 344
142 3300026088 Ga0207641_10000001 Ga0207641_100000011091 344
143 3300028379 Ga0268266_10102933 Ga0268266_101029332 344
144 3300028381 Ga0268264_10040016 Ga0268264_100400163 344
145 3300039450 Ga0436363_0926748 Ga0436363_0926748_1913_3040 344
146 3300042157 Ga0439458_0000273 Ga0439458_0000273_657_1784 344
147 3300048923 Ga0496120_0017808 Ga0496120_0017808_2025_3152 344
148 3300001989 JGI24739J22299_10012378 JGI24739J22299_100123783 345
149 3300001990 JGI24737J22298_10026128 JGI24737J22298_100261283 345
150 3300002067 JGI24735J21928_10013206 JGI24735J21928_100132063 345
151 3300005262 Ga0065165_1004241 Ga0065165_10042416 345
152 3300005333 Ga0070677_10002044 Ga0070677_100020444 345
153 3300005457 Ga0070662_100027437 Ga0070662_1000274374 345
154 3300006353 Ga0075370_10074767 Ga0075370_100747672 345
155 3300013105 Ga0157369_10240649 Ga0157369_102406492 345
156 3300025904 Ga0207647_10000812 Ga0207647_100008123 345
157 3300042157 Ga0439458_0003781 Ga0439458_0003781_1384_2511 345
158 3300048927 Ga0496124_0015374 Ga0496124_0015374_2580_3716 345
159 3300049586 Ga0501070_0079042 Ga0501070_0079042_1128_2273 345
160 3300053119 Ga0500595_005158 Ga0500595_005158_823_1944 345
161 3300005327 Ga0070658_10000055 Ga0070658_1000005570 346
162 3300025909 Ga0207705_10000139 Ga0207705_1000013971 346
163 3300037471 Ga0395905_0235788 Ga0395905_0235788_32_1150 346
164 3300048905 Ga0496102_0056923 Ga0496102_0056923_1640_2764 346
165 3300048911 Ga0496108_0062901 Ga0496108_0062901_1744_2868 346
166 3300049571 Ga0501034_0005895 Ga0501034_0005895_10609_11730 346
167 3300005719 Ga0068861_100025770 Ga0068861_1000257703 347
168 3300026118 Ga0207675_100002616 Ga0207675_10000261613 347
169 3300031548 Ga0307408_100009178 Ga0307408_1000091783 347
170 3300005331 Ga0070670_100000249 Ga0070670_10000024943 348
171 3300005336 Ga0070680_100000431 Ga0070680_1000004313 348
172 3300005367 Ga0070667_100000570 Ga0070667_10000057027 348
173 3300005530 Ga0070679_100000002 Ga0070679_100000002198 348
174 3300005618 Ga0068864_100000004 Ga0068864_100000004492 348
175 3300005841 Ga0068863_100000002 Ga0068863_100000002493 348
176 3300005844 Ga0068862_100000002 Ga0068862_1000000029 348
177 3300009011 Ga0105251_10000988 Ga0105251_100009885 348
178 3300009101 Ga0105247_10028527 Ga0105247_100285272 348
179 3300009177 Ga0105248_10000016 Ga0105248_10000016240 348
180 3300009553 Ga0105249_10000106 Ga0105249_10000106120 348
181 3300025900 Ga0207710_10020750 Ga0207710_100207502 348
182 3300025917 Ga0207660_10003819 Ga0207660_100038198 348
183 3300025921 Ga0207652_10000001 Ga0207652_10000001294 348
184 3300025921 Ga0207652_10000002 Ga0207652_10000002434 348
185 3300025925 Ga0207650_10000980 Ga0207650_1000098014 348
186 3300025941 Ga0207711_10000022 Ga0207711_10000022237 348
187 3300025961 Ga0207712_10000593 Ga0207712_1000059327 348
188 3300025986 Ga0207658_10000411 Ga0207658_1000041127 348
189 3300026088 Ga0207641_10000002 Ga0207641_10000002972 348
190 3300026095 Ga0207676_10000040 Ga0207676_10000040166 348
191 3300028380 Ga0268265_10000003 Ga0268265_1000000318 348
192 3300031548 Ga0307408_100111664 Ga0307408_1001116643 348
193 3300031731 Ga0307405_10040288 Ga0307405_100402883 348
194 3300032005 Ga0307411_10021077 Ga0307411_100210772 348
195 3300042157 Ga0439458_0010727 Ga0439458_0010727_690_1811 348
196 3300048906 Ga0496103_0096817 Ga0496103_0096817_250_1377 348
197 3300046660 Ga0495625_0004059 Ga0495625_0004059_12771_13892 349
198 3300005459 Ga0068867_100052229 Ga0068867_1000522293 350
199 3300005548 Ga0070665_100000972 Ga0070665_10000097227 350
200 3300025937 Ga0207669_10000946 Ga0207669_1000094612 350
201 3300026121 Ga0207683_10001115 Ga0207683_1000111519 350
202 3300028786 Ga0307517_10024225 Ga0307517_1002422512 350
203 3300046492 Ga0495585_0021281 Ga0495585_0021281_2244_3377 350
204 3300046506 Ga0495583_0009207 Ga0495583_0009207_1535_2656 350
