F469038
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 611 | 304 | 593 | 361 |
Family's Representative Sequence
| Representative Sequence | 3300005339|Ga0070660_100036013|Ga0070660_1000360132 |
| Length | 406 |
| Sequence | MGILDQAGDVAASAGSGARQRRTRVEIVKIGIVKEMAPGERRVSGTPETVKKFTALGATVAVETGAGLSAAISDADYVAMGAXXXDRAATVADADIILGVQGPDAASLAGARPGAWIVAGLNPFVERARIDAYAAAGFEALAMEFMPRITRAQSMDILSSQSNLAGYKAVLDAAAEYGRSFPMMMTAAGTVSPAKAFIMGVGVAGLQAIATARRLGAQVSATDVRSATREQIESLGAKAIFVESVAGIEGEGKGGYATEMSEEYRQAQAELVSSHIAKQDIVITTALIPGKPAPRLVSDAQIASMKPGSVIVDLAVEQGGNVEGAVAGEVVERHGVKIVGHRNVPSRLAADASALFARNLYNFLSAFWNKERNAPVLDEEIGNAIRVTQGGKIVSERLLQLAGGMQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2512564014 | Sphingobium sp. AP49 | Isolate | Rhizosphere |
| 3 | 2599185354 | Sphingomonas sp. NFR15 | Isolate | Rhizoplane |
| 4 | 2599185359 | Sphingomonas sp. NFR04 | Isolate | Rhizoplane |
| 5 | 2643221622 | Sphingomonas sp. Root241 | Isolate | Unclassified |
| 6 | 2751185897 | Sphingomonas panacis DCY99 | Isolate | Unclassified |
| 7 | 2808606401 | Sphingobium sp. AEW010 | Isolate | Rhizosphere |
| 8 | 2808606404 | Sphingobium sp. AEW013 | Isolate | Rhizosphere |
| 9 | 2808606405 | Sphingobium sp. AEW001 | Isolate | Rhizosphere |
| 10 | 2818991466 | Sphingomonas trueperi 1152a | Isolate | Unclassified |
| 11 | 2830075706 | Sphingomonas jinjuensis DSM 21457 | Isolate | Rhizosphere |
| 12 | 2879163058 | Sphingomonas pokkalii L3B27 | Isolate | Rhizosphere |
| 13 | 2880518877 | Sphingobium sp. JAI105 | Isolate | Rhizosphere |
| 14 | 2885429604 | Sphingomonas sp. WZY 27 | Isolate | Rhizosphere |
| 15 | 2919709256 | Sphingobium xenophagum 4256 | Isolate | Unclassified |
| 16 | 2928526807 | Sphingomonas trueperi 1770 | Isolate | Rhizosphere |
| 17 | 2928968154 | Sphingomonas trueperi 1075 | Isolate | Unclassified |
| 18 | 2946787523 | Sphingomonas faeni W4I17 | Isolate | Rhizosphere |
| 19 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 20 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 21 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 22 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 23 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 24 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 25 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 26 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 27 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 28 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 29 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 30 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 31 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 32 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 33 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 34 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 35 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 36 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 37 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 38 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 39 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 40 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 41 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 42 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 43 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 47 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 50 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 52 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 64 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 65 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 66 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 67 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 69 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 71 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 72 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 73 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 74 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 75 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 76 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 77 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 78 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 79 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 80 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 81 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 82 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 83 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 84 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 85 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 86 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009978 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG | Metagenome | Rhizosphere |
| 99 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 116 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 117 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 118 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 119 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 121 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 124 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 126 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 129 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 132 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 187 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 188 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 189 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 190 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 191 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 192 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 193 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 194 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 195 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 196 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 197 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 198 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 199 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 200 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 201 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 202 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 203 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 204 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 205 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 206 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 207 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 208 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 209 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 210 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 211 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 212 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 213 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 214 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 215 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 216 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 217 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 218 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 219 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 220 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 221 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 222 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 223 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 224 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 225 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 226 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 227 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 228 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 229 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 230 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 254 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 255 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 256 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 257 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 258 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 259 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 260 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 261 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 262 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 263 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 264 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 265 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 266 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 267 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 268 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 269 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 270 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 271 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 272 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 273 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 274 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 280 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 281 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 282 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 284 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 285 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 286 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 288 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 289 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 290 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 292 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 293 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 294 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 295 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 296 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 297 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 298 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 299 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 300 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 301 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 302 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 303 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 304 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.89 |
| Metatranscriptomes | 0.16 |
| Isolates | 2.95 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.97 |
| Nodule | 0 |
| Rhizoplane | 3.93 |
| Rhizosphere | 74.96 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.15 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_493648 | 2162886007 | Bacteria | 5061 |
| 2 | JGI24736J21556_1000479 | 3300001904 | Bacteria | 7486 |
| 3 | JGI24741J21665_1000063 | 3300001915 | Bacteria | 25937 |
| 4 | JGI24741J21665_1000437 | 3300001915 | Bacteria | 12597 |
| 5 | JGI24741J21665_1003441 | 3300001915 | Bacteria | 3774 |
| 6 | JGI24740J21852_10000017 | 3300001979 | Bacteria | 57092 |
| 7 | JGI24739J22299_10007314 | 3300001989 | Bacteria | 4146 |
| 8 | JGI24739J22299_10012378 | 3300001989 | Bacteria | 3135 |
| 9 | JGI24737J22298_10000590 | 3300001990 | Bacteria | 12764 |