205 3300046518 Ga0495631_0020539 Ga0495631_0020539_1563_2684 350
206 3300046524 Ga0495648_0100081 Ga0495648_0100081_42_1163 350
207 3300046558 Ga0495633_0004188 Ga0495633_0004188_3054_4175 350
208 3300046558 Ga0495633_0064781 Ga0495633_0064781_39_1160 350
209 3300046810 Ga0495660_0072848 Ga0495660_0072848_103_1224 350
210 3300047472 Ga0495686_0000511 Ga0495686_0000511_42708_43829 350
211 3300048924 Ga0496121_0001202 Ga0496121_0001202_16176_17297 350
212 3300048925 Ga0496122_0000221 Ga0496122_0000221_33164_34291 350
213 3300048926 Ga0496123_0000833 Ga0496123_0000833_46673_47800 350
214 3300053087 Ga0500643_001263 Ga0500643_001263_11791_12918 350
215 3300053094 Ga0500566_0074947 Ga0500566_0074947_660_1787 350
216 3300053177 Ga0500636_0014724 Ga0500636_0014724_1683_2804 350
217 3300005340 Ga0070689_100186052 Ga0070689_1001860522 351
218 3300005353 Ga0070669_100000317 Ga0070669_10000031731 351
219 3300005366 Ga0070659_100000011 Ga0070659_10000001199 351
220 3300005366 Ga0070659_100111127 Ga0070659_1001111272 351
221 3300005367 Ga0070667_100035498 Ga0070667_1000354982 351
222 3300005544 Ga0070686_100000284 Ga0070686_10000028423 351
223 3300005548 Ga0070665_100017966 Ga0070665_1000179662 351
224 3300005618 Ga0068864_100052967 Ga0068864_1000529673 351
225 3300017792 Ga0163161_10039071 Ga0163161_100390713 351
226 3300025904 Ga0207647_10049844 Ga0207647_100498443 351
227 3300025923 Ga0207681_10002014 Ga0207681_100020144 351
228 3300025925 Ga0207650_10069769 Ga0207650_100697693 351
229 3300025925 Ga0207650_10074085 Ga0207650_100740853 351
230 3300025932 Ga0207690_10000005 Ga0207690_10000005109 351
231 3300025936 Ga0207670_10195026 Ga0207670_101950262 351
232 3300025941 Ga0207711_10048087 Ga0207711_100480872 351
233 3300025986 Ga0207658_10050391 Ga0207658_100503913 351
234 3300025986 Ga0207658_10077294 Ga0207658_100772944 351
235 3300026095 Ga0207676_10047729 Ga0207676_100477293 351
236 3300028381 Ga0268264_10041890 Ga0268264_100418903 351
237 3300046524 Ga0495648_0115237 Ga0495648_0115237_233_1354 351
238 3300046525 Ga0495663_0003941 Ga0495663_0003941_1015_2136 351
239 3300046648 Ga0495611_0055865 Ga0495611_0055865_588_1715 351
240 3300046660 Ga0495625_0040489 Ga0495625_0040489_2253_3374 351
241 3300048903 Ga0496100_0074923 Ga0496100_0074923_750_1886 351
242 3300048905 Ga0496102_0000184 Ga0496102_0000184_32059_33180 351
243 3300048906 Ga0496103_0000099 Ga0496103_0000099_50721_51842 351
244 3300048907 Ga0496104_0019640 Ga0496104_0019640_3783_4919 351
245 3300048907 Ga0496104_0166271 Ga0496104_0166271_910_2031 351
246 3300048908 Ga0496105_0001784 Ga0496105_0001784_1931_3052 351
247 3300048909 Ga0496106_0000966 Ga0496106_0000966_7388_8524 351
248 3300048911 Ga0496108_0017063 Ga0496108_0017063_3936_5072 351
249 3300048912 Ga0496109_0075293 Ga0496109_0075293_525_1661 351
250 3300048913 Ga0496110_0013168 Ga0496110_0013168_1373_2494 351
251 3300048913 Ga0496110_0063604 Ga0496110_0063604_1180_2316 351
252 3300048916 Ga0496113_0001111 Ga0496113_0001111_928_2064 351
253 3300048916 Ga0496113_0158823 Ga0496113_0158823_520_1641 351
254 3300048918 Ga0496115_0000066 Ga0496115_0000066_42160_43281 351
255 3300048919 Ga0496116_0002164 Ga0496116_0002164_7820_8941 351
256 3300048920 Ga0496117_0000744 Ga0496117_0000744_8323_9444 351
257 3300048921 Ga0496118_0000852 Ga0496118_0000852_42044_43165 351
258 3300048923 Ga0496120_0020134 Ga0496120_0020134_1168_2289 351
259 3300048924 Ga0496121_0000417 Ga0496121_0000417_41967_43088 351
260 3300048926 Ga0496123_0006477 Ga0496123_0006477_8947_10068 351
261 3300048927 Ga0496124_0000291 Ga0496124_0000291_41958_43079 351
262 3300048928 Ga0496125_0000687 Ga0496125_0000687_12862_13983 351
263 3300048929 Ga0496126_0003758 Ga0496126_0003758_12394_13515 351
264 3300053140 Ga0500573_0092793 Ga0500573_0092793_240_1361 351
265 3300053153 Ga0500616_0007950 Ga0500616_0007950_3953_5080 351
266 3300005548 Ga0070665_100000089 Ga0070665_100000089140 352
267 3300028379 Ga0268266_10000083 Ga0268266_1000008335 352
268 3300031911 Ga0307412_10035802 Ga0307412_100358022 352
269 3300013296 Ga0157374_10064473 Ga0157374_100644733 353
270 3300025297 Ga0209758_1029226 Ga0209758_10292264 353
271 3300025940 Ga0207691_10279725 Ga0207691_102797252 353
272 3300037853 Ga0436364_0543931 Ga0436364_0543931_308_1429 353
273 3300046513 Ga0495616_0098622 Ga0495616_0098622_17_1138 353
274 3300046528 Ga0495642_0003589 Ga0495642_0003589_3210_4331 353
275 3300047445 Ga0495677_0004297 Ga0495677_0004297_3271_4392 353
276 3300009177 Ga0105248_10369541 Ga0105248_103695411 355
277 3300026095 Ga0207676_10372916 Ga0207676_103729162 355
278 3300046506 Ga0495583_0000033 Ga0495583_0000033_78927_80054 355
279 3300053103 Ga0500555_000742 Ga0500555_000742_696_1823 355
280 3300044719 Ga0466971_0057643 Ga0466971_0057643_491_1618 356
281 3300046506 Ga0495583_0003712 Ga0495583_0003712_9261_10397 356
282 3300046692 Ga0495671_0000011 Ga0495671_0000011_203177_204313 356
283 3300047469 Ga0495673_0000013 Ga0495673_0000013_471241_472377 356
284 3300006871 Ga0075434_100132799 Ga0075434_1001327992 357
285 3300020082 Ga0206353_11089745 Ga0206353_110897452 357
286 3300046460 Ga0495638_0000018 Ga0495638_0000018_140086_141225 357
287 3300046524 Ga0495648_0000018 Ga0495648_0000018_141266_142405 357
288 3300050512 nmdc:mga0n895_77889_c1 nmdc:mga0n895_77889_c1_1274_2401 357
289 3300005338 Ga0068868_100000042 Ga0068868_10000004278 358
290 3300005577 Ga0068857_100316373 Ga0068857_1003163732 358
291 3300005614 Ga0068856_100109937 Ga0068856_1001099374 358
292 3300005616 Ga0068852_100000393 Ga0068852_10000039313 358
293 3300013105 Ga0157369_10013976 Ga0157369_100139767 358
294 3300026078 Ga0207702_10008912 Ga0207702_100089129 358
295 3300026116 Ga0207674_10127060 Ga0207674_101270604 358
296 3300026142 Ga0207698_10001092 Ga0207698_1000109211 358
297 3300032126 Ga0307415_100026870 Ga0307415_1000268703 358
298 3300037312 Ga0395899_0006918 Ga0395899_0006918_174_1301 358
299 3300037418 Ga0395900_0228996 Ga0395900_0228996_37_1164 358
300 3300041410 Ga0439461_0000108 Ga0439461_0000108_8751_9872 358
301 3300041997 Ga0439431_0001890 Ga0439431_0001890_35_1156 358
302 3300042004 Ga0439445_0000054 Ga0439445_0000054_6867_7988 358
303 3300042006 Ga0439432_025810 Ga0439432_025810_315_1436 358
304 3300042015 Ga0439462_0002567 Ga0439462_0002567_2513_3634 358
305 3300046519 Ga0495632_0003057 Ga0495632_0003057_1780_2916 358
306 3300005617 Ga0068859_100034368 Ga0068859_1000343685 359
307 3300006931 Ga0097620_100034367 Ga0097620_1000343675 359
308 3300009545 Ga0105237_10079802 Ga0105237_100798022 359
309 3300014326 Ga0157380_10060767 Ga0157380_100607673 359
310 3300047469 Ga0495673_0043128 Ga0495673_0043128_592_1719 360
311 3300005530 Ga0070679_100163809 Ga0070679_1001638093 361
312 3300014325 Ga0163163_10242394 Ga0163163_102423942 361
313 3300003214 JGI25165J46597_1000289 JGI25165J46597_100028953 362
314 3300025231 Ga0207427_100420 Ga0207427_10042023 362
315 3300025261 Ga0209233_1000291 Ga0209233_100029123 362
316 3300045836 Ga0466958_0026324 Ga0466958_0026324_2152_3279 362
317 3300045976 Ga0466967_0120728 Ga0466967_0120728_734_1861 362
318 3300046660 Ga0495625_0001633 Ga0495625_0001633_10303_11439 362
319 3300005355 Ga0070671_100000112 Ga0070671_10000011220 363
320 3300025931 Ga0207644_10000107 Ga0207644_1000010747 363
321 3300048906 Ga0496103_0039775 Ga0496103_0039775_982_2118 363
322 3300001915 JGI24741J21665_1003441 JGI24741J21665_10034412 365
323 3300005539 Ga0068853_100039656 Ga0068853_1000396566 365
324 iso_pu_bacteria 2643221622 2644127674 365
325 3300005841 Ga0068863_100051605 Ga0068863_1000516053 366
326 3300026088 Ga0207641_10029503 Ga0207641_100295036 366