| 10 | JGI24737J22298_10002013 | 3300001990 | Bacteria | 7258 |
| 11 | JGI24737J22298_10003951 | 3300001990 | Bacteria | 5192 |
| 12 | JGI24737J22298_10026128 | 3300001990 | Bacteria | 1844 |
| 13 | JGI24743J22301_10001846 | 3300001991 | Bacteria | 3060 |
| 14 | JGI24735J21928_10003325 | 3300002067 | Bacteria | 5485 |
| 15 | JGI24735J21928_10006215 | 3300002067 | Bacteria | 3944 |
| 16 | JGI24735J21928_10010490 | 3300002067 | Bacteria | 2953 |
| 17 | JGI24735J21928_10011900 | 3300002067 | Bacteria | 2753 |
| 18 | JGI24735J21928_10013206 | 3300002067 | Bacteria | 2600 |
| 19 | JGI24735J21928_10026852 | 3300002067 | Bacteria | 1728 |
| 20 | JGI24738J21930_10001894 | 3300002075 | Bacteria | 5653 |
| 21 | JGI24738J21930_10001982 | 3300002075 | Bacteria | 5505 |
| 22 | JGI24751J29686_10008002 | 3300002459 | Bacteria | 2160 |
| 23 | JGI25150J39212_1000282 | 3300002774 | Bacteria | 26768 |
| 24 | JGI25406J46586_10005157 | 3300003203 | Bacteria | 6064 |
| 25 | JGI25165J46597_1000289 | 3300003214 | Bacteria | 63916 |
| 26 | JGI25153J46596_10000032 | 3300003215 | Bacteria | 196732 |
| 27 | Ga0055542_1000142 | 3300003762 | Bacteria | 89813 |
| 28 | Ga0055542_1000783 | 3300003762 | Bacteria | 23812 |
| 29 | Ga0055529_1000167 | 3300003763 | Bacteria | 90966 |
| 30 | Ga0055526_1001776 | 3300003771 | Bacteria | 14983 |
| 31 | Ga0055537_1000406 | 3300003773 | Bacteria | 28230 |
| 32 | Ga0055524_1000133 | 3300003775 | Bacteria | 87720 |
| 33 | Ga0055530_10000114 | 3300003791 | Bacteria | 70700 |
| 34 | Ga0055540_1007630 | 3300003792 | Bacteria | 4040 |
| 35 | Ga0055531_10000095 | 3300003794 | Bacteria | 96056 |
| 36 | Ga0055531_10004667 | 3300003794 | Bacteria | 8213 |
| 37 | Ga0065165_1004241 | 3300005262 | Bacteria | 9097 |
| 38 | Ga0065165_1011769 | 3300005262 | Bacteria | 3609 |
| 39 | Ga0065704_10001254 | 3300005289 | Bacteria | 12681 |
| 40 | Ga0065704_10002877 | 3300005289 | Bacteria | 4914 |
| 41 | Ga0065707_10102066 | 3300005295 | Bacteria | 2828 |
| 42 | Ga0065707_10104178 | 3300005295 | Bacteria | 2708 |
| 43 | Ga0070658_10000055 | 3300005327 | Bacteria | 114800 |
| 44 | Ga0070658_10000384 | 3300005327 | Bacteria | 38496 |
| 45 | Ga0070658_10001088 | 3300005327 | Bacteria | 23167 |
| 46 | Ga0070658_10048616 | 3300005327 | Bacteria | 3434 |
| 47 | Ga0070670_100000249 | 3300005331 | Bacteria | 48555 |
| 48 | Ga0070670_100017442 | 3300005331 | Bacteria | 6159 |
| 49 | Ga0070670_100079517 | 3300005331 | Bacteria | 2818 |
| 50 | Ga0070670_100154909 | 3300005331 | Bacteria | 1984 |
| 51 | Ga0070677_10002044 | 3300005333 | Bacteria | 6419 |
| 52 | Ga0068869_100001042 | 3300005334 | Bacteria | 16130 |
| 53 | Ga0070666_10000182 | 3300005335 | Bacteria | 43137 |
| 54 | Ga0070666_10009675 | 3300005335 | Bacteria | 6020 |
| 55 | Ga0070680_100000431 | 3300005336 | Bacteria | 28580 |
| 56 | Ga0070680_100019919 | 3300005336 | Bacteria | 5319 |
| 57 | Ga0068868_100000042 | 3300005338 | Bacteria | 68731 |
| 58 | Ga0068868_100000516 | 3300005338 | Bacteria | 25830 |
| 59 | Ga0068868_100295667 | 3300005338 | Bacteria | 1374 |
| 60 | Ga0070660_100000066 | 3300005339 | Bacteria | 61587 |
| 61 | Ga0070660_100007816 | 3300005339 | Bacteria | 7457 |
| 62 | Ga0070660_100036013 | 3300005339 | Bacteria | 3746 |
| 63 | Ga0070689_100186052 | 3300005340 | Bacteria | 1689 |
| 64 | Ga0070661_100000133 | 3300005344 | Bacteria | 62182 |
| 65 | Ga0070668_100000034 | 3300005347 | Bacteria | 82494 |
| 66 | Ga0070668_100000993 | 3300005347 | Bacteria | 19904 |
| 67 | Ga0070668_100013601 | 3300005347 | Bacteria | 6077 |
| 68 | Ga0070668_100016156 | 3300005347 | Bacteria | 5586 |
| 69 | Ga0070668_100028198 | 3300005347 | Bacteria | 4264 |
| 70 | Ga0070668_100237360 | 3300005347 | Bacteria | 1509 |
| 71 | Ga0070669_100000001 | 3300005353 | Bacteria | 537589 |
| 72 | Ga0070669_100000317 | 3300005353 | Bacteria | 37676 |
| 73 | Ga0070669_100089640 | 3300005353 | Bacteria | 2304 |
| 74 | Ga0070675_100008635 | 3300005354 | Bacteria | 7910 |
| 75 | Ga0070671_100000002 | 3300005355 | Bacteria | 292733 |
| 76 | Ga0070671_100000112 | 3300005355 | Bacteria | 52171 |
| 77 | Ga0070671_100000160 | 3300005355 | Bacteria | 44240 |
| 78 | Ga0070671_100002059 | 3300005355 | Bacteria | 15508 |
| 79 | Ga0070671_100027168 | 3300005355 | Bacteria | 4708 |
| 80 | Ga0070673_100000010 | 3300005364 | Bacteria | 153851 |
| 81 | Ga0070659_100000011 | 3300005366 | Bacteria | 185903 |
| 82 | Ga0070659_100018071 | 3300005366 | Bacteria | 5318 |
| 83 | Ga0070659_100035610 | 3300005366 | Bacteria | 3876 |
| 84 | Ga0070659_100111127 | 3300005366 | Bacteria | 2212 |
| 85 | Ga0070667_100000199 | 3300005367 | Bacteria | 71115 |
| 86 | Ga0070667_100000570 | 3300005367 | Bacteria | 36484 |
| 87 | Ga0070667_100008714 | 3300005367 | Bacteria | 8411 |
| 88 | Ga0070667_100021538 | 3300005367 | Bacteria | 5351 |
| 89 | Ga0070667_100035498 | 3300005367 | Bacteria | 4177 |
| 90 | Ga0070667_100217414 | 3300005367 | Bacteria | 1700 |
| 91 | Ga0070663_100000022 | 3300005455 | Bacteria | 111612 |
| 92 | Ga0070663_100022137 | 3300005455 | Bacteria | 4243 |
| 93 | Ga0070678_100002349 | 3300005456 | Bacteria | 10338 |
| 94 | Ga0070662_100027437 | 3300005457 | Bacteria | 3952 |
| 95 | Ga0070662_100107278 | 3300005457 | Bacteria | 2123 |
| 96 | Ga0070681_10069878 | 3300005458 | Bacteria | 3477 |
| 97 | Ga0068867_100000019 | 3300005459 | Bacteria | 97503 |
| 98 | Ga0068867_100052229 | 3300005459 | Bacteria | 3016 |
| 99 | Ga0068867_100097607 | 3300005459 | Bacteria | 2239 |
| 100 | Ga0070679_100000002 | 3300005530 | Bacteria | 312066 |
| 101 | Ga0070679_100163809 | 3300005530 | Bacteria | 2197 |
| 102 | Ga0068853_100017380 | 3300005539 | Bacteria | 5939 |
| 103 | Ga0068853_100037460 | 3300005539 | Bacteria | 4126 |
| 104 | Ga0068853_100039656 | 3300005539 | Bacteria | 4017 |
| 105 | Ga0068853_100115975 | 3300005539 | Bacteria | 2384 |
| 106 | Ga0070672_100060355 | 3300005543 | Bacteria | 2986 |
| 107 | Ga0070686_100000284 | 3300005544 | Bacteria | 34135 |
| 108 | Ga0070665_100000089 | 3300005548 | Bacteria | 177659 |
| 109 | Ga0070665_100000316 | 3300005548 | Bacteria | 75107 |
| 110 | Ga0070665_100000972 | 3300005548 | Bacteria | 36392 |
| 111 | Ga0070665_100003125 | 3300005548 | Bacteria | 17834 |
| 112 | Ga0070665_100017966 | 3300005548 | Bacteria | 7101 |
| 113 | Ga0070665_100340257 | 3300005548 | Bacteria | 1505 |
| 114 | Ga0068855_100000123 | 3300005563 | Bacteria | 97174 |
| 115 | Ga0068855_100000377 | 3300005563 | Bacteria | 55242 |
| 116 | Ga0068855_100244018 | 3300005563 | Bacteria | 2006 |
| 117 | Ga0068855_100275595 | 3300005563 | Bacteria | 1870 |
| 118 | Ga0068857_100055682 | 3300005577 | Bacteria | 3509 |
| 119 | Ga0068857_100316373 | 3300005577 | Bacteria | 1441 |
| 120 | Ga0068856_100000041 | 3300005614 | Bacteria | 112613 |
| 121 | Ga0068856_100003500 | 3300005614 | Bacteria | 15852 |
| 122 | Ga0068856_100109937 | 3300005614 | Bacteria | 2753 |
| 123 | Ga0068852_100000393 | 3300005616 | Bacteria | 29281 |
| 124 | Ga0068852_100065135 | 3300005616 | Bacteria | 3178 |
| 125 | Ga0068859_100001318 | 3300005617 | Bacteria | 25318 |
| 126 | Ga0068859_100026537 | 3300005617 | Bacteria | 5809 |
| 127 | Ga0068859_100031297 | 3300005617 | Bacteria | 5342 |
| 128 | Ga0068859_100034368 | 3300005617 | Bacteria | 5088 |
| 129 | Ga0068864_100000004 | 3300005618 | Bacteria | 489341 |
| 130 | Ga0068864_100000800 | 3300005618 | Bacteria | 26375 |
| 131 | Ga0068864_100052967 | 3300005618 | Bacteria | 3499 |
| 132 | Ga0068861_100000850 | 3300005719 | Bacteria | 18510 |
| 133 | Ga0068861_100025770 | 3300005719 | Bacteria | 4268 |
| 134 | Ga0068863_100000002 | 3300005841 | Bacteria | 489510 |
| 135 | Ga0068863_100000020 | 3300005841 | Bacteria | 198519 |
| 136 | Ga0068863_100000029 | 3300005841 | Bacteria | 177191 |
| 137 | Ga0068863_100008204 | 3300005841 | Bacteria | 10207 |
| 138 | Ga0068863_100051605 | 3300005841 | Bacteria | 3898 |
| 139 | Ga0068858_100000122 | 3300005842 | Bacteria | 80502 |
| 140 | Ga0068858_100004242 | 3300005842 | Bacteria | 14102 |
| 141 | Ga0068860_100002353 | 3300005843 | Bacteria | 19855 |
| 142 | Ga0068860_100009823 | 3300005843 | Bacteria | 9494 |
| 143 | Ga0068862_100000002 | 3300005844 | Bacteria | 489341 |
| 144 | Ga0068862_100001039 | 3300005844 | Bacteria | 26612 |
| 145 | Ga0068862_100013247 | 3300005844 | Bacteria | 6821 |
| 146 | Ga0081539_10000086 | 3300005985 | Bacteria | 217801 |
| 147 | Ga0081539_10018758 | 3300005985 | Bacteria | 4777 |
| 148 | Ga0075368_10006435 | 3300006042 | Bacteria | 4103 |
| 149 | Ga0075370_10074767 | 3300006353 | Bacteria | 1942 |
| 150 | Ga0075434_100132799 | 3300006871 | Bacteria | 2509 |
| 151 | Ga0068865_100000319 | 3300006881 | Bacteria | 26597 |
| 152 | Ga0097620_100001318 | 3300006931 | Bacteria | 25318 |
| 153 | Ga0097620_100026537 | 3300006931 | Bacteria | 5809 |
| 154 | Ga0097620_100031299 | 3300006931 | Bacteria | 5342 |
| 155 | Ga0097620_100034367 | 3300006931 | Bacteria | 5088 |
| 156 | Ga0105251_10000988 | 3300009011 | Bacteria | 24969 |
| 157 | Ga0105251_10003664 | 3300009011 | Bacteria | 11021 |
| 158 | Ga0105240_10003584 | 3300009093 | Bacteria | 24088 |
| 159 | Ga0105240_10014804 | 3300009093 | Bacteria | 10631 |
| 160 | Ga0105240_10056596 | 3300009093 | Bacteria | 4906 |
| 161 | Ga0105240_10099444 | 3300009093 | Bacteria | 3540 |
| 162 | Ga0105245_10000582 | 3300009098 | Bacteria | 33174 |
| 163 | Ga0105245_10001094 | 3300009098 | Bacteria | 24598 |
| 164 | Ga0105247_10002228 | 3300009101 | Bacteria | 13346 |
| 165 | Ga0105247_10028527 | 3300009101 | Bacteria | 3378 |
| 166 | Ga0114129_10148369 | 3300009147 | Bacteria | 3211 |
| 167 | Ga0105243_10000296 | 3300009148 | Bacteria | 55065 |
| 168 | Ga0105243_10003479 | 3300009148 | Bacteria | 12715 |
| 169 | Ga0105241_10000037 | 3300009174 | Bacteria | 115452 |
| 170 | Ga0105241_10007488 | 3300009174 | Bacteria | 8036 |
| 171 | Ga0105242_10000803 | 3300009176 | Bacteria | 24326 |
| 172 | Ga0105248_10000016 | 3300009177 | Bacteria | 308151 |
| 173 | Ga0105248_10006892 | 3300009177 | Bacteria | 12456 |
| 174 | Ga0105248_10369541 | 3300009177 | Bacteria | 1615 |
| 175 | Ga0105237_10009164 | 3300009545 | Bacteria | 10629 |
| 176 | Ga0105237_10009789 | 3300009545 | Bacteria | 10248 |
| 177 | Ga0105237_10037685 | 3300009545 | Bacteria | 4886 |
| 178 | Ga0105237_10054919 | 3300009545 | Bacteria | 3990 |
| 179 | Ga0105237_10059453 | 3300009545 | Bacteria | 3824 |
| 180 | Ga0105237_10079802 | 3300009545 | Bacteria | 3263 |
| 181 | Ga0105249_10000106 | 3300009553 | Bacteria | 115526 |
| 182 | Ga0105249_10013461 | 3300009553 | Bacteria | 7222 |
| 183 | Ga0105249_10060620 | 3300009553 | Bacteria | 3471 |
| 184 | Ga0105249_10129125 | 3300009553 | Bacteria | 2411 |
| 185 | Ga0105148_100043 | 3300009978 | Bacteria | 18692 |
| 186 | Ga0105239_10000073 | 3300010375 | Bacteria | 140771 |
| 187 | Ga0105239_10056916 | 3300010375 | Bacteria | 4288 |
| 188 | Ga0105239_10130631 | 3300010375 | Bacteria | 2793 |
| 189 | Ga0157373_10000046 | 3300013100 | Bacteria | 112179 |
| 190 | Ga0157371_10000062 | 3300013102 | Bacteria | 169669 |
| 191 | Ga0157370_10000071 | 3300013104 | Bacteria | 111640 |
| 192 | Ga0157370_10000774 | 3300013104 | Bacteria | 40033 |
| 193 | Ga0157369_10013976 | 3300013105 | Bacteria | 9073 |
| 194 | Ga0157369_10240649 | 3300013105 | Bacteria | 1890 |