327 3300009093 Ga0105240_10099444 Ga0105240_100994443 367
328 3300031911 Ga0307412_10000304 Ga0307412_1000030427 367
329 3300005336 Ga0070680_100019919 Ga0070680_1000199196 368
330 3300005338 Ga0068868_100295667 Ga0068868_1002956671 368
331 3300005347 Ga0070668_100237360 Ga0070668_1002373601 368
332 3300005367 Ga0070667_100008714 Ga0070667_1000087142 368
333 3300005456 Ga0070678_100002349 Ga0070678_1000023495 368
334 3300005459 Ga0068867_100097607 Ga0068867_1000976072 368
335 3300005548 Ga0070665_100003125 Ga0070665_1000031257 368
336 3300014969 Ga0157376_10101503 Ga0157376_101015033 368
337 3300025937 Ga0207669_10032133 Ga0207669_100321333 368
338 3300025986 Ga0207658_10028416 Ga0207658_100284161 368
339 3300026089 Ga0207648_10178051 Ga0207648_101780511 368
340 3300028379 Ga0268266_10048020 Ga0268266_100480203 368
341 3300031548 Ga0307408_100020042 Ga0307408_1000200422 368
342 3300031901 Ga0307406_10002850 Ga0307406_100028506 368
343 3300031903 Ga0307407_10004214 Ga0307407_100042146 368
344 3300031995 Ga0307409_100004393 Ga0307409_1000043936 368
345 3300032002 Ga0307416_100007874 Ga0307416_1000078746 368
346 3300032005 Ga0307411_10026655 Ga0307411_100266552 368
347 3300048905 Ga0496102_0000100 Ga0496102_0000100_118660_119784 368
348 3300048906 Ga0496103_0000070 Ga0496103_0000070_118641_119765 368
349 3300048919 Ga0496116_0002579 Ga0496116_0002579_16523_17647 368
350 3300048920 Ga0496117_0000194 Ga0496117_0000194_118660_119784 368
351 3300048921 Ga0496118_0000146 Ga0496118_0000146_118660_119784 368
352 3300048927 Ga0496124_0000185 Ga0496124_0000185_3748_4872 368
353 3300049577 Ga0501041_0082488 Ga0501041_0082488_484_1608 368
354 3300049743 Ga0501081_0102784 Ga0501081_0102784_109_1233 368
355 3300003773 Ga0055537_1000406 Ga0055537_10004064 369
356 3300003775 Ga0055524_1000133 Ga0055524_100013334 369
357 3300003794 Ga0055531_10004667 Ga0055531_100046674 369
358 3300025263 Ga0209565_1000007 Ga0209565_1000007709 369
359 3300025273 Ga0209673_1001335 Ga0209673_10013353 369
360 3300025298 Ga0209050_1009706 Ga0209050_10097063 369
361 3300025299 Ga0209256_1000008 Ga0209256_1000008551 369
362 3300025304 Ga0209257_1004469 Ga0209257_10044694 369
363 3300031901 Ga0307406_10088335 Ga0307406_100883352 369
364 iso_pu_bacteria 2512564014 2512644599 369
365 iso_pu_bacteria 2599185354 2600201213 369
366 iso_pu_bacteria 2599185359 2600228063 369
367 iso_pu_bacteria 2751185897 2753764919 369
368 iso_pu_bacteria 2751185897 2753765424 369
369 iso_pu_bacteria 2808606401 2809062343 369
370 iso_pu_bacteria 2808606404 2809078317 369
371 iso_pu_bacteria 2808606405 2809082732 369
372 iso_pu_bacteria 2818991466 2819715132 369
373 iso_pu_bacteria 2830075706 2830078455 369
374 iso_pu_bacteria 2879163058 2879164313 369
375 iso_pu_bacteria 2880518877 2880522398 369
376 iso_pu_bacteria 2885429604 2885432645 369
377 iso_pu_bacteria 2919709256 2919709665 369
378 iso_pu_bacteria 2928526807 2928531146 369
379 iso_pu_bacteria 2928968154 2928972322 369
380 iso_pu_bacteria 2946787523 2946790241 369
381 3300021358 Ga0213873_10000007 Ga0213873_1000000787 370
382 3300021384 Ga0213876_10000005 Ga0213876_10000005123 370
383 3300039437 Ga0436365_0687780 Ga0436365_0687780_49365_50483 370
384 3300039453 Ga0436362_0451893 Ga0436362_0451893_86923_88041 370
385 3300005347 Ga0070668_100028198 Ga0070668_1000281982 371
386 3300025972 Ga0207668_10071656 Ga0207668_100716561 371
387 3300048911 Ga0496108_0002667 Ga0496108_0002667_3530_4672 371
388 3300002774 JGI25150J39212_1000282 JGI25150J39212_100028210 372
389 3300003215 JGI25153J46596_10000032 JGI25153J46596_10000032161 372
390 3300009147 Ga0114129_10148369 Ga0114129_101483694 372
391 3300009545 Ga0105237_10059453 Ga0105237_100594534 372
392 3300025245 Ga0207425_1000025 Ga0207425_1000025245 372
393 3300025263 Ga0209565_1006830 Ga0209565_10068303 372
394 3300025294 Ga0209025_1000663 Ga0209025_10006634 372