| 195 | Ga0157374_10003979 | 3300013296 | Bacteria | 12416 |
| 196 | Ga0157374_10015043 | 3300013296 | Bacteria | 6783 |
| 197 | Ga0157374_10064473 | 3300013296 | Bacteria | 3437 |
| 198 | Ga0157378_10006416 | 3300013297 | Bacteria | 10284 |
| 199 | Ga0157378_10109366 | 3300013297 | Bacteria | 2532 |
| 200 | Ga0163162_10014804 | 3300013306 | Bacteria | 7619 |
| 201 | Ga0163162_10164516 | 3300013306 | Bacteria | 2342 |
| 202 | Ga0157372_10016443 | 3300013307 | Bacteria | 7938 |
| 203 | Ga0157372_10268487 | 3300013307 | Bacteria | 1982 |
| 204 | Ga0157375_10003787 | 3300013308 | Bacteria | 13108 |
| 205 | Ga0163163_10242394 | 3300014325 | Bacteria | 1853 |
| 206 | Ga0157380_10060767 | 3300014326 | Bacteria | 3021 |
| 207 | Ga0157377_10061945 | 3300014745 | Bacteria | 2139 |
| 208 | Ga0157379_10033264 | 3300014968 | Bacteria | 4598 |
| 209 | Ga0157376_10000245 | 3300014969 | Bacteria | 37670 |
| 210 | Ga0157376_10101503 | 3300014969 | Bacteria | 2514 |
| 211 | Ga0163161_10039071 | 3300017792 | Bacteria | 3405 |
| 212 | Ga0206353_11089745 | 3300020082 | Bacteria | 5455 |
| 213 | Ga0213873_10000007 | 3300021358 | Bacteria | 309961 |
| 214 | Ga0213872_10000577 | 3300021361 | Bacteria | 28396 |
| 215 | Ga0213876_10000005 | 3300021384 | Bacteria | 727326 |
| 216 | Ga0213876_10003902 | 3300021384 | Bacteria | 8429 |
| 217 | Ga0207427_100420 | 3300025231 | Bacteria | 24276 |
| 218 | Ga0207425_1000025 | 3300025245 | Bacteria | 321872 |
| 219 | Ga0209148_1000008 | 3300025254 | Bacteria | 1504371 |
| 220 | Ga0209148_1000114 | 3300025254 | Bacteria | 192073 |
| 221 | Ga0209148_1001403 | 3300025254 | Bacteria | 12381 |
| 222 | Ga0209233_1000107 | 3300025261 | Bacteria | 267399 |
| 223 | Ga0209233_1000291 | 3300025261 | Bacteria | 64111 |
| 224 | Ga0209565_1000007 | 3300025263 | Bacteria | 784361 |
| 225 | Ga0209565_1006830 | 3300025263 | Bacteria | 3152 |
| 226 | Ga0209455_1000002 | 3300025272 | Bacteria | 1505459 |
| 227 | Ga0209455_1000796 | 3300025272 | Bacteria | 17455 |
| 228 | Ga0209673_1001335 | 3300025273 | Bacteria | 24658 |
| 229 | Ga0207673_1002390 | 3300025290 | Bacteria | 2138 |
| 230 | Ga0209025_1000663 | 3300025294 | Bacteria | 59620 |
| 231 | Ga0209564_1002343 | 3300025295 | Bacteria | 15298 |
| 232 | Ga0209758_1000002 | 3300025297 | Bacteria | 1400310 |
| 233 | Ga0209758_1029226 | 3300025297 | Bacteria | 2310 |
| 234 | Ga0209050_1000001 | 3300025298 | Bacteria | 3563507 |
| 235 | Ga0209050_1000051 | 3300025298 | Bacteria | 353153 |
| 236 | Ga0209050_1000350 | 3300025298 | Bacteria | 88878 |
| 237 | Ga0209050_1009706 | 3300025298 | Bacteria | 4877 |
| 238 | Ga0209050_1031398 | 3300025298 | Bacteria | 1655 |
| 239 | Ga0209256_1000008 | 3300025299 | Bacteria | 975723 |
| 240 | Ga0209051_1000689 | 3300025303 | Bacteria | 37393 |
| 241 | Ga0209257_1000028 | 3300025304 | Bacteria | 699493 |
| 242 | Ga0209257_1001053 | 3300025304 | Bacteria | 36546 |
| 243 | Ga0209257_1001406 | 3300025304 | Bacteria | 28716 |
| 244 | Ga0209257_1004469 | 3300025304 | Bacteria | 10819 |
| 245 | Ga0207697_10001981 | 3300025315 | Bacteria | 10861 |
| 246 | Ga0207656_10011133 | 3300025321 | Bacteria | 3390 |
| 247 | Ga0207713_1023180 | 3300025735 | Bacteria | 2928 |
| 248 | Ga0207710_10005939 | 3300025900 | Bacteria | 5237 |
| 249 | Ga0207710_10020750 | 3300025900 | Bacteria | 2811 |
| 250 | Ga0207680_10000033 | 3300025903 | Bacteria | 77177 |
| 251 | Ga0207680_10002112 | 3300025903 | Bacteria | 9302 |
| 252 | Ga0207647_10000812 | 3300025904 | Bacteria | 24230 |
| 253 | Ga0207647_10003181 | 3300025904 | Bacteria | 12327 |
| 254 | Ga0207647_10045307 | 3300025904 | Bacteria | 2745 |
| 255 | Ga0207647_10049844 | 3300025904 | Bacteria | 2595 |
| 256 | Ga0207645_10000492 | 3300025907 | Bacteria | 32549 |
| 257 | Ga0207705_10000139 | 3300025909 | Bacteria | 78756 |
| 258 | Ga0207705_10000181 | 3300025909 | Bacteria | 66244 |
| 259 | Ga0207705_10000254 | 3300025909 | Bacteria | 52174 |
| 260 | Ga0207705_10023327 | 3300025909 | Bacteria | 4414 |
| 261 | Ga0207654_10000032 | 3300025911 | Bacteria | 120553 |
| 262 | Ga0207654_10000822 | 3300025911 | Bacteria | 17099 |
| 263 | Ga0207654_10032576 | 3300025911 | Bacteria | 2882 |
| 264 | Ga0207707_10094305 | 3300025912 | Bacteria | 2615 |
| 265 | Ga0207695_10074360 | 3300025913 | Bacteria | 3460 |
| 266 | Ga0207695_10152157 | 3300025913 | Bacteria | 2252 |
| 267 | Ga0207695_10153503 | 3300025913 | Bacteria | 2239 |
| 268 | Ga0207695_10168710 | 3300025913 | Bacteria | 2115 |
| 269 | Ga0207671_10009543 | 3300025914 | Bacteria | 8097 |
| 270 | Ga0207671_10020727 | 3300025914 | Bacteria | 5000 |
| 271 | Ga0207660_10003819 | 3300025917 | Bacteria | 9817 |
| 272 | Ga0207657_10003028 | 3300025919 | Bacteria | 18001 |
| 273 | Ga0207657_10022449 | 3300025919 | Bacteria | 5902 |
| 274 | Ga0207649_10000247 | 3300025920 | Bacteria | 43791 |
| 275 | Ga0207649_10000651 | 3300025920 | Bacteria | 23190 |
| 276 | Ga0207652_10000001 | 3300025921 | Bacteria | 1006643 |
| 277 | Ga0207652_10000002 | 3300025921 | Bacteria | 878035 |
| 278 | Ga0207652_10074044 | 3300025921 | Bacteria | 2964 |
| 279 | Ga0207681_10000002 | 3300025923 | Bacteria | 985597 |
| 280 | Ga0207681_10002014 | 3300025923 | Bacteria | 13045 |
| 281 | Ga0207681_10044883 | 3300025923 | Bacteria | 2964 |
| 282 | Ga0207681_10081881 | 3300025923 | Bacteria | 2280 |
| 283 | Ga0207694_10003586 | 3300025924 | Bacteria | 12309 |
| 284 | Ga0207650_10000980 | 3300025925 | Bacteria | 21439 |
| 285 | Ga0207650_10008717 | 3300025925 | Bacteria | 6924 |
| 286 | Ga0207650_10068305 | 3300025925 | Bacteria | 2668 |
| 287 | Ga0207650_10069769 | 3300025925 | Bacteria | 2641 |
| 288 | Ga0207650_10074085 | 3300025925 | Bacteria | 2566 |
| 289 | Ga0207650_10151670 | 3300025925 | Bacteria | 1829 |
| 290 | Ga0207687_10000728 | 3300025927 | Bacteria | 22343 |
| 291 | Ga0207687_10003822 | 3300025927 | Bacteria | 10117 |
| 292 | Ga0207644_10000002 | 3300025931 | Bacteria | 942221 |
| 293 | Ga0207644_10000097 | 3300025931 | Bacteria | 63086 |
| 294 | Ga0207644_10000107 | 3300025931 | Bacteria | 61436 |
| 295 | Ga0207644_10010910 | 3300025931 | Bacteria | 6002 |
| 296 | Ga0207690_10000005 | 3300025932 | Bacteria | 581199 |
| 297 | Ga0207690_10003702 | 3300025932 | Bacteria | 9098 |
| 298 | Ga0207690_10036117 | 3300025932 | Bacteria | 3197 |
| 299 | Ga0207706_10116124 | 3300025933 | Bacteria | 2354 |
| 300 | Ga0207709_10000005 | 3300025935 | Bacteria | 806813 |
| 301 | Ga0207709_10000050 | 3300025935 | Bacteria | 234391 |
| 302 | Ga0207670_10195026 | 3300025936 | Bacteria | 1535 |
| 303 | Ga0207669_10000946 | 3300025937 | Bacteria | 12295 |
| 304 | Ga0207669_10004620 | 3300025937 | Bacteria | 6079 |
| 305 | Ga0207669_10032133 | 3300025937 | Bacteria | 2943 |
| 306 | Ga0207704_10000051 | 3300025938 | Bacteria | 81152 |
| 307 | Ga0207691_10093636 | 3300025940 | Bacteria | 2689 |
| 308 | Ga0207691_10131899 | 3300025940 | Bacteria | 2206 |
| 309 | Ga0207691_10279725 | 3300025940 | Bacteria | 1436 |
| 310 | Ga0207711_10000022 | 3300025941 | Bacteria | 340441 |
| 311 | Ga0207711_10001291 | 3300025941 | Bacteria | 23744 |
| 312 | Ga0207711_10048087 | 3300025941 | Bacteria | 3649 |
| 313 | Ga0207711_10057663 | 3300025941 | Bacteria | 3339 |
| 314 | Ga0207689_10000899 | 3300025942 | Bacteria | 28556 |
| 315 | Ga0207667_10000167 | 3300025949 | Bacteria | 97188 |
| 316 | Ga0207667_10000537 | 3300025949 | Bacteria | 50070 |
| 317 | Ga0207667_10000852 | 3300025949 | Bacteria | 39321 |
| 318 | Ga0207667_10040733 | 3300025949 | Bacteria | 4945 |
| 319 | Ga0207667_10109641 | 3300025949 | Bacteria | 2847 |
| 320 | Ga0207667_10215428 | 3300025949 | Bacteria | 1968 |
| 321 | Ga0207667_10267390 | 3300025949 | Bacteria | 1748 |
| 322 | Ga0207651_10000005 | 3300025960 | Bacteria | 246132 |
| 323 | Ga0207712_10000593 | 3300025961 | Bacteria | 28979 |
| 324 | Ga0207712_10005757 | 3300025961 | Bacteria | 7811 |
| 325 | Ga0207712_10048491 | 3300025961 | Bacteria | 2955 |
| 326 | Ga0207712_10077330 | 3300025961 | Bacteria | 2411 |
| 327 | Ga0207668_10000313 | 3300025972 | Bacteria | 31786 |
| 328 | Ga0207668_10000364 | 3300025972 | Bacteria | 28957 |
| 329 | Ga0207668_10001089 | 3300025972 | Bacteria | 16167 |
| 330 | Ga0207668_10002267 | 3300025972 | Bacteria | 11223 |
| 331 | Ga0207668_10016024 | 3300025972 | Bacteria | 4669 |
| 332 | Ga0207668_10071656 | 3300025972 | Bacteria | 2476 |
| 333 | Ga0207640_10016378 | 3300025981 | Bacteria | 4312 |
| 334 | Ga0207658_10000159 | 3300025986 | Bacteria | 71280 |
| 335 | Ga0207658_10000411 | 3300025986 | Bacteria | 40690 |
| 336 | Ga0207658_10007323 | 3300025986 | Bacteria | 7527 |
| 337 | Ga0207658_10028416 | 3300025986 | Bacteria | 3938 |
| 338 | Ga0207658_10050391 | 3300025986 | Bacteria | 3064 |
| 339 | Ga0207658_10077294 | 3300025986 | Bacteria | 2539 |
| 340 | Ga0207677_10000484 | 3300026023 | Bacteria | 25909 |
| 341 | Ga0207703_10000159 | 3300026035 | Bacteria | 78106 |
| 342 | Ga0207703_10003103 | 3300026035 | Bacteria | 14035 |
| 343 | Ga0207639_10000100 | 3300026041 | Bacteria | 70921 |
| 344 | Ga0207639_10000449 | 3300026041 | Bacteria | 28347 |
| 345 | Ga0207639_10010202 | 3300026041 | Bacteria | 6498 |
| 346 | Ga0207678_10000007 | 3300026067 | Bacteria | 179943 |
| 347 | Ga0207678_10000038 | 3300026067 | Bacteria | 101262 |
| 348 | Ga0207702_10000061 | 3300026078 | Bacteria | 125368 |
| 349 | Ga0207702_10006464 | 3300026078 | Bacteria | 10103 |
| 350 | Ga0207702_10008912 | 3300026078 | Bacteria | 8458 |
| 351 | Ga0207702_10010959 | 3300026078 | Bacteria | 7563 |
| 352 | Ga0207702_10028171 | 3300026078 | Bacteria | 4667 |
| 353 | Ga0207702_10114574 | 3300026078 | Bacteria | 2403 |
| 354 | Ga0207641_10000001 | 3300026088 | Bacteria | 1180841 |
| 355 | Ga0207641_10000002 | 3300026088 | Bacteria | 981004 |
| 356 | Ga0207641_10000049 | 3300026088 | Bacteria | 177222 |
| 357 | Ga0207641_10014692 | 3300026088 | Bacteria | 6419 |
| 358 | Ga0207641_10029503 | 3300026088 | Bacteria | 4537 |
| 359 | Ga0207648_10000068 | 3300026089 | Bacteria | 97469 |
| 360 | Ga0207648_10178051 | 3300026089 | Bacteria | 1881 |
| 361 | Ga0207676_10000040 | 3300026095 | Bacteria | 167947 |
| 362 | Ga0207676_10047729 | 3300026095 | Bacteria | 3320 |
| 363 | Ga0207676_10372916 | 3300026095 | Bacteria | 1326 |
| 364 | Ga0207674_10033925 | 3300026116 | Bacteria | 5339 |
| 365 | Ga0207674_10058761 | 3300026116 | Bacteria | 3894 |
| 366 | Ga0207674_10070451 | 3300026116 | Bacteria | 3515 |
| 367 | Ga0207674_10127060 | 3300026116 | Bacteria | 2515 |
| 368 | Ga0207675_100001943 | 3300026118 | Bacteria | 20638 |
| 369 | Ga0207675_100002616 | 3300026118 | Bacteria | 17805 |
| 370 | Ga0207683_10001115 | 3300026121 | Bacteria | 24408 |
| 371 | Ga0207698_10001092 | 3300026142 | Bacteria | 15782 |
| 372 | Ga0207698_10003088 | 3300026142 | Bacteria | 9988 |
| 373 | Ga0209813_10000095 | 3300027866 | Bacteria | 33070 |
| 374 | Ga0268266_10000002 | 3300028379 | Bacteria | 3059047 |
| 375 | Ga0268266_10000083 | 3300028379 | Bacteria | 202393 |
| 376 | Ga0268266_10048020 | 3300028379 | Bacteria | 3658 |
| 377 | Ga0268266_10102933 | 3300028379 | Bacteria | 2519 |
| 378 | Ga0268265_10000003 | 3300028380 | Bacteria | 949201 |
| 379 | Ga0268265_10000116 | 3300028380 | Bacteria | 100689 |
| 380 | Ga0268264_10000116 | 3300028381 | Bacteria | 198591 |
| 381 | Ga0268264_10001925 | 3300028381 | Bacteria | 18720 |
| 382 | Ga0268264_10040016 | 3300028381 | Bacteria | 3873 |
| 383 | Ga0268264_10041890 | 3300028381 | Bacteria | 3788 |
| 384 | Ga0268264_10230277 | 3300028381 | Bacteria | 1711 |
| 385 | Ga0307517_10024225 | 3300028786 | Bacteria | 7496 |
| 386 | Ga0265338_10117244 | 3300028800 | Bacteria | 2131 |
| 387 | Ga0307512_10004811 | 3300030522 | Bacteria | 14488 |
| 388 | Ga0265331_10007851 | 3300031250 | Bacteria | 6118 |
| 389 | Ga0307513_10001996 | 3300031456 | Bacteria | 28859 |
| 390 | Ga0307513_10267685 | 3300031456 | Bacteria | 1494 |
| 391 | Ga0307408_100009178 | 3300031548 | Bacteria | 6521 |
| 392 | Ga0307408_100020042 | 3300031548 | Bacteria | 4508 |
| 393 | Ga0307408_100035106 | 3300031548 | Bacteria | 3516 |
| 394 | Ga0307408_100111664 | 3300031548 | Bacteria | 2100 |
| 395 | Ga0307508_10000302 | 3300031616 | Bacteria | 60090 |
| 396 | Ga0316578_10118904 | 3300031728 | Bacteria | 1588 |
| 397 | Ga0307405_10040288 | 3300031731 | Bacteria | 2828 |
| 398 | Ga0307413_10117905 | 3300031824 | Bacteria | 1791 |
| 399 | Ga0307410_10042175 | 3300031852 | Bacteria | 3014 |
| 400 | Ga0307406_10002850 | 3300031901 | Bacteria | 9420 |
| 401 | Ga0307406_10088335 | 3300031901 | Bacteria | 2080 |
| 402 | Ga0307407_10004214 | 3300031903 | Bacteria | 6065 |
| 403 | Ga0307412_10000304 | 3300031911 | Bacteria | 31110 |
| 404 | Ga0307412_10022225 | 3300031911 | Bacteria | 3885 |
| 405 | Ga0307412_10035802 | 3300031911 | Bacteria | 3174 |
| 406 | Ga0307412_10196255 | 3300031911 | Bacteria | 1529 |
| 407 | Ga0307409_100004393 | 3300031995 | Bacteria | 7914 |
| 408 | Ga0307416_100007874 | 3300032002 | Bacteria | 6815 |
| 409 | Ga0307416_100080827 | 3300032002 | Bacteria | 2745 |
| 410 | Ga0307414_10003041 | 3300032004 | Bacteria | 8897 |
| 411 | Ga0307411_10021077 | 3300032005 | Bacteria | 3805 |
| 412 | Ga0307411_10026655 | 3300032005 | Bacteria | 3483 |
| 413 | Ga0307415_100026870 | 3300032126 | Bacteria | 3638 |
| 414 | Ga0307415_100058569 | 3300032126 | Bacteria | 2652 |
| 415 | Ga0316584_0047411 | 3300036712 | Bacteria | 3210 |
| 416 | Ga0316584_0071411 | 3300036712 | Bacteria | 2601 |
| 417 | Ga0395899_0006918 | 3300037312 | Bacteria | 8785 |
| 418 | Ga0395900_0228996 | 3300037418 | Bacteria | 1870 |
| 419 | Ga0395905_0235788 | 3300037471 | Bacteria | 1710 |
| 420 | Ga0436364_0543931 | 3300037853 | Bacteria | 2874 |
| 421 | Ga0237819_00282 | 3300038705 | Bacteria | 18645 |
| 422 | Ga0436365_0687780 | 3300039437 | Bacteria | 92990 |
| 423 | Ga0436365_1127686 | 3300039437 | Bacteria | 20335 |
| 424 | Ga0436361_0375914 | 3300039447 | Bacteria | 18209 |
| 425 | Ga0436363_0926748 | 3300039450 | Bacteria | 4186 |
| 426 | Ga0436362_0451893 | 3300039453 | Bacteria | 163419 |
| 427 | Ga0439461_0000108 | 3300041410 | Bacteria | 10970 |
| 428 | Ga0439431_0001890 | 3300041997 | Bacteria | 4646 |
| 429 | Ga0439431_0018299 | 3300041997 | Bacteria | 1656 |
| 430 | Ga0439445_0000054 | 3300042004 | Bacteria | 16765 |
| 431 | Ga0439432_025810 | 3300042006 | Bacteria | 1925 |
| 432 | Ga0439452_011683 | 3300042010 | Bacteria | 2516 |
| 433 | Ga0439462_0002567 | 3300042015 | Bacteria | 4237 |
| 434 | Ga0439458_0000273 | 3300042157 | Bacteria | 12703 |
| 435 | Ga0439458_0003781 | 3300042157 | Bacteria | 3503 |
| 436 | Ga0439458_0010727 | 3300042157 | Bacteria | 2045 |
| 437 | Ga0466972_0011708 | 3300044658 | Bacteria | 4404 |
| 438 | Ga0466964_0008643 | 3300044706 | Bacteria | 3829 |
| 439 | Ga0466971_0057643 | 3300044719 | Bacteria | 1752 |
| 440 | Ga0466968_0010087 | 3300044735 | Bacteria | 3651 |
| 441 | Ga0466960_0020079 | 3300044901 | Bacteria | 2954 |
| 442 | Ga0466959_0107453 | 3300045049 | Bacteria | 1994 |
| 443 | Ga0466958_0026324 | 3300045836 | Bacteria | 3437 |
| 444 | Ga0466967_0120728 | 3300045976 | Bacteria | 2421 |
| 445 | Ga0495638_0000018 | 3300046460 | Bacteria | 389696 |
| 446 | Ga0495638_0000048 | 3300046460 | Bacteria | 209787 |
| 447 | Ga0495650_0000983 | 3300046471 | Bacteria | 32562 |
| 448 | Ga0495650_0001327 | 3300046471 | Bacteria | 24827 |
| 449 | Ga0495585_0021281 | 3300046492 | Bacteria | 3725 |
| 450 | Ga0495583_0000033 | 3300046506 | Bacteria | 246882 |
| 451 | Ga0495583_0003712 | 3300046506 | Bacteria | 11355 |
| 452 | Ga0495583_0009207 | 3300046506 | Bacteria | 5926 |
| 453 | Ga0495606_0000390 | 3300046507 | Bacteria | 74253 |
| 454 | Ga0495606_0001880 | 3300046507 | Bacteria | 26312 |
| 455 | Ga0495616_0098622 | 3300046513 | Bacteria | 1373 |
| 456 | Ga0495631_0020539 | 3300046518 | Bacteria | 3085 |
| 457 | Ga0495632_0003057 | 3300046519 | Bacteria | 12168 |
| 458 | Ga0495643_0002704 | 3300046522 | Bacteria | 13657 |
| 459 | Ga0495643_0003269 | 3300046522 | Bacteria | 11994 |
| 460 | Ga0495643_0099436 | 3300046522 | Bacteria | 1492 |
| 461 | Ga0495648_0000018 | 3300046524 | Bacteria | 282490 |
| 462 | Ga0495648_0001493 | 3300046524 | Bacteria | 22886 |
| 463 | Ga0495648_0100081 | 3300046524 | Bacteria | 1602 |
| 464 | Ga0495648_0115237 | 3300046524 | Bacteria | 1454 |
| 465 | Ga0495663_0003941 | 3300046525 | Bacteria | 4228 |
| 466 | Ga0495642_0003589 | 3300046528 | Bacteria | 6102 |
| 467 | Ga0495633_0004188 | 3300046558 | Bacteria | 9257 |
| 468 | Ga0495633_0064781 | 3300046558 | Bacteria | 1708 |
| 469 | Ga0495668_0000059 | 3300046616 | Bacteria | 194951 |
| 470 | Ga0495611_0055865 | 3300046648 | Bacteria | 1787 |
| 471 | Ga0495625_0001633 | 3300046660 | Bacteria | 26389 |
| 472 | Ga0495625_0004059 | 3300046660 | Bacteria | 13990 |
| 473 | Ga0495625_0038326 | 3300046660 | Bacteria | 3510 |
| 474 | Ga0495625_0040489 | 3300046660 | Bacteria | 3397 |
| 475 | Ga0495625_0047960 | 3300046660 | Bacteria | 3078 |
| 476 | Ga0495670_0060090 | 3300046691 | Bacteria | 1909 |
| 477 | Ga0495671_0000011 | 3300046692 | Bacteria | 365582 |
| 478 | Ga0495671_0024998 | 3300046692 | Bacteria | 3107 |
| 479 | Ga0495660_0072848 | 3300046810 | Bacteria | 1818 |
| 480 | Ga0495677_0004297 | 3300047445 | Bacteria | 5477 |
| 481 | Ga0495673_0000013 | 3300047469 | Bacteria | 612902 |
| 482 | Ga0495673_0032390 | 3300047469 | Bacteria | 2438 |
| 483 | Ga0495673_0043128 | 3300047469 | Bacteria | 2021 |
| 484 | Ga0495681_0007069 | 3300047470 | Bacteria | 7246 |
| 485 | Ga0495686_0000053 | 3300047472 | Bacteria | 259537 |
| 486 | Ga0495686_0000141 | 3300047472 | Bacteria | 144510 |
| 487 | Ga0495686_0000511 | 3300047472 | Bacteria | 56027 |
| 488 | Ga0495686_0012386 | 3300047472 | Bacteria | 5966 |
| 489 | Ga0495686_0075609 | 3300047472 | Bacteria | 2065 |
| 490 | Ga0496100_0074923 | 3300048903 | Bacteria | 2268 |
| 491 | Ga0496102_0000100 | 3300048905 | Bacteria | 123531 |
| 492 | Ga0496102_0000184 | 3300048905 | Bacteria | 84568 |
| 493 | Ga0496102_0056923 | 3300048905 | Bacteria | 3568 |
| 494 | Ga0496103_0000070 | 3300048906 | Bacteria | 121077 |
| 495 | Ga0496103_0000099 | 3300048906 | Bacteria | 94046 |
| 496 | Ga0496103_0039775 | 3300048906 | Bacteria | 2890 |
| 497 | Ga0496103_0096817 | 3300048906 | Bacteria | 1865 |
| 498 | Ga0496104_0019640 | 3300048907 | Bacteria | 6186 |
| 499 | Ga0496104_0166271 | 3300048907 | Bacteria | 2116 |
| 500 | Ga0496105_0001784 | 3300048908 | Bacteria | 15381 |
| 501 | Ga0496106_0000966 | 3300048909 | Bacteria | 20956 |
| 502 | Ga0496108_0002667 | 3300048911 | Bacteria | 14298 |
| 503 | Ga0496108_0017063 | 3300048911 | Bacteria | 5935 |
| 504 | Ga0496108_0062901 | 3300048911 | Bacteria | 3125 |
| 505 | Ga0496109_0075293 | 3300048912 | Bacteria | 3103 |
| 506 | Ga0496110_0013168 | 3300048913 | Bacteria | 6830 |
| 507 | Ga0496110_0063604 | 3300048913 | Bacteria | 3260 |
| 508 | Ga0496110_0131343 | 3300048913 | Bacteria | 2261 |
| 509 | Ga0496113_0001111 | 3300048916 | Bacteria | 14597 |
| 510 | Ga0496113_0158823 | 3300048916 | Bacteria | 1786 |
| 511 | Ga0496115_0000066 | 3300048918 | Bacteria | 95550 |
| 512 | Ga0496116_0002164 | 3300048919 | Bacteria | 20928 |
| 513 | Ga0496116_0002579 | 3300048919 | Bacteria | 18871 |
| 514 | Ga0496117_0000194 | 3300048920 | Bacteria | 123531 |
| 515 | Ga0496117_0000744 | 3300048920 | Bacteria | 51303 |
| 516 | Ga0496117_0006172 | 3300048920 | Bacteria | 12244 |
| 517 | Ga0496117_0025842 | 3300048920 | Bacteria | 4604 |
| 518 | Ga0496118_0000146 | 3300048921 | Bacteria | 123531 |
| 519 | Ga0496118_0000434 | 3300048921 | Bacteria | 69469 |
| 520 | Ga0496118_0000852 | 3300048921 | Bacteria | 48454 |
| 521 | Ga0496118_0004543 | 3300048921 | Bacteria | 16370 |
| 522 | Ga0496118_0066084 | 3300048921 | Bacteria | 2641 |
| 523 | Ga0496120_0017808 | 3300048923 | Bacteria | 4592 |
| 524 | Ga0496120_0020134 | 3300048923 | Bacteria | 4249 |
| 525 | Ga0496121_0000417 | 3300048924 | Bacteria | 84424 |
| 526 | Ga0496121_0000670 | 3300048924 | Bacteria | 63957 |
| 527 | Ga0496121_0001202 | 3300048924 | Bacteria | 45329 |
| 528 | Ga0496121_0001743 | 3300048924 | Bacteria | 35549 |
| 529 | Ga0496121_0008548 | 3300048924 | Bacteria | 12008 |
| 530 | Ga0496121_0017936 | 3300048924 | Bacteria | 7179 |
| 531 | Ga0496121_0112500 | 3300048924 | Bacteria | 2074 |
| 532 | Ga0496121_0140707 | 3300048924 | Bacteria | 1791 |
| 533 | Ga0496122_0000221 | 3300048925 | Bacteria | 127004 |
| 534 | Ga0496122_0000627 | 3300048925 | Bacteria | 72195 |
| 535 | Ga0496122_0021049 | 3300048925 | Bacteria | 5858 |
| 536 | Ga0496123_0000833 | 3300048926 | Bacteria | 49467 |
| 537 | Ga0496123_0000962 | 3300048926 | Bacteria | 44465 |
| 538 | Ga0496123_0006477 | 3300048926 | Bacteria | 11332 |
| 539 | Ga0496123_0012929 | 3300048926 | Bacteria | 7060 |
| 540 | Ga0496123_0031843 | 3300048926 | Bacteria | 3828 |
| 541 | Ga0496123_0124820 | 3300048926 | Bacteria | 1439 |
| 542 | Ga0496124_0000185 | 3300048927 | Bacteria | 123531 |
| 543 | Ga0496124_0000291 | 3300048927 | Bacteria | 94493 |
| 544 | Ga0496124_0000648 | 3300048927 | Bacteria | 57426 |
| 545 | Ga0496124_0001629 | 3300048927 | Bacteria | 32187 |
| 546 | Ga0496124_0015374 | 3300048927 | Bacteria | 7339 |
| 547 | Ga0496124_0022364 | 3300048927 | Bacteria | 5797 |
| 548 | Ga0496124_0023699 | 3300048927 | Bacteria | 5597 |
| 549 | Ga0496125_0000687 | 3300048928 | Bacteria | 56251 |
| 550 | Ga0496125_0036267 | 3300048928 | Bacteria | 4309 |
| 551 | Ga0496125_0079580 | 3300048928 | Bacteria | 2514 |
| 552 | Ga0496126_0003758 | 3300048929 | Bacteria | 18877 |
| 553 | Ga0496126_0011152 | 3300048929 | Bacteria | 9330 |
| 554 | Ga0496126_0012541 | 3300048929 | Bacteria | 8676 |
| 555 | Ga0496126_0126083 | 3300048929 | Bacteria | 2216 |
| 556 | Ga0501034_0005895 | 3300049571 | Bacteria | 13302 |
| 557 | Ga0501038_0205059 | 3300049574 | Bacteria | 1580 |
| 558 | Ga0501041_0082488 | 3300049577 | Bacteria | 1981 |
| 559 | Ga0501069_0060448 | 3300049585 | Bacteria | 2115 |
| 560 | Ga0501070_0079042 | 3300049586 | Bacteria | 2722 |
| 561 | Ga0501223_000010 | 3300049663 | Bacteria | 106901 |
| 562 | Ga0501235_004353 | 3300049669 | Bacteria | 3064 |
| 563 | Ga0501225_0000008 | 3300049705 | Bacteria | 95521 |
| 564 | Ga0501225_0000376 | 3300049705 | Bacteria | 14073 |
| 565 | Ga0501225_0004562 | 3300049705 | Bacteria | 4120 |
| 566 | Ga0501081_0102784 | 3300049743 | Bacteria | 2022 |
| 567 | Ga0501279_000182 | 3300049775 | Bacteria | 8660 |
| 568 | Ga0501281_00290 | 3300049777 | Bacteria | 5187 |