395 3300025297 Ga0209758_1000002 Ga0209758_1000002329 372
396 3300025298 Ga0209050_1031398 Ga0209050_10313982 372
397 3300025304 Ga0209257_1001406 Ga0209257_100140615 372
398 3300025933 Ga0207706_10116124 Ga0207706_101161243 372
399 3300001990 JGI24737J22298_10000590 JGI24737J22298_100005905 373
400 3300001991 JGI24743J22301_10001846 JGI24743J22301_100018463 373
401 3300002067 JGI24735J21928_10006215 JGI24735J21928_100062151 373
402 3300002067 JGI24735J21928_10010490 JGI24735J21928_100104904 373
403 3300002067 JGI24735J21928_10011900 JGI24735J21928_100119004 373
404 3300002067 JGI24735J21928_10026852 JGI24735J21928_100268521 373
405 3300002075 JGI24738J21930_10001982 JGI24738J21930_100019822 373
406 3300003762 Ga0055542_1000142 Ga0055542_100014297 373
407 3300003762 Ga0055542_1000783 Ga0055542_100078322 373
408 3300003763 Ga0055529_1000167 Ga0055529_100016797 373
409 3300003771 Ga0055526_1001776 Ga0055526_100177615 373
410 3300003792 Ga0055540_1007630 Ga0055540_10076303 373
411 3300005262 Ga0065165_1011769 Ga0065165_10117693 373
412 3300005327 Ga0070658_10000384 Ga0070658_1000038424 373
413 3300005327 Ga0070658_10001088 Ga0070658_100010883 373
414 3300005334 Ga0068869_100001042 Ga0068869_10000104218 373
415 3300005338 Ga0068868_100000516 Ga0068868_1000005168 373
416 3300005339 Ga0070660_100000066 Ga0070660_10000006624 373
417 3300005339 Ga0070660_100007816 Ga0070660_1000078162 373
418 3300005344 Ga0070661_100000133 Ga0070661_10000013322 373
419 3300005347 Ga0070668_100013601 Ga0070668_1000136013 373
420 3300005354 Ga0070675_100008635 Ga0070675_1000086359 373
421 3300005355 Ga0070671_100002059 Ga0070671_10000205913 373
422 3300005355 Ga0070671_100027168 Ga0070671_1000271682 373
423 3300005364 Ga0070673_100000010 Ga0070673_100000010139 373
424 3300005366 Ga0070659_100018071 Ga0070659_1000180715 373
425 3300005367 Ga0070667_100217414 Ga0070667_1002174142 373
426 3300005457 Ga0070662_100107278 Ga0070662_1001072783 373
427 3300005459 Ga0068867_100000019 Ga0068867_10000001982 373
428 3300005539 Ga0068853_100037460 Ga0068853_1000374603 373
429 3300005539 Ga0068853_100115975 Ga0068853_1001159753 373
430 3300005543 Ga0070672_100060355 Ga0070672_1000603553 373
431 3300005548 Ga0070665_100000316 Ga0070665_1000003168 373
432 3300005563 Ga0068855_100000123 Ga0068855_10000012384 373
433 3300005563 Ga0068855_100244018 Ga0068855_1002440183 373
434 3300005617 Ga0068859_100001318 Ga0068859_10000131824 373
435 3300005719 Ga0068861_100000850 Ga0068861_10000085015 373
436 3300005842 Ga0068858_100000122 Ga0068858_10000012211 373
437 3300006881 Ga0068865_100000319 Ga0068865_1000003199 373
438 3300006931 Ga0097620_100001318 Ga0097620_1000013183 373
439 3300009093 Ga0105240_10056596 Ga0105240_100565962 373
440 3300009098 Ga0105245_10000582 Ga0105245_1000058215 373
441 3300009098 Ga0105245_10001094 Ga0105245_1000109422 373
442 3300009148 Ga0105243_10000296 Ga0105243_1000029622 373
443 3300009176 Ga0105242_10000803 Ga0105242_100008036 373
444 3300009177 Ga0105248_10006892 Ga0105248_100068923 373
445 3300009545 Ga0105237_10009164 Ga0105237_100091643 373
446 3300009545 Ga0105237_10054919 Ga0105237_100549193 373
447 3300009553 Ga0105249_10060620 Ga0105249_100606203 373
448 3300010375 Ga0105239_10130631 Ga0105239_101306315 373
449 3300013102 Ga0157371_10000062 Ga0157371_1000006233 373
450 3300013104 Ga0157370_10000774 Ga0157370_1000077429 373
451 3300013296 Ga0157374_10003979 Ga0157374_100039797 373
452 3300013296 Ga0157374_10015043 Ga0157374_100150436 373
453 3300013297 Ga0157378_10006416 Ga0157378_100064166 373
454 3300013297 Ga0157378_10109366 Ga0157378_101093662 373
455 3300013306 Ga0163162_10164516 Ga0163162_101645162 373
456 3300013307 Ga0157372_10016443 Ga0157372_100164434 373
457 3300013308 Ga0157375_10003787 Ga0157375_1000378713 373
458 3300014745 Ga0157377_10061945 Ga0157377_100619453 373