| 569 | Ga0501282_000324 | 3300049778 | Bacteria | 5782 |
| 570 | Ga0501044_0375811 | 3300049823 | Bacteria | 1337 |
| 571 | nmdc:mga0k408_73827_c1 | 3300050493 | Bacteria | 1992 |
| 572 | nmdc:mga06z11_52_c1 | 3300050494 | Bacteria | 49109 |
| 573 | nmdc:mga04h51_570_c1 | 3300050495 | Bacteria | 8813 |
| 574 | nmdc:mga0n895_77889_c1 | 3300050512 | Bacteria | 3298 |
| 575 | Ga0500643_000050 | 3300053087 | Bacteria | 147005 |
| 576 | Ga0500643_001263 | 3300053087 | Bacteria | 14950 |
| 577 | Ga0500566_0074947 | 3300053094 | Bacteria | 1894 |
| 578 | Ga0500555_000742 | 3300053103 | Bacteria | 12026 |
| 579 | Ga0500556_0000027 | 3300053104 | Bacteria | 165855 |
| 580 | Ga0500595_000911 | 3300053119 | Bacteria | 16842 |
| 581 | Ga0500595_005158 | 3300053119 | Bacteria | 5734 |
| 582 | Ga0500642_0000003 | 3300053130 | Bacteria | 544899 |
| 583 | Ga0500642_0000238 | 3300053130 | Bacteria | 21313 |
| 584 | Ga0500658_0009654 | 3300053134 | Bacteria | 3559 |
| 585 | Ga0500573_0000093 | 3300053140 | Bacteria | 40260 |
| 586 | Ga0500573_0092793 | 3300053140 | Bacteria | 1704 |
| 587 | Ga0500616_0007950 | 3300053153 | Bacteria | 6660 |
| 588 | Ga0500624_000009 | 3300053157 | Bacteria | 178763 |
| 589 | Ga0500624_000120 | 3300053157 | Bacteria | 35695 |
| 590 | Ga0500636_0014724 | 3300053177 | Bacteria | 4602 |
| 591 | Ga0500637_0000076 | 3300053178 | Bacteria | 35528 |
| 592 | Ga0500645_000586 | 3300053730 | Bacteria | 23516 |
| 593 | Ga0500601_001769 | 3300053737 | Bacteria | 2324 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053737 | Ga0500601_001769 | Ga0500601_001769_13_942 | 300 |
| 2 | 3300003203 | JGI25406J46586_10005157 | JGI25406J46586_100051574 | 320 |
| 3 | 3300005985 | Ga0081539_10000086 | Ga0081539_10000086113 | 320 |
| 4 | 3300005295 | Ga0065707_10104178 | Ga0065707_101041783 | 324 |
| 5 | 3300005563 | Ga0068855_100275595 | Ga0068855_1002755953 | 326 |
| 6 | 3300025949 | Ga0207667_10215428 | Ga0207667_102154283 | 326 |
| 7 | 3300046522 | Ga0495643_0002704 | Ga0495643_0002704_9037_10158 | 327 |
| 8 | 3300046507 | Ga0495606_0000390 | Ga0495606_0000390_65755_66876 | 328 |
| 9 | 3300046522 | Ga0495643_0099436 | Ga0495643_0099436_339_1460 | 328 |
| 10 | 3300046616 | Ga0495668_0000059 | Ga0495668_0000059_96612_97733 | 328 |
| 11 | 3300046692 | Ga0495671_0024998 | Ga0495671_0024998_857_1978 | 328 |
| 12 | 3300053130 | Ga0500642_0000238 | Ga0500642_0000238_774_1895 | 328 |
| 13 | 3300025290 | Ga0207673_1002390 | Ga0207673_10023903 | 330 |
| 14 | 3300053087 | Ga0500643_000050 | Ga0500643_000050_66101_67228 | 330 |
| 15 | 3300005458 | Ga0070681_10069878 | Ga0070681_100698783 | 331 |
| 16 | 3300025912 | Ga0207707_10094305 | Ga0207707_100943052 | 331 |
| 17 | 3300025921 | Ga0207652_10074044 | Ga0207652_100740444 | 331 |
| 18 | 3300048925 | Ga0496122_0021049 | Ga0496122_0021049_1918_3036 | 334 |
| 19 | 3300049669 | Ga0501235_004353 | Ga0501235_004353_52_1170 | 334 |
| 20 | 3300005331 | Ga0070670_100079517 | Ga0070670_1000795171 | 335 |
| 21 | 3300009148 | Ga0105243_10003479 | Ga0105243_1000347914 | 335 |
| 22 | 3300025925 | Ga0207650_10151670 | Ga0207650_101516701 | 335 |
| 23 | 3300025935 | Ga0207709_10000005 | Ga0207709_10000005629 | 335 |
| 24 | 3300003791 | Ga0055530_10000114 | Ga0055530_1000011439 | 336 |
| 25 | 3300003794 | Ga0055531_10000095 | Ga0055531_1000009535 | 336 |
| 26 | 3300025298 | Ga0209050_1000051 | Ga0209050_100005135 | 336 |
| 27 | 3300025304 | Ga0209257_1000028 | Ga0209257_1000028333 | 336 |
| 28 | 3300049663 | Ga0501223_000010 | Ga0501223_000010_92355_93479 | 336 |
| 29 | 3300049705 | Ga0501225_0000008 | Ga0501225_0000008_80707_81831 | 336 |
| 30 | 3300005335 | Ga0070666_10009675 | Ga0070666_100096755 | 337 |
| 31 | 3300005347 | Ga0070668_100000993 | Ga0070668_10000099311 | 337 |
| 32 | 3300005367 | Ga0070667_100000199 | Ga0070667_10000019948 | 337 |
| 33 | 3300005841 | Ga0068863_100000029 | Ga0068863_10000002922 | 337 |
| 34 | 3300005843 | Ga0068860_100002353 | Ga0068860_10000235312 | 337 |
| 35 | 3300025903 | Ga0207680_10002112 | Ga0207680_100021127 | 337 |
| 36 | 3300025972 | Ga0207668_10000313 | Ga0207668_1000031310 | 337 |
| 37 | 3300025986 | Ga0207658_10000159 | Ga0207658_1000015949 | 337 |
| 38 | 3300026088 | Ga0207641_10000049 | Ga0207641_1000004922 | 337 |
| 39 | 3300028381 | Ga0268264_10001925 | Ga0268264_100019257 | 337 |
| 40 | 3300046471 | Ga0495650_0001327 | Ga0495650_0001327_22672_23790 | 337 |
| 41 | 3300048924 | Ga0496121_0112500 | Ga0496121_0112500_185_1303 | 337 |
| 42 | 3300031824 | Ga0307413_10117905 | Ga0307413_101179052 | 338 |
| 43 | 3300049705 | Ga0501225_0004562 | Ga0501225_0004562_75_1202 | 338 |
| 44 | 3300049775 | Ga0501279_000182 | Ga0501279_000182_5490_6617 | 338 |
| 45 | 3300049777 | Ga0501281_00290 | Ga0501281_00290_1233_2360 | 338 |
| 46 | 3300049778 | Ga0501282_000324 | Ga0501282_000324_1756_2883 | 338 |
| 47 | 3300001990 | JGI24737J22298_10002013 | JGI24737J22298_100020135 | 339 |
| 48 | 3300002075 | JGI24738J21930_10001894 | JGI24738J21930_100018946 | 339 |
| 49 | 3300013307 | Ga0157372_10268487 | Ga0157372_102684873 | 339 |
| 50 | 3300025904 | Ga0207647_10003181 | Ga0207647_100031812 | 339 |
| 51 | 3300047469 | Ga0495673_0032390 | Ga0495673_0032390_467_1591 | 339 |
| 52 | 3300048925 | Ga0496122_0000627 | Ga0496122_0000627_50562_51689 | 339 |
| 53 | 3300048926 | Ga0496123_0000962 | Ga0496123_0000962_17709_18836 | 339 |
| 54 | 3300048927 | Ga0496124_0001629 | Ga0496124_0001629_11887_13014 | 339 |
| 55 | 3300053119 | Ga0500595_000911 | Ga0500595_000911_13503_14624 | 339 |
| 56 | 3300005347 | Ga0070668_100016156 | Ga0070668_1000161563 | 340 |
| 57 | 3300009011 | Ga0105251_10003664 | Ga0105251_100036646 | 340 |
| 58 | 3300025735 | Ga0207713_1023180 | Ga0207713_10231803 | 340 |
| 59 | 3300025972 | Ga0207668_10016024 | Ga0207668_100160243 | 340 |
| 60 | 3300032004 | Ga0307414_10003041 | Ga0307414_100030417 | 340 |
| 61 | 3300047472 | Ga0495686_0000141 | Ga0495686_0000141_87084_88211 | 340 |
| 62 | 3300048913 | Ga0496110_0131343 | Ga0496110_0131343_984_2102 | 340 |
| 63 | 3300048926 | Ga0496123_0124820 | Ga0496123_0124820_135_1253 | 340 |
| 64 | 3300048927 | Ga0496124_0022364 | Ga0496124_0022364_700_1818 | 340 |
| 65 | 3300048928 | Ga0496125_0079580 | Ga0496125_0079580_1144_2265 | 340 |
| 66 | 3300053157 | Ga0500624_000120 | Ga0500624_000120_1766_2887 | 340 |
| 67 | 3300053178 | Ga0500637_0000076 | Ga0500637_0000076_32566_33687 | 340 |
| 68 | 3300005289 | Ga0065704_10002877 | Ga0065704_100028773 | 341 |
| 69 | 3300005295 | Ga0065707_10102066 | Ga0065707_101020663 | 341 |
| 70 | 3300005353 | Ga0070669_100000001 | Ga0070669_100000001534 | 341 |
| 71 | 3300005353 | Ga0070669_100089640 | Ga0070669_1000896402 | 341 |
| 72 | 3300005844 | Ga0068862_100001039 | Ga0068862_10000103911 | 341 |
| 73 | 3300009553 | Ga0105249_10013461 | Ga0105249_100134618 | 341 |
| 74 | 3300009978 | Ga0105148_100043 | Ga0105148_1000438 | 341 |
| 75 | 3300025315 | Ga0207697_10001981 | Ga0207697_100019818 | 341 |
| 76 | 3300025923 | Ga0207681_10000002 | Ga0207681_10000002469 | 341 |
| 77 | 3300025923 | Ga0207681_10081881 | Ga0207681_100818812 | 341 |
| 78 | 3300025981 | Ga0207640_10016378 | Ga0207640_100163785 | 341 |
| 79 | 3300028380 | Ga0268265_10000116 | Ga0268265_1000011636 | 341 |
| 80 | 3300044735 | Ga0466968_0010087 | Ga0466968_0010087_1776_2903 | 341 |
| 81 | 3300048924 | Ga0496121_0008548 | Ga0496121_0008548_7711_8838 | 341 |
| 82 | 3300049705 | Ga0501225_0000376 | Ga0501225_0000376_7895_9019 | 341 |
| 83 | 3300002459 | JGI24751J29686_10008002 | JGI24751J29686_100080023 | 342 |
| 84 | 3300005331 | Ga0070670_100017442 | Ga0070670_1000174423 | 342 |
| 85 | 3300005335 | Ga0070666_10000182 | Ga0070666_1000018238 | 342 |
| 86 | 3300005355 | Ga0070671_100000002 | Ga0070671_10000000281 | 342 |
| 87 | 3300005367 | Ga0070667_100021538 | Ga0070667_1000215385 | 342 |
| 88 | 3300005617 | Ga0068859_100031297 | Ga0068859_1000312975 | 342 |
| 89 | 3300005618 | Ga0068864_100000800 | Ga0068864_10000080013 | 342 |
| 90 | 3300005841 | Ga0068863_100008204 | Ga0068863_1000082045 | 342 |
| 91 | 3300005842 | Ga0068858_100004242 | Ga0068858_1000042429 | 342 |
| 92 | 3300005843 | Ga0068860_100009823 | Ga0068860_1000098235 | 342 |
| 93 | 3300006042 | Ga0075368_10006435 | Ga0075368_100064353 | 342 |
| 94 | 3300006931 | Ga0097620_100031299 | Ga0097620_1000312995 | 342 |
| 95 | 3300009101 | Ga0105247_10002228 | Ga0105247_100022288 | 342 |
| 96 | 3300009545 | Ga0105237_10009789 | Ga0105237_100097893 | 342 |
| 97 | 3300010375 | Ga0105239_10000073 | Ga0105239_10000073110 | 342 |
| 98 | 3300013306 | Ga0163162_10014804 | Ga0163162_100148043 | 342 |
| 99 | 3300014968 | Ga0157379_10033264 | Ga0157379_100332643 | 342 |
| 100 | 3300025900 | Ga0207710_10005939 | Ga0207710_100059395 | 342 |
| 101 | 3300025903 | Ga0207680_10000033 | Ga0207680_1000003355 | 342 |
| 102 | 3300025913 | Ga0207695_10074360 | Ga0207695_100743604 | 342 |
| 103 | 3300025914 | Ga0207671_10020727 | Ga0207671_100207272 | 342 |
| 104 | 3300025925 | Ga0207650_10008717 | Ga0207650_100087178 | 342 |
| 105 | 3300025931 | Ga0207644_10000002 | Ga0207644_10000002473 | 342 |
| 106 | 3300025941 | Ga0207711_10057663 | Ga0207711_100576633 | 342 |
| 107 | 3300025961 | Ga0207712_10005757 | Ga0207712_100057578 | 342 |
| 108 | 3300025972 | Ga0207668_10001089 | Ga0207668_100010895 | 342 |
| 109 | 3300025986 | Ga0207658_10007323 | Ga0207658_100073238 | 342 |
| 110 | 3300026035 | Ga0207703_10003103 | Ga0207703_1000310312 | 342 |
| 111 | 3300026088 | Ga0207641_10014692 | Ga0207641_100146928 | 342 |
| 112 | 3300027866 | Ga0209813_10000095 | Ga0209813_100000956 | 342 |
| 113 | 3300028381 | Ga0268264_10000116 | Ga0268264_1000011685 | 342 |
| 114 | 3300030522 | Ga0307512_10004811 | Ga0307512_1000481114 | 342 |
| 115 | 3300046507 | Ga0495606_0001880 | Ga0495606_0001880_1130_2257 | 342 |
| 116 | 3300048924 | Ga0496121_0001743 | Ga0496121_0001743_11500_12627 | 342 |
| 117 | 3300048929 | Ga0496126_0012541 | Ga0496126_0012541_5612_6739 | 342 |
| 118 | 3300050494 | nmdc:mga06z11_52_c1 | nmdc:mga06z11_52_c1_47484_48605 | 342 |
| 119 | 3300050495 | nmdc:mga04h51_570_c1 | nmdc:mga04h51_570_c1_2658_3779 | 342 |
| 120 | 3300009093 | Ga0105240_10014804 | Ga0105240_100148048 | 343 |
| 121 | 3300025913 | Ga0207695_10153503 | Ga0207695_101535033 | 343 |
| 122 | 3300005331 | Ga0070670_100154909 | Ga0070670_1001549093 | 344 |
| 123 | 3300005347 | Ga0070668_100000034 | Ga0070668_10000003489 | 344 |
| 124 | 3300005355 | Ga0070671_100000160 | Ga0070671_10000016022 | 344 |
| 125 | 3300005539 | Ga0068853_100017380 | Ga0068853_1000173805 | 344 |
| 126 | 3300005548 | Ga0070665_100340257 | Ga0070665_1003402572 | 344 |
| 127 | 3300005563 | Ga0068855_100000377 | Ga0068855_10000037747 | 344 |
| 128 | 3300005616 | Ga0068852_100065135 | Ga0068852_1000651353 | 344 |
| 129 | 3300005617 | Ga0068859_100026537 | Ga0068859_1000265376 | 344 |
| 130 | 3300005841 | Ga0068863_100000020 | Ga0068863_100000020142 | 344 |
| 131 | 3300005844 | Ga0068862_100013247 | Ga0068862_1000132474 | 344 |
| 132 | 3300006931 | Ga0097620_100026537 | Ga0097620_1000265376 | 344 |
| 133 | 3300009093 | Ga0105240_10003584 | Ga0105240_100035843 | 344 |
| 134 | 3300009553 | Ga0105249_10129125 | Ga0105249_101291253 | 344 |
| 135 | 3300025913 | Ga0207695_10152157 | Ga0207695_101521573 | 344 |
| 136 | 3300025925 | Ga0207650_10068305 | Ga0207650_100683053 | 344 |
| 137 | 3300025931 | Ga0207644_10000097 | Ga0207644_100000979 | 344 |
| 138 | 3300025949 | Ga0207667_10000537 | Ga0207667_100005373 | 344 |
| 139 | 3300025961 | Ga0207712_10077330 | Ga0207712_100773303 | 344 |
| 140 | 3300025972 | Ga0207668_10000364 | Ga0207668_100003649 | 344 |
| 141 | 3300026041 | Ga0207639_10000449 | Ga0207639_1000044910 | 344 |
| 142 | 3300026088 | Ga0207641_10000001 | Ga0207641_100000011091 | 344 |
| 143 | 3300028379 | Ga0268266_10102933 | Ga0268266_101029332 | 344 |
| 144 | 3300028381 | Ga0268264_10040016 | Ga0268264_100400163 | 344 |
| 145 | 3300039450 | Ga0436363_0926748 | Ga0436363_0926748_1913_3040 | 344 |
| 146 | 3300042157 | Ga0439458_0000273 | Ga0439458_0000273_657_1784 | 344 |
| 147 | 3300048923 | Ga0496120_0017808 | Ga0496120_0017808_2025_3152 | 344 |
| 148 | 3300001989 | JGI24739J22299_10012378 | JGI24739J22299_100123783 | 345 |
| 149 | 3300001990 | JGI24737J22298_10026128 | JGI24737J22298_100261283 | 345 |
| 150 | 3300002067 | JGI24735J21928_10013206 | JGI24735J21928_100132063 | 345 |
| 151 | 3300005262 | Ga0065165_1004241 | Ga0065165_10042416 | 345 |
| 152 | 3300005333 | Ga0070677_10002044 | Ga0070677_100020444 | 345 |
| 153 | 3300005457 | Ga0070662_100027437 | Ga0070662_1000274374 | 345 |
| 154 | 3300006353 | Ga0075370_10074767 | Ga0075370_100747672 | 345 |
| 155 | 3300013105 | Ga0157369_10240649 | Ga0157369_102406492 | 345 |
| 156 | 3300025904 | Ga0207647_10000812 | Ga0207647_100008123 | 345 |
| 157 | 3300042157 | Ga0439458_0003781 | Ga0439458_0003781_1384_2511 | 345 |
| 158 | 3300048927 | Ga0496124_0015374 | Ga0496124_0015374_2580_3716 | 345 |
| 159 | 3300049586 | Ga0501070_0079042 | Ga0501070_0079042_1128_2273 | 345 |
| 160 | 3300053119 | Ga0500595_005158 | Ga0500595_005158_823_1944 | 345 |
| 161 | 3300005327 | Ga0070658_10000055 | Ga0070658_1000005570 | 346 |
| 162 | 3300025909 | Ga0207705_10000139 | Ga0207705_1000013971 | 346 |
| 163 | 3300037471 | Ga0395905_0235788 | Ga0395905_0235788_32_1150 | 346 |
| 164 | 3300048905 | Ga0496102_0056923 | Ga0496102_0056923_1640_2764 | 346 |
| 165 | 3300048911 | Ga0496108_0062901 | Ga0496108_0062901_1744_2868 | 346 |
| 166 | 3300049571 | Ga0501034_0005895 | Ga0501034_0005895_10609_11730 | 346 |
| 167 | 3300005719 | Ga0068861_100025770 | Ga0068861_1000257703 | 347 |
| 168 | 3300026118 | Ga0207675_100002616 | Ga0207675_10000261613 | 347 |
| 169 | 3300031548 | Ga0307408_100009178 | Ga0307408_1000091783 | 347 |
| 170 | 3300005331 | Ga0070670_100000249 | Ga0070670_10000024943 | 348 |
| 171 | 3300005336 | Ga0070680_100000431 | Ga0070680_1000004313 | 348 |
| 172 | 3300005367 | Ga0070667_100000570 | Ga0070667_10000057027 | 348 |
| 173 | 3300005530 | Ga0070679_100000002 | Ga0070679_100000002198 | 348 |
| 174 | 3300005618 | Ga0068864_100000004 | Ga0068864_100000004492 | 348 |
| 175 | 3300005841 | Ga0068863_100000002 | Ga0068863_100000002493 | 348 |
| 176 | 3300005844 | Ga0068862_100000002 | Ga0068862_1000000029 | 348 |
| 177 | 3300009011 | Ga0105251_10000988 | Ga0105251_100009885 | 348 |
| 178 | 3300009101 | Ga0105247_10028527 | Ga0105247_100285272 | 348 |
| 179 | 3300009177 | Ga0105248_10000016 | Ga0105248_10000016240 | 348 |
| 180 | 3300009553 | Ga0105249_10000106 | Ga0105249_10000106120 | 348 |
| 181 | 3300025900 | Ga0207710_10020750 | Ga0207710_100207502 | 348 |
| 182 | 3300025917 | Ga0207660_10003819 | Ga0207660_100038198 | 348 |
| 183 | 3300025921 | Ga0207652_10000001 | Ga0207652_10000001294 | 348 |
| 184 | 3300025921 | Ga0207652_10000002 | Ga0207652_10000002434 | 348 |
| 185 | 3300025925 | Ga0207650_10000980 | Ga0207650_1000098014 | 348 |
| 186 | 3300025941 | Ga0207711_10000022 | Ga0207711_10000022237 | 348 |
| 187 | 3300025961 | Ga0207712_10000593 | Ga0207712_1000059327 | 348 |
| 188 | 3300025986 | Ga0207658_10000411 | Ga0207658_1000041127 | 348 |
| 189 | 3300026088 | Ga0207641_10000002 | Ga0207641_10000002972 | 348 |
| 190 | 3300026095 | Ga0207676_10000040 | Ga0207676_10000040166 | 348 |
| 191 | 3300028380 | Ga0268265_10000003 | Ga0268265_1000000318 | 348 |
| 192 | 3300031548 | Ga0307408_100111664 | Ga0307408_1001116643 | 348 |
| 193 | 3300031731 | Ga0307405_10040288 | Ga0307405_100402883 | 348 |
| 194 | 3300032005 | Ga0307411_10021077 | Ga0307411_100210772 | 348 |
| 195 | 3300042157 | Ga0439458_0010727 | Ga0439458_0010727_690_1811 | 348 |
| 196 | 3300048906 | Ga0496103_0096817 | Ga0496103_0096817_250_1377 | 348 |
| 197 | 3300046660 | Ga0495625_0004059 | Ga0495625_0004059_12771_13892 | 349 |
| 198 | 3300005459 | Ga0068867_100052229 | Ga0068867_1000522293 | 350 |
| 199 | 3300005548 | Ga0070665_100000972 | Ga0070665_10000097227 | 350 |
| 200 | 3300025937 | Ga0207669_10000946 | Ga0207669_1000094612 | 350 |
| 201 | 3300026121 | Ga0207683_10001115 | Ga0207683_1000111519 | 350 |
| 202 | 3300028786 | Ga0307517_10024225 | Ga0307517_1002422512 | 350 |
| 203 | 3300046492 | Ga0495585_0021281 | Ga0495585_0021281_2244_3377 | 350 |
| 204 | 3300046506 | Ga0495583_0009207 | Ga0495583_0009207_1535_2656 | 350 |
| 205 | 3300046518 | Ga0495631_0020539 | Ga0495631_0020539_1563_2684 | 350 |
| 206 | 3300046524 | Ga0495648_0100081 | Ga0495648_0100081_42_1163 | 350 |
| 207 | 3300046558 | Ga0495633_0004188 | Ga0495633_0004188_3054_4175 | 350 |
| 208 | 3300046558 | Ga0495633_0064781 | Ga0495633_0064781_39_1160 | 350 |
| 209 | 3300046810 | Ga0495660_0072848 | Ga0495660_0072848_103_1224 | 350 |
| 210 | 3300047472 | Ga0495686_0000511 | Ga0495686_0000511_42708_43829 | 350 |
| 211 | 3300048924 | Ga0496121_0001202 | Ga0496121_0001202_16176_17297 | 350 |
| 212 | 3300048925 | Ga0496122_0000221 | Ga0496122_0000221_33164_34291 | 350 |
| 213 | 3300048926 | Ga0496123_0000833 | Ga0496123_0000833_46673_47800 | 350 |
| 214 | 3300053087 | Ga0500643_001263 | Ga0500643_001263_11791_12918 | 350 |
| 215 | 3300053094 | Ga0500566_0074947 | Ga0500566_0074947_660_1787 | 350 |
| 216 | 3300053177 | Ga0500636_0014724 | Ga0500636_0014724_1683_2804 | 350 |
| 217 | 3300005340 | Ga0070689_100186052 | Ga0070689_1001860522 | 351 |
| 218 | 3300005353 | Ga0070669_100000317 | Ga0070669_10000031731 | 351 |
| 219 | 3300005366 | Ga0070659_100000011 | Ga0070659_10000001199 | 351 |
| 220 | 3300005366 | Ga0070659_100111127 | Ga0070659_1001111272 | 351 |
| 221 | 3300005367 | Ga0070667_100035498 | Ga0070667_1000354982 | 351 |
| 222 | 3300005544 | Ga0070686_100000284 | Ga0070686_10000028423 | 351 |
| 223 | 3300005548 | Ga0070665_100017966 | Ga0070665_1000179662 | 351 |
| 224 | 3300005618 | Ga0068864_100052967 | Ga0068864_1000529673 | 351 |
| 225 | 3300017792 | Ga0163161_10039071 | Ga0163161_100390713 | 351 |
| 226 | 3300025904 | Ga0207647_10049844 | Ga0207647_100498443 | 351 |
| 227 | 3300025923 | Ga0207681_10002014 | Ga0207681_100020144 | 351 |
| 228 | 3300025925 | Ga0207650_10069769 | Ga0207650_100697693 | 351 |
| 229 | 3300025925 | Ga0207650_10074085 | Ga0207650_100740853 | 351 |
| 230 | 3300025932 | Ga0207690_10000005 | Ga0207690_10000005109 | 351 |
| 231 | 3300025936 | Ga0207670_10195026 | Ga0207670_101950262 | 351 |
| 232 | 3300025941 | Ga0207711_10048087 | Ga0207711_100480872 | 351 |
| 233 | 3300025986 | Ga0207658_10050391 | Ga0207658_100503913 | 351 |
| 234 | 3300025986 | Ga0207658_10077294 | Ga0207658_100772944 | 351 |
| 235 | 3300026095 | Ga0207676_10047729 | Ga0207676_100477293 | 351 |
| 236 | 3300028381 | Ga0268264_10041890 | Ga0268264_100418903 | 351 |
| 237 | 3300046524 | Ga0495648_0115237 | Ga0495648_0115237_233_1354 | 351 |
| 238 | 3300046525 | Ga0495663_0003941 | Ga0495663_0003941_1015_2136 | 351 |
| 239 | 3300046648 | Ga0495611_0055865 | Ga0495611_0055865_588_1715 | 351 |
| 240 | 3300046660 | Ga0495625_0040489 | Ga0495625_0040489_2253_3374 | 351 |
| 241 | 3300048903 | Ga0496100_0074923 | Ga0496100_0074923_750_1886 | 351 |
| 242 | 3300048905 | Ga0496102_0000184 | Ga0496102_0000184_32059_33180 | 351 |
| 243 | 3300048906 | Ga0496103_0000099 | Ga0496103_0000099_50721_51842 | 351 |
| 244 | 3300048907 | Ga0496104_0019640 | Ga0496104_0019640_3783_4919 | 351 |
| 245 | 3300048907 | Ga0496104_0166271 | Ga0496104_0166271_910_2031 | 351 |
| 246 | 3300048908 | Ga0496105_0001784 | Ga0496105_0001784_1931_3052 | 351 |
| 247 | 3300048909 | Ga0496106_0000966 | Ga0496106_0000966_7388_8524 | 351 |
| 248 | 3300048911 | Ga0496108_0017063 | Ga0496108_0017063_3936_5072 | 351 |
| 249 | 3300048912 | Ga0496109_0075293 | Ga0496109_0075293_525_1661 | 351 |
| 250 | 3300048913 | Ga0496110_0013168 | Ga0496110_0013168_1373_2494 | 351 |
| 251 | 3300048913 | Ga0496110_0063604 | Ga0496110_0063604_1180_2316 | 351 |
| 252 | 3300048916 | Ga0496113_0001111 | Ga0496113_0001111_928_2064 | 351 |
| 253 | 3300048916 | Ga0496113_0158823 | Ga0496113_0158823_520_1641 | 351 |
| 254 | 3300048918 | Ga0496115_0000066 | Ga0496115_0000066_42160_43281 | 351 |
| 255 | 3300048919 | Ga0496116_0002164 | Ga0496116_0002164_7820_8941 | 351 |
| 256 | 3300048920 | Ga0496117_0000744 | Ga0496117_0000744_8323_9444 | 351 |
| 257 | 3300048921 | Ga0496118_0000852 | Ga0496118_0000852_42044_43165 | 351 |
| 258 | 3300048923 | Ga0496120_0020134 | Ga0496120_0020134_1168_2289 | 351 |
| 259 | 3300048924 | Ga0496121_0000417 | Ga0496121_0000417_41967_43088 | 351 |
| 260 | 3300048926 | Ga0496123_0006477 | Ga0496123_0006477_8947_10068 | 351 |
| 261 | 3300048927 | Ga0496124_0000291 | Ga0496124_0000291_41958_43079 | 351 |
| 262 | 3300048928 | Ga0496125_0000687 | Ga0496125_0000687_12862_13983 | 351 |
| 263 | 3300048929 | Ga0496126_0003758 | Ga0496126_0003758_12394_13515 | 351 |
| 264 | 3300053140 | Ga0500573_0092793 | Ga0500573_0092793_240_1361 | 351 |
| 265 | 3300053153 | Ga0500616_0007950 | Ga0500616_0007950_3953_5080 | 351 |
| 266 | 3300005548 | Ga0070665_100000089 | Ga0070665_100000089140 | 352 |
| 267 | 3300028379 | Ga0268266_10000083 | Ga0268266_1000008335 | 352 |
| 268 | 3300031911 | Ga0307412_10035802 | Ga0307412_100358022 | 352 |
| 269 | 3300013296 | Ga0157374_10064473 | Ga0157374_100644733 | 353 |
| 270 | 3300025297 | Ga0209758_1029226 | Ga0209758_10292264 | 353 |
| 271 | 3300025940 | Ga0207691_10279725 | Ga0207691_102797252 | 353 |
| 272 | 3300037853 | Ga0436364_0543931 | Ga0436364_0543931_308_1429 | 353 |
| 273 | 3300046513 | Ga0495616_0098622 | Ga0495616_0098622_17_1138 | 353 |
| 274 | 3300046528 | Ga0495642_0003589 | Ga0495642_0003589_3210_4331 | 353 |
| 275 | 3300047445 | Ga0495677_0004297 | Ga0495677_0004297_3271_4392 | 353 |
| 276 | 3300009177 | Ga0105248_10369541 | Ga0105248_103695411 | 355 |
| 277 | 3300026095 | Ga0207676_10372916 | Ga0207676_103729162 | 355 |
| 278 | 3300046506 | Ga0495583_0000033 | Ga0495583_0000033_78927_80054 | 355 |
| 279 | 3300053103 | Ga0500555_000742 | Ga0500555_000742_696_1823 | 355 |
| 280 | 3300044719 | Ga0466971_0057643 | Ga0466971_0057643_491_1618 | 356 |
| 281 | 3300046506 | Ga0495583_0003712 | Ga0495583_0003712_9261_10397 | 356 |
| 282 | 3300046692 | Ga0495671_0000011 | Ga0495671_0000011_203177_204313 | 356 |
| 283 | 3300047469 | Ga0495673_0000013 | Ga0495673_0000013_471241_472377 | 356 |
| 284 | 3300006871 | Ga0075434_100132799 | Ga0075434_1001327992 | 357 |
| 285 | 3300020082 | Ga0206353_11089745 | Ga0206353_110897452 | 357 |
| 286 | 3300046460 | Ga0495638_0000018 | Ga0495638_0000018_140086_141225 | 357 |
| 287 | 3300046524 | Ga0495648_0000018 | Ga0495648_0000018_141266_142405 | 357 |