459 3300014969 Ga0157376_10000245 Ga0157376_1000024521 373
460 3300021384 Ga0213876_10003902 Ga0213876_100039024 373
461 3300025254 Ga0209148_1000008 Ga0209148_1000008484 373
462 3300025254 Ga0209148_1000114 Ga0209148_100011483 373
463 3300025254 Ga0209148_1001403 Ga0209148_10014034 373
464 3300025261 Ga0209233_1000107 Ga0209233_100010790 373
465 3300025272 Ga0209455_1000002 Ga0209455_1000002940 373
466 3300025272 Ga0209455_1000796 Ga0209455_10007964 373
467 3300025295 Ga0209564_1002343 Ga0209564_10023436 373
468 3300025298 Ga0209050_1000001 Ga0209050_1000001273 373
469 3300025298 Ga0209050_1000350 Ga0209050_100035079 373
470 3300025303 Ga0209051_1000689 Ga0209051_10006895 373
471 3300025304 Ga0209257_1001053 Ga0209257_100105318 373
472 3300025907 Ga0207645_10000492 Ga0207645_1000049229 373
473 3300025909 Ga0207705_10000181 Ga0207705_1000018131 373
474 3300025909 Ga0207705_10000254 Ga0207705_1000025433 373
475 3300025909 Ga0207705_10023327 Ga0207705_100233273 373
476 3300025911 Ga0207654_10000822 Ga0207654_1000082214 373
477 3300025913 Ga0207695_10168710 Ga0207695_101687102 373
478 3300025914 Ga0207671_10009543 Ga0207671_1000954310 373
479 3300025919 Ga0207657_10003028 Ga0207657_1000302818 373
480 3300025920 Ga0207649_10000247 Ga0207649_100002475 373
481 3300025920 Ga0207649_10000651 Ga0207649_1000065113 373
482 3300025923 Ga0207681_10044883 Ga0207681_100448832 373
483 3300025924 Ga0207694_10003586 Ga0207694_100035867 373
484 3300025927 Ga0207687_10000728 Ga0207687_1000072815 373
485 3300025927 Ga0207687_10003822 Ga0207687_100038227 373
486 3300025931 Ga0207644_10010910 Ga0207644_100109103 373
487 3300025932 Ga0207690_10003702 Ga0207690_100037025 373
488 3300025932 Ga0207690_10036117 Ga0207690_100361173 373
489 3300025935 Ga0207709_10000050 Ga0207709_100000509 373
490 3300025937 Ga0207669_10004620 Ga0207669_100046204 373
491 3300025938 Ga0207704_10000051 Ga0207704_100000513 373
492 3300025940 Ga0207691_10093636 Ga0207691_100936363 373
493 3300025940 Ga0207691_10131899 Ga0207691_101318994 373
494 3300025941 Ga0207711_10001291 Ga0207711_1000129112 373
495 3300025942 Ga0207689_10000899 Ga0207689_100008997 373
496 3300025949 Ga0207667_10000167 Ga0207667_1000016781 373
497 3300025949 Ga0207667_10000852 Ga0207667_100008529 373
498 3300025949 Ga0207667_10040733 Ga0207667_100407331 373
499 3300025949 Ga0207667_10109641 Ga0207667_101096415 373
500 3300025949 Ga0207667_10267390 Ga0207667_102673903 373
501 3300025960 Ga0207651_10000005 Ga0207651_10000005242 373
502 3300025961 Ga0207712_10048491 Ga0207712_100484913 373
503 3300025972 Ga0207668_10002267 Ga0207668_100022677 373
504 3300026023 Ga0207677_10000484 Ga0207677_1000048419 373
505 3300026035 Ga0207703_10000159 Ga0207703_1000015967 373
506 3300026041 Ga0207639_10010202 Ga0207639_100102023 373
507 3300026078 Ga0207702_10006464 Ga0207702_1000646410 373
508 3300026078 Ga0207702_10010959 Ga0207702_100109598 373
509 3300026089 Ga0207648_10000068 Ga0207648_1000006882 373
510 3300026116 Ga0207674_10058761 Ga0207674_100587612 373
511 3300026118 Ga0207675_100001943 Ga0207675_1000019439 373
512 3300026142 Ga0207698_10003088 Ga0207698_100030883 373
513 3300028379 Ga0268266_10000002 Ga0268266_10000002893 373
514 3300028381 Ga0268264_10230277 Ga0268264_102302773 373
515 3300031456 Ga0307513_10001996 Ga0307513_100019968 373
516 3300031456 Ga0307513_10267685 Ga0307513_102676852 373
517 3300031616 Ga0307508_10000302 Ga0307508_1000030259 373
518 3300031728 Ga0316578_10118904 Ga0316578_101189041 373
519 3300031911 Ga0307412_10022225 Ga0307412_100222253 373
520 3300036712 Ga0316584_0047411 Ga0316584_0047411_1442_2593 373
521 3300036712 Ga0316584_0071411 Ga0316584_0071411_215_1366 373
522 3300038705 Ga0237819_00282 Ga0237819_00282_3911_5038 373
523 3300039437 Ga0436365_1127686 Ga0436365_1127686_3635_4762 373