| 288 | 3300050512 | nmdc:mga0n895_77889_c1 | nmdc:mga0n895_77889_c1_1274_2401 | 357 |
| 289 | 3300005338 | Ga0068868_100000042 | Ga0068868_10000004278 | 358 |
| 290 | 3300005577 | Ga0068857_100316373 | Ga0068857_1003163732 | 358 |
| 291 | 3300005614 | Ga0068856_100109937 | Ga0068856_1001099374 | 358 |
| 292 | 3300005616 | Ga0068852_100000393 | Ga0068852_10000039313 | 358 |
| 293 | 3300013105 | Ga0157369_10013976 | Ga0157369_100139767 | 358 |
| 294 | 3300026078 | Ga0207702_10008912 | Ga0207702_100089129 | 358 |
| 295 | 3300026116 | Ga0207674_10127060 | Ga0207674_101270604 | 358 |
| 296 | 3300026142 | Ga0207698_10001092 | Ga0207698_1000109211 | 358 |
| 297 | 3300032126 | Ga0307415_100026870 | Ga0307415_1000268703 | 358 |
| 298 | 3300037312 | Ga0395899_0006918 | Ga0395899_0006918_174_1301 | 358 |
| 299 | 3300037418 | Ga0395900_0228996 | Ga0395900_0228996_37_1164 | 358 |
| 300 | 3300041410 | Ga0439461_0000108 | Ga0439461_0000108_8751_9872 | 358 |
| 301 | 3300041997 | Ga0439431_0001890 | Ga0439431_0001890_35_1156 | 358 |
| 302 | 3300042004 | Ga0439445_0000054 | Ga0439445_0000054_6867_7988 | 358 |
| 303 | 3300042006 | Ga0439432_025810 | Ga0439432_025810_315_1436 | 358 |
| 304 | 3300042015 | Ga0439462_0002567 | Ga0439462_0002567_2513_3634 | 358 |
| 305 | 3300046519 | Ga0495632_0003057 | Ga0495632_0003057_1780_2916 | 358 |
| 306 | 3300005617 | Ga0068859_100034368 | Ga0068859_1000343685 | 359 |
| 307 | 3300006931 | Ga0097620_100034367 | Ga0097620_1000343675 | 359 |
| 308 | 3300009545 | Ga0105237_10079802 | Ga0105237_100798022 | 359 |
| 309 | 3300014326 | Ga0157380_10060767 | Ga0157380_100607673 | 359 |
| 310 | 3300047469 | Ga0495673_0043128 | Ga0495673_0043128_592_1719 | 360 |
| 311 | 3300005530 | Ga0070679_100163809 | Ga0070679_1001638093 | 361 |
| 312 | 3300014325 | Ga0163163_10242394 | Ga0163163_102423942 | 361 |
| 313 | 3300003214 | JGI25165J46597_1000289 | JGI25165J46597_100028953 | 362 |
| 314 | 3300025231 | Ga0207427_100420 | Ga0207427_10042023 | 362 |
| 315 | 3300025261 | Ga0209233_1000291 | Ga0209233_100029123 | 362 |
| 316 | 3300045836 | Ga0466958_0026324 | Ga0466958_0026324_2152_3279 | 362 |
| 317 | 3300045976 | Ga0466967_0120728 | Ga0466967_0120728_734_1861 | 362 |
| 318 | 3300046660 | Ga0495625_0001633 | Ga0495625_0001633_10303_11439 | 362 |
| 319 | 3300005355 | Ga0070671_100000112 | Ga0070671_10000011220 | 363 |
| 320 | 3300025931 | Ga0207644_10000107 | Ga0207644_1000010747 | 363 |
| 321 | 3300048906 | Ga0496103_0039775 | Ga0496103_0039775_982_2118 | 363 |
| 322 | 3300001915 | JGI24741J21665_1003441 | JGI24741J21665_10034412 | 365 |
| 323 | 3300005539 | Ga0068853_100039656 | Ga0068853_1000396566 | 365 |
| 324 | iso_pu_bacteria | 2643221622 | 2644127674 | 365 |
| 325 | 3300005841 | Ga0068863_100051605 | Ga0068863_1000516053 | 366 |
| 326 | 3300026088 | Ga0207641_10029503 | Ga0207641_100295036 | 366 |
| 327 | 3300009093 | Ga0105240_10099444 | Ga0105240_100994443 | 367 |
| 328 | 3300031911 | Ga0307412_10000304 | Ga0307412_1000030427 | 367 |
| 329 | 3300005336 | Ga0070680_100019919 | Ga0070680_1000199196 | 368 |
| 330 | 3300005338 | Ga0068868_100295667 | Ga0068868_1002956671 | 368 |
| 331 | 3300005347 | Ga0070668_100237360 | Ga0070668_1002373601 | 368 |
| 332 | 3300005367 | Ga0070667_100008714 | Ga0070667_1000087142 | 368 |
| 333 | 3300005456 | Ga0070678_100002349 | Ga0070678_1000023495 | 368 |
| 334 | 3300005459 | Ga0068867_100097607 | Ga0068867_1000976072 | 368 |
| 335 | 3300005548 | Ga0070665_100003125 | Ga0070665_1000031257 | 368 |
| 336 | 3300014969 | Ga0157376_10101503 | Ga0157376_101015033 | 368 |
| 337 | 3300025937 | Ga0207669_10032133 | Ga0207669_100321333 | 368 |
| 338 | 3300025986 | Ga0207658_10028416 | Ga0207658_100284161 | 368 |
| 339 | 3300026089 | Ga0207648_10178051 | Ga0207648_101780511 | 368 |
| 340 | 3300028379 | Ga0268266_10048020 | Ga0268266_100480203 | 368 |
| 341 | 3300031548 | Ga0307408_100020042 | Ga0307408_1000200422 | 368 |
| 342 | 3300031901 | Ga0307406_10002850 | Ga0307406_100028506 | 368 |
| 343 | 3300031903 | Ga0307407_10004214 | Ga0307407_100042146 | 368 |
| 344 | 3300031995 | Ga0307409_100004393 | Ga0307409_1000043936 | 368 |
| 345 | 3300032002 | Ga0307416_100007874 | Ga0307416_1000078746 | 368 |
| 346 | 3300032005 | Ga0307411_10026655 | Ga0307411_100266552 | 368 |
| 347 | 3300048905 | Ga0496102_0000100 | Ga0496102_0000100_118660_119784 | 368 |
| 348 | 3300048906 | Ga0496103_0000070 | Ga0496103_0000070_118641_119765 | 368 |
| 349 | 3300048919 | Ga0496116_0002579 | Ga0496116_0002579_16523_17647 | 368 |
| 350 | 3300048920 | Ga0496117_0000194 | Ga0496117_0000194_118660_119784 | 368 |
| 351 | 3300048921 | Ga0496118_0000146 | Ga0496118_0000146_118660_119784 | 368 |
| 352 | 3300048927 | Ga0496124_0000185 | Ga0496124_0000185_3748_4872 | 368 |
| 353 | 3300049577 | Ga0501041_0082488 | Ga0501041_0082488_484_1608 | 368 |
| 354 | 3300049743 | Ga0501081_0102784 | Ga0501081_0102784_109_1233 | 368 |
| 355 | 3300003773 | Ga0055537_1000406 | Ga0055537_10004064 | 369 |
| 356 | 3300003775 | Ga0055524_1000133 | Ga0055524_100013334 | 369 |
| 357 | 3300003794 | Ga0055531_10004667 | Ga0055531_100046674 | 369 |
| 358 | 3300025263 | Ga0209565_1000007 | Ga0209565_1000007709 | 369 |
| 359 | 3300025273 | Ga0209673_1001335 | Ga0209673_10013353 | 369 |
| 360 | 3300025298 | Ga0209050_1009706 | Ga0209050_10097063 | 369 |
| 361 | 3300025299 | Ga0209256_1000008 | Ga0209256_1000008551 | 369 |
| 362 | 3300025304 | Ga0209257_1004469 | Ga0209257_10044694 | 369 |
| 363 | 3300031901 | Ga0307406_10088335 | Ga0307406_100883352 | 369 |
| 364 | iso_pu_bacteria | 2512564014 | 2512644599 | 369 |
| 365 | iso_pu_bacteria | 2599185354 | 2600201213 | 369 |
| 366 | iso_pu_bacteria | 2599185359 | 2600228063 | 369 |
| 367 | iso_pu_bacteria | 2751185897 | 2753764919 | 369 |
| 368 | iso_pu_bacteria | 2751185897 | 2753765424 | 369 |
| 369 | iso_pu_bacteria | 2808606401 | 2809062343 | 369 |
| 370 | iso_pu_bacteria | 2808606404 | 2809078317 | 369 |
| 371 | iso_pu_bacteria | 2808606405 | 2809082732 | 369 |
| 372 | iso_pu_bacteria | 2818991466 | 2819715132 | 369 |
| 373 | iso_pu_bacteria | 2830075706 | 2830078455 | 369 |
| 374 | iso_pu_bacteria | 2879163058 | 2879164313 | 369 |
| 375 | iso_pu_bacteria | 2880518877 | 2880522398 | 369 |
| 376 | iso_pu_bacteria | 2885429604 | 2885432645 | 369 |
| 377 | iso_pu_bacteria | 2919709256 | 2919709665 | 369 |
| 378 | iso_pu_bacteria | 2928526807 | 2928531146 | 369 |
| 379 | iso_pu_bacteria | 2928968154 | 2928972322 | 369 |
| 380 | iso_pu_bacteria | 2946787523 | 2946790241 | 369 |
| 381 | 3300021358 | Ga0213873_10000007 | Ga0213873_1000000787 | 370 |
| 382 | 3300021384 | Ga0213876_10000005 | Ga0213876_10000005123 | 370 |
| 383 | 3300039437 | Ga0436365_0687780 | Ga0436365_0687780_49365_50483 | 370 |
| 384 | 3300039453 | Ga0436362_0451893 | Ga0436362_0451893_86923_88041 | 370 |
| 385 | 3300005347 | Ga0070668_100028198 | Ga0070668_1000281982 | 371 |
| 386 | 3300025972 | Ga0207668_10071656 | Ga0207668_100716561 | 371 |
| 387 | 3300048911 | Ga0496108_0002667 | Ga0496108_0002667_3530_4672 | 371 |
| 388 | 3300002774 | JGI25150J39212_1000282 | JGI25150J39212_100028210 | 372 |
| 389 | 3300003215 | JGI25153J46596_10000032 | JGI25153J46596_10000032161 | 372 |
| 390 | 3300009147 | Ga0114129_10148369 | Ga0114129_101483694 | 372 |
| 391 | 3300009545 | Ga0105237_10059453 | Ga0105237_100594534 | 372 |
| 392 | 3300025245 | Ga0207425_1000025 | Ga0207425_1000025245 | 372 |
| 393 | 3300025263 | Ga0209565_1006830 | Ga0209565_10068303 | 372 |
| 394 | 3300025294 | Ga0209025_1000663 | Ga0209025_10006634 | 372 |
| 395 | 3300025297 | Ga0209758_1000002 | Ga0209758_1000002329 | 372 |
| 396 | 3300025298 | Ga0209050_1031398 | Ga0209050_10313982 | 372 |
| 397 | 3300025304 | Ga0209257_1001406 | Ga0209257_100140615 | 372 |
| 398 | 3300025933 | Ga0207706_10116124 | Ga0207706_101161243 | 372 |
| 399 | 3300001990 | JGI24737J22298_10000590 | JGI24737J22298_100005905 | 373 |
| 400 | 3300001991 | JGI24743J22301_10001846 | JGI24743J22301_100018463 | 373 |
| 401 | 3300002067 | JGI24735J21928_10006215 | JGI24735J21928_100062151 | 373 |
| 402 | 3300002067 | JGI24735J21928_10010490 | JGI24735J21928_100104904 | 373 |
| 403 | 3300002067 | JGI24735J21928_10011900 | JGI24735J21928_100119004 | 373 |
| 404 | 3300002067 | JGI24735J21928_10026852 | JGI24735J21928_100268521 | 373 |
| 405 | 3300002075 | JGI24738J21930_10001982 | JGI24738J21930_100019822 | 373 |
| 406 | 3300003762 | Ga0055542_1000142 | Ga0055542_100014297 | 373 |
| 407 | 3300003762 | Ga0055542_1000783 | Ga0055542_100078322 | 373 |
| 408 | 3300003763 | Ga0055529_1000167 | Ga0055529_100016797 | 373 |
| 409 | 3300003771 | Ga0055526_1001776 | Ga0055526_100177615 | 373 |
| 410 | 3300003792 | Ga0055540_1007630 | Ga0055540_10076303 | 373 |
| 411 | 3300005262 | Ga0065165_1011769 | Ga0065165_10117693 | 373 |
| 412 | 3300005327 | Ga0070658_10000384 | Ga0070658_1000038424 | 373 |
| 413 | 3300005327 | Ga0070658_10001088 | Ga0070658_100010883 | 373 |
| 414 | 3300005334 | Ga0068869_100001042 | Ga0068869_10000104218 | 373 |
| 415 | 3300005338 | Ga0068868_100000516 | Ga0068868_1000005168 | 373 |
| 416 | 3300005339 | Ga0070660_100000066 | Ga0070660_10000006624 | 373 |
| 417 | 3300005339 | Ga0070660_100007816 | Ga0070660_1000078162 | 373 |
| 418 | 3300005344 | Ga0070661_100000133 | Ga0070661_10000013322 | 373 |
| 419 | 3300005347 | Ga0070668_100013601 | Ga0070668_1000136013 | 373 |
| 420 | 3300005354 | Ga0070675_100008635 | Ga0070675_1000086359 | 373 |
| 421 | 3300005355 | Ga0070671_100002059 | Ga0070671_10000205913 | 373 |
| 422 | 3300005355 | Ga0070671_100027168 | Ga0070671_1000271682 | 373 |
| 423 | 3300005364 | Ga0070673_100000010 | Ga0070673_100000010139 | 373 |
| 424 | 3300005366 | Ga0070659_100018071 | Ga0070659_1000180715 | 373 |
| 425 | 3300005367 | Ga0070667_100217414 | Ga0070667_1002174142 | 373 |
| 426 | 3300005457 | Ga0070662_100107278 | Ga0070662_1001072783 | 373 |
| 427 | 3300005459 | Ga0068867_100000019 | Ga0068867_10000001982 | 373 |
| 428 | 3300005539 | Ga0068853_100037460 | Ga0068853_1000374603 | 373 |
| 429 | 3300005539 | Ga0068853_100115975 | Ga0068853_1001159753 | 373 |
| 430 | 3300005543 | Ga0070672_100060355 | Ga0070672_1000603553 | 373 |
| 431 | 3300005548 | Ga0070665_100000316 | Ga0070665_1000003168 | 373 |
| 432 | 3300005563 | Ga0068855_100000123 | Ga0068855_10000012384 | 373 |
| 433 | 3300005563 | Ga0068855_100244018 | Ga0068855_1002440183 | 373 |
| 434 | 3300005617 | Ga0068859_100001318 | Ga0068859_10000131824 | 373 |
| 435 | 3300005719 | Ga0068861_100000850 | Ga0068861_10000085015 | 373 |
| 436 | 3300005842 | Ga0068858_100000122 | Ga0068858_10000012211 | 373 |
| 437 | 3300006881 | Ga0068865_100000319 | Ga0068865_1000003199 | 373 |
| 438 | 3300006931 | Ga0097620_100001318 | Ga0097620_1000013183 | 373 |
| 439 | 3300009093 | Ga0105240_10056596 | Ga0105240_100565962 | 373 |
| 440 | 3300009098 | Ga0105245_10000582 | Ga0105245_1000058215 | 373 |
| 441 | 3300009098 | Ga0105245_10001094 | Ga0105245_1000109422 | 373 |
| 442 | 3300009148 | Ga0105243_10000296 | Ga0105243_1000029622 | 373 |
| 443 | 3300009176 | Ga0105242_10000803 | Ga0105242_100008036 | 373 |
| 444 | 3300009177 | Ga0105248_10006892 | Ga0105248_100068923 | 373 |
| 445 | 3300009545 | Ga0105237_10009164 | Ga0105237_100091643 | 373 |