524 3300041997 Ga0439431_0018299 Ga0439431_0018299_407_1528 373
525 3300042010 Ga0439452_011683 Ga0439452_011683_496_1617 373
526 3300044658 Ga0466972_0011708 Ga0466972_0011708_1868_2995 373
527 3300044706 Ga0466964_0008643 Ga0466964_0008643_1820_2947 373
528 3300044901 Ga0466960_0020079 Ga0466960_0020079_79_1206 373
529 3300045049 Ga0466959_0107453 Ga0466959_0107453_830_1951 373
530 3300046460 Ga0495638_0000048 Ga0495638_0000048_105227_106348 373
531 3300046471 Ga0495650_0000983 Ga0495650_0000983_1978_3099 373
532 3300046522 Ga0495643_0003269 Ga0495643_0003269_132_1253 373
533 3300046524 Ga0495648_0001493 Ga0495648_0001493_1868_2989 373
534 3300046660 Ga0495625_0038326 Ga0495625_0038326_516_1637 373
535 3300046660 Ga0495625_0047960 Ga0495625_0047960_913_2040 373
536 3300046691 Ga0495670_0060090 Ga0495670_0060090_186_1322 373
537 3300047470 Ga0495681_0007069 Ga0495681_0007069_769_1890 373
538 3300047472 Ga0495686_0000053 Ga0495686_0000053_76317_77444 373
539 3300047472 Ga0495686_0012386 Ga0495686_0012386_3385_4506 373
540 3300047472 Ga0495686_0075609 Ga0495686_0075609_75_1202 373
541 3300048920 Ga0496117_0006172 Ga0496117_0006172_2824_3951 373
542 3300048920 Ga0496117_0025842 Ga0496117_0025842_3228_4355 373
543 3300048921 Ga0496118_0000434 Ga0496118_0000434_46771_47898 373
544 3300048921 Ga0496118_0004543 Ga0496118_0004543_8652_9779 373
545 3300048921 Ga0496118_0066084 Ga0496118_0066084_835_1962 373
546 3300048924 Ga0496121_0017936 Ga0496121_0017936_5855_6982 373
547 3300048924 Ga0496121_0140707 Ga0496121_0140707_624_1745 373
548 3300048926 Ga0496123_0012929 Ga0496123_0012929_1414_2541 373
549 3300048926 Ga0496123_0031843 Ga0496123_0031843_1103_2224 373
550 3300048927 Ga0496124_0000648 Ga0496124_0000648_41849_42970 373
551 3300048927 Ga0496124_0023699 Ga0496124_0023699_335_1456 373
552 3300048929 Ga0496126_0126083 Ga0496126_0126083_493_1620 373
553 3300049585 Ga0501069_0060448 Ga0501069_0060448_207_1334 373
554 3300049823 Ga0501044_0375811 Ga0501044_0375811_111_1238 373
555 3300053104 Ga0500556_0000027 Ga0500556_0000027_152236_153363 373
556 3300053130 Ga0500642_0000003 Ga0500642_0000003_537213_538340 373
557 3300053134 Ga0500658_0009654 Ga0500658_0009654_948_2069 373
558 3300053140 Ga0500573_0000093 Ga0500573_0000093_1966_3087 373
559 3300053157 Ga0500624_000009 Ga0500624_000009_116833_117954 373
560 3300053730 Ga0500645_000586 Ga0500645_000586_21442_22569 373
561 3300031250 Ga0265331_10007851 Ga0265331_100078512 374
562 3300032126 Ga0307415_100058569 Ga0307415_1000585694 374
563 3300049574 Ga0501038_0205059 Ga0501038_0205059_94_1299 374
564 3300001904 JGI24736J21556_1000479 JGI24736J21556_10004793 375
565 3300001915 JGI24741J21665_1000063 JGI24741J21665_10000638 375
566 3300001989 JGI24739J22299_10007314 JGI24739J22299_100073142 375
567 3300001990 JGI24737J22298_10003951 JGI24737J22298_100039513 375
568 3300002067 JGI24735J21928_10003325 JGI24735J21928_100033254 375
569 3300005327 Ga0070658_10048616 Ga0070658_100486164 375
570 3300005339 Ga0070660_100036013 Ga0070660_1000360132 375
571 3300005366 Ga0070659_100035610 Ga0070659_1000356104 375
572 3300005455 Ga0070663_100022137 Ga0070663_1000221373 375
573 3300005614 Ga0068856_100003500 Ga0068856_10000350011 375
574 3300005985 Ga0081539_10018758 Ga0081539_100187583 375
575 3300009174 Ga0105241_10007488 Ga0105241_100074884 375
576 3300009545 Ga0105237_10037685 Ga0105237_100376852 375
577 3300010375 Ga0105239_10056916 Ga0105239_100569163 375
578 3300025321 Ga0207656_10011133 Ga0207656_100111333 375
579 3300025904 Ga0207647_10045307 Ga0207647_100453073 375
580 3300025911 Ga0207654_10032576 Ga0207654_100325763 375
581 3300025919 Ga0207657_10022449 Ga0207657_100224495 375
582 3300026041 Ga0207639_10000100 Ga0207639_100001008 375
583 3300026067 Ga0207678_10000007 Ga0207678_1000000728 375
584 3300026078 Ga0207702_10028171 Ga0207702_100281714 375
585 3300026116 Ga0207674_10033925 Ga0207674_100339253 375
586 3300031548 Ga0307408_100035106 Ga0307408_1000351064 375
587 3300031852 Ga0307410_10042175 Ga0307410_100421752 375
588 3300031911 Ga0307412_10196255 Ga0307412_101962551 375
589 3300032002 Ga0307416_100080827 Ga0307416_1000808273 375
590 3300050493 nmdc:mga0k408_73827_c1 nmdc:mga0k408_73827_c1_818_1969 375
591 3300021361 Ga0213872_10000577 Ga0213872_1000057720 376
592 3300028800 Ga0265338_10117244 Ga0265338_101172441 376
593 3300039447 Ga0436361_0375914 Ga0436361_0375914_7817_8974 376
594 2162886007 SwRhRL2b_contig_493648 SwRhRL2b_0926.00006950 380
595 3300001915 JGI24741J21665_1000437 JGI24741J21665_100043712 380
596 3300001979 JGI24740J21852_10000017 JGI24740J21852_1000001720 380
597 3300005289 Ga0065704_10001254 Ga0065704_100012548 380
598 3300005455 Ga0070663_100000022 Ga0070663_10000002285 380
599 3300005577 Ga0068857_100055682 Ga0068857_1000556823 380
600 3300005614 Ga0068856_100000041 Ga0068856_10000004187 380
601 3300009174 Ga0105241_10000037 Ga0105241_1000003784 380
602 3300013100 Ga0157373_10000046 Ga0157373_1000004619 380
603 3300013104 Ga0157370_10000071 Ga0157370_1000007119 380
604 3300025911 Ga0207654_10000032 Ga0207654_1000003228 380
605 3300026067 Ga0207678_10000038 Ga0207678_1000003873 380
606 3300026078 Ga0207702_10000061 Ga0207702_1000006187 380
607 3300026078 Ga0207702_10114574 Ga0207702_101145743 380
608 3300026116 Ga0207674_10070451 Ga0207674_100704513 380
609 3300048924 Ga0496121_0000670 Ga0496121_0000670_46128_47270 380
610 3300048928 Ga0496125_0036267 Ga0496125_0036267_1964_3106 380
611 3300048929 Ga0496126_0011152 Ga0496126_0011152_6408_7550 380

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05222

AlaDh_PNT_N

Alanine dehydrogenase/PNT, N-terminal domain

31

165

0.97

PF01262

AlaDh_PNT_C

Alanine dehydrogenase/PNT, C-terminal domain

169

396

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4dio-assembly1.cif.gz_B the crystal structure of transhydrogenase from sinorhizobium meliloti 0.9597 1 364
1u2g-assembly1.cif.gz_A transhydrogenase (di.adpr)2(diii.nadph)1 asymmetric complex 0.959 1 361
4dio-assembly1.cif.gz_A the crystal structure of transhydrogenase from sinorhizobium meliloti 0.9567 1 361
4dio-assembly1.cif.gz_A the crystal structure of transhydrogenase from sinorhizobium meliloti 0.954 1 361
4dio-assembly1.cif.gz_B the crystal structure of transhydrogenase from sinorhizobium meliloti 0.954 1 364
ID Description Score Start End Superfamily
af_A4HWA7_1_176_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9955 161 192 3.50.50.60
af_Q54H99_9_164_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9758 161 192 3.50.50.60
af_A0A0P0V2P7_13_181_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.971 163 193 3.50.50.60
af_Q4CQU6_365_588_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9573 160 192 3.50.50.60
af_Q54H02_2_246_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9551 161 192 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A3S4IYE5-F1-model_v4 proton-translocating NAD(P)(+) transhydrogenase (EC 7.1.1.1) 0.9945 117 201 GO:0005886
GO:0006740
GO:0016491
GO:0050661
AF-A0A4Q3CEL8-F1-model_v4 proton-translocating NAD(P)(+) transhydrogenase (EC 7.1.1.1) 0.9921 39 367 GO:0005886
GO:0006740
GO:0016491
GO:0050661
AF-A0A377BBC3-F1-model_v4 proton-translocating NAD(P)(+) transhydrogenase (EC 7.1.1.1) 0.9917 108 209 GO:0005886
GO:0006740
GO:0008750
GO:0016491
GO:0050661
AF-A0A520I8I6-F1-model_v4 proton-translocating NAD(P)(+) transhydrogenase (EC 7.1.1.1) 0.9902 116 367 GO:0005886
GO:0006740
GO:0016491
GO:0050661
AF-A0A4Q3C5W8-F1-model_v4 proton-translocating NAD(P)(+) transhydrogenase (EC 7.1.1.1) 0.9893 1 205 GO:0005886
GO:0006740
GO:0016491
GO:0050661

Feature Viewer

pLDDT pTM Quality
92.2 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map