| 446 | 3300009545 | Ga0105237_10054919 | Ga0105237_100549193 | 373 |
| 447 | 3300009553 | Ga0105249_10060620 | Ga0105249_100606203 | 373 |
| 448 | 3300010375 | Ga0105239_10130631 | Ga0105239_101306315 | 373 |
| 449 | 3300013102 | Ga0157371_10000062 | Ga0157371_1000006233 | 373 |
| 450 | 3300013104 | Ga0157370_10000774 | Ga0157370_1000077429 | 373 |
| 451 | 3300013296 | Ga0157374_10003979 | Ga0157374_100039797 | 373 |
| 452 | 3300013296 | Ga0157374_10015043 | Ga0157374_100150436 | 373 |
| 453 | 3300013297 | Ga0157378_10006416 | Ga0157378_100064166 | 373 |
| 454 | 3300013297 | Ga0157378_10109366 | Ga0157378_101093662 | 373 |
| 455 | 3300013306 | Ga0163162_10164516 | Ga0163162_101645162 | 373 |
| 456 | 3300013307 | Ga0157372_10016443 | Ga0157372_100164434 | 373 |
| 457 | 3300013308 | Ga0157375_10003787 | Ga0157375_1000378713 | 373 |
| 458 | 3300014745 | Ga0157377_10061945 | Ga0157377_100619453 | 373 |
| 459 | 3300014969 | Ga0157376_10000245 | Ga0157376_1000024521 | 373 |
| 460 | 3300021384 | Ga0213876_10003902 | Ga0213876_100039024 | 373 |
| 461 | 3300025254 | Ga0209148_1000008 | Ga0209148_1000008484 | 373 |
| 462 | 3300025254 | Ga0209148_1000114 | Ga0209148_100011483 | 373 |
| 463 | 3300025254 | Ga0209148_1001403 | Ga0209148_10014034 | 373 |
| 464 | 3300025261 | Ga0209233_1000107 | Ga0209233_100010790 | 373 |
| 465 | 3300025272 | Ga0209455_1000002 | Ga0209455_1000002940 | 373 |
| 466 | 3300025272 | Ga0209455_1000796 | Ga0209455_10007964 | 373 |
| 467 | 3300025295 | Ga0209564_1002343 | Ga0209564_10023436 | 373 |
| 468 | 3300025298 | Ga0209050_1000001 | Ga0209050_1000001273 | 373 |
| 469 | 3300025298 | Ga0209050_1000350 | Ga0209050_100035079 | 373 |
| 470 | 3300025303 | Ga0209051_1000689 | Ga0209051_10006895 | 373 |
| 471 | 3300025304 | Ga0209257_1001053 | Ga0209257_100105318 | 373 |
| 472 | 3300025907 | Ga0207645_10000492 | Ga0207645_1000049229 | 373 |
| 473 | 3300025909 | Ga0207705_10000181 | Ga0207705_1000018131 | 373 |
| 474 | 3300025909 | Ga0207705_10000254 | Ga0207705_1000025433 | 373 |
| 475 | 3300025909 | Ga0207705_10023327 | Ga0207705_100233273 | 373 |
| 476 | 3300025911 | Ga0207654_10000822 | Ga0207654_1000082214 | 373 |
| 477 | 3300025913 | Ga0207695_10168710 | Ga0207695_101687102 | 373 |
| 478 | 3300025914 | Ga0207671_10009543 | Ga0207671_1000954310 | 373 |
| 479 | 3300025919 | Ga0207657_10003028 | Ga0207657_1000302818 | 373 |
| 480 | 3300025920 | Ga0207649_10000247 | Ga0207649_100002475 | 373 |
| 481 | 3300025920 | Ga0207649_10000651 | Ga0207649_1000065113 | 373 |
| 482 | 3300025923 | Ga0207681_10044883 | Ga0207681_100448832 | 373 |
| 483 | 3300025924 | Ga0207694_10003586 | Ga0207694_100035867 | 373 |
| 484 | 3300025927 | Ga0207687_10000728 | Ga0207687_1000072815 | 373 |
| 485 | 3300025927 | Ga0207687_10003822 | Ga0207687_100038227 | 373 |
| 486 | 3300025931 | Ga0207644_10010910 | Ga0207644_100109103 | 373 |
| 487 | 3300025932 | Ga0207690_10003702 | Ga0207690_100037025 | 373 |
| 488 | 3300025932 | Ga0207690_10036117 | Ga0207690_100361173 | 373 |
| 489 | 3300025935 | Ga0207709_10000050 | Ga0207709_100000509 | 373 |
| 490 | 3300025937 | Ga0207669_10004620 | Ga0207669_100046204 | 373 |
| 491 | 3300025938 | Ga0207704_10000051 | Ga0207704_100000513 | 373 |
| 492 | 3300025940 | Ga0207691_10093636 | Ga0207691_100936363 | 373 |
| 493 | 3300025940 | Ga0207691_10131899 | Ga0207691_101318994 | 373 |
| 494 | 3300025941 | Ga0207711_10001291 | Ga0207711_1000129112 | 373 |
| 495 | 3300025942 | Ga0207689_10000899 | Ga0207689_100008997 | 373 |
| 496 | 3300025949 | Ga0207667_10000167 | Ga0207667_1000016781 | 373 |
| 497 | 3300025949 | Ga0207667_10000852 | Ga0207667_100008529 | 373 |
| 498 | 3300025949 | Ga0207667_10040733 | Ga0207667_100407331 | 373 |
| 499 | 3300025949 | Ga0207667_10109641 | Ga0207667_101096415 | 373 |
| 500 | 3300025949 | Ga0207667_10267390 | Ga0207667_102673903 | 373 |
| 501 | 3300025960 | Ga0207651_10000005 | Ga0207651_10000005242 | 373 |
| 502 | 3300025961 | Ga0207712_10048491 | Ga0207712_100484913 | 373 |
| 503 | 3300025972 | Ga0207668_10002267 | Ga0207668_100022677 | 373 |
| 504 | 3300026023 | Ga0207677_10000484 | Ga0207677_1000048419 | 373 |
| 505 | 3300026035 | Ga0207703_10000159 | Ga0207703_1000015967 | 373 |
| 506 | 3300026041 | Ga0207639_10010202 | Ga0207639_100102023 | 373 |
| 507 | 3300026078 | Ga0207702_10006464 | Ga0207702_1000646410 | 373 |
| 508 | 3300026078 | Ga0207702_10010959 | Ga0207702_100109598 | 373 |
| 509 | 3300026089 | Ga0207648_10000068 | Ga0207648_1000006882 | 373 |
| 510 | 3300026116 | Ga0207674_10058761 | Ga0207674_100587612 | 373 |
| 511 | 3300026118 | Ga0207675_100001943 | Ga0207675_1000019439 | 373 |
| 512 | 3300026142 | Ga0207698_10003088 | Ga0207698_100030883 | 373 |
| 513 | 3300028379 | Ga0268266_10000002 | Ga0268266_10000002893 | 373 |
| 514 | 3300028381 | Ga0268264_10230277 | Ga0268264_102302773 | 373 |
| 515 | 3300031456 | Ga0307513_10001996 | Ga0307513_100019968 | 373 |
| 516 | 3300031456 | Ga0307513_10267685 | Ga0307513_102676852 | 373 |
| 517 | 3300031616 | Ga0307508_10000302 | Ga0307508_1000030259 | 373 |
| 518 | 3300031728 | Ga0316578_10118904 | Ga0316578_101189041 | 373 |
| 519 | 3300031911 | Ga0307412_10022225 | Ga0307412_100222253 | 373 |
| 520 | 3300036712 | Ga0316584_0047411 | Ga0316584_0047411_1442_2593 | 373 |
| 521 | 3300036712 | Ga0316584_0071411 | Ga0316584_0071411_215_1366 | 373 |
| 522 | 3300038705 | Ga0237819_00282 | Ga0237819_00282_3911_5038 | 373 |
| 523 | 3300039437 | Ga0436365_1127686 | Ga0436365_1127686_3635_4762 | 373 |
| 524 | 3300041997 | Ga0439431_0018299 | Ga0439431_0018299_407_1528 | 373 |
| 525 | 3300042010 | Ga0439452_011683 | Ga0439452_011683_496_1617 | 373 |
| 526 | 3300044658 | Ga0466972_0011708 | Ga0466972_0011708_1868_2995 | 373 |
| 527 | 3300044706 | Ga0466964_0008643 | Ga0466964_0008643_1820_2947 | 373 |
| 528 | 3300044901 | Ga0466960_0020079 | Ga0466960_0020079_79_1206 | 373 |
| 529 | 3300045049 | Ga0466959_0107453 | Ga0466959_0107453_830_1951 | 373 |
| 530 | 3300046460 | Ga0495638_0000048 | Ga0495638_0000048_105227_106348 | 373 |
| 531 | 3300046471 | Ga0495650_0000983 | Ga0495650_0000983_1978_3099 | 373 |
| 532 | 3300046522 | Ga0495643_0003269 | Ga0495643_0003269_132_1253 | 373 |
| 533 | 3300046524 | Ga0495648_0001493 | Ga0495648_0001493_1868_2989 | 373 |
| 534 | 3300046660 | Ga0495625_0038326 | Ga0495625_0038326_516_1637 | 373 |
| 535 | 3300046660 | Ga0495625_0047960 | Ga0495625_0047960_913_2040 | 373 |
| 536 | 3300046691 | Ga0495670_0060090 | Ga0495670_0060090_186_1322 | 373 |
| 537 | 3300047470 | Ga0495681_0007069 | Ga0495681_0007069_769_1890 | 373 |
| 538 | 3300047472 | Ga0495686_0000053 | Ga0495686_0000053_76317_77444 | 373 |
| 539 | 3300047472 | Ga0495686_0012386 | Ga0495686_0012386_3385_4506 | 373 |
| 540 | 3300047472 | Ga0495686_0075609 | Ga0495686_0075609_75_1202 | 373 |
| 541 | 3300048920 | Ga0496117_0006172 | Ga0496117_0006172_2824_3951 | 373 |
| 542 | 3300048920 | Ga0496117_0025842 | Ga0496117_0025842_3228_4355 | 373 |
| 543 | 3300048921 | Ga0496118_0000434 | Ga0496118_0000434_46771_47898 | 373 |
| 544 | 3300048921 | Ga0496118_0004543 | Ga0496118_0004543_8652_9779 | 373 |
| 545 | 3300048921 | Ga0496118_0066084 | Ga0496118_0066084_835_1962 | 373 |
| 546 | 3300048924 | Ga0496121_0017936 | Ga0496121_0017936_5855_6982 | 373 |
| 547 | 3300048924 | Ga0496121_0140707 | Ga0496121_0140707_624_1745 | 373 |
| 548 | 3300048926 | Ga0496123_0012929 | Ga0496123_0012929_1414_2541 | 373 |
| 549 | 3300048926 | Ga0496123_0031843 | Ga0496123_0031843_1103_2224 | 373 |
| 550 | 3300048927 | Ga0496124_0000648 | Ga0496124_0000648_41849_42970 | 373 |
| 551 | 3300048927 | Ga0496124_0023699 | Ga0496124_0023699_335_1456 | 373 |
| 552 | 3300048929 | Ga0496126_0126083 | Ga0496126_0126083_493_1620 | 373 |
| 553 | 3300049585 | Ga0501069_0060448 | Ga0501069_0060448_207_1334 | 373 |
| 554 | 3300049823 | Ga0501044_0375811 | Ga0501044_0375811_111_1238 | 373 |
| 555 | 3300053104 | Ga0500556_0000027 | Ga0500556_0000027_152236_153363 | 373 |
| 556 | 3300053130 | Ga0500642_0000003 | Ga0500642_0000003_537213_538340 | 373 |
| 557 | 3300053134 | Ga0500658_0009654 | Ga0500658_0009654_948_2069 | 373 |
| 558 | 3300053140 | Ga0500573_0000093 | Ga0500573_0000093_1966_3087 | 373 |
| 559 | 3300053157 | Ga0500624_000009 | Ga0500624_000009_116833_117954 | 373 |
| 560 | 3300053730 | Ga0500645_000586 | Ga0500645_000586_21442_22569 | 373 |
| 561 | 3300031250 | Ga0265331_10007851 | Ga0265331_100078512 | 374 |
| 562 | 3300032126 | Ga0307415_100058569 | Ga0307415_1000585694 | 374 |
| 563 | 3300049574 | Ga0501038_0205059 | Ga0501038_0205059_94_1299 | 374 |
| 564 | 3300001904 | JGI24736J21556_1000479 | JGI24736J21556_10004793 | 375 |
| 565 | 3300001915 | JGI24741J21665_1000063 | JGI24741J21665_10000638 | 375 |
| 566 | 3300001989 | JGI24739J22299_10007314 | JGI24739J22299_100073142 | 375 |
| 567 | 3300001990 | JGI24737J22298_10003951 | JGI24737J22298_100039513 | 375 |
| 568 | 3300002067 | JGI24735J21928_10003325 | JGI24735J21928_100033254 | 375 |
| 569 | 3300005327 | Ga0070658_10048616 | Ga0070658_100486164 | 375 |
| 570 | 3300005339 | Ga0070660_100036013 | Ga0070660_1000360132 | 375 |
| 571 | 3300005366 | Ga0070659_100035610 | Ga0070659_1000356104 | 375 |
| 572 | 3300005455 | Ga0070663_100022137 | Ga0070663_1000221373 | 375 |
| 573 | 3300005614 | Ga0068856_100003500 | Ga0068856_10000350011 | 375 |
| 574 | 3300005985 | Ga0081539_10018758 | Ga0081539_100187583 | 375 |
| 575 | 3300009174 | Ga0105241_10007488 | Ga0105241_100074884 | 375 |
| 576 | 3300009545 | Ga0105237_10037685 | Ga0105237_100376852 | 375 |
| 577 | 3300010375 | Ga0105239_10056916 | Ga0105239_100569163 | 375 |
| 578 | 3300025321 | Ga0207656_10011133 | Ga0207656_100111333 | 375 |
| 579 | 3300025904 | Ga0207647_10045307 | Ga0207647_100453073 | 375 |
| 580 | 3300025911 | Ga0207654_10032576 | Ga0207654_100325763 | 375 |
| 581 | 3300025919 | Ga0207657_10022449 | Ga0207657_100224495 | 375 |
| 582 | 3300026041 | Ga0207639_10000100 | Ga0207639_100001008 | 375 |
| 583 | 3300026067 | Ga0207678_10000007 | Ga0207678_1000000728 | 375 |
| 584 | 3300026078 | Ga0207702_10028171 | Ga0207702_100281714 | 375 |
| 585 | 3300026116 | Ga0207674_10033925 | Ga0207674_100339253 | 375 |
| 586 | 3300031548 | Ga0307408_100035106 | Ga0307408_1000351064 | 375 |
| 587 | 3300031852 | Ga0307410_10042175 | Ga0307410_100421752 | 375 |
| 588 | 3300031911 | Ga0307412_10196255 | Ga0307412_101962551 | 375 |
| 589 | 3300032002 | Ga0307416_100080827 | Ga0307416_1000808273 | 375 |
| 590 | 3300050493 | nmdc:mga0k408_73827_c1 | nmdc:mga0k408_73827_c1_818_1969 | 375 |
| 591 | 3300021361 | Ga0213872_10000577 | Ga0213872_1000057720 | 376 |
| 592 | 3300028800 | Ga0265338_10117244 | Ga0265338_101172441 | 376 |
| 593 | 3300039447 | Ga0436361_0375914 | Ga0436361_0375914_7817_8974 | 376 |
| 594 | 2162886007 | SwRhRL2b_contig_493648 | SwRhRL2b_0926.00006950 | 380 |
| 595 | 3300001915 | JGI24741J21665_1000437 | JGI24741J21665_100043712 | 380 |
| 596 | 3300001979 | JGI24740J21852_10000017 | JGI24740J21852_1000001720 | 380 |
| 597 | 3300005289 | Ga0065704_10001254 | Ga0065704_100012548 | 380 |
| 598 | 3300005455 | Ga0070663_100000022 | Ga0070663_10000002285 | 380 |
| 599 | 3300005577 | Ga0068857_100055682 | Ga0068857_1000556823 | 380 |
| 600 | 3300005614 | Ga0068856_100000041 | Ga0068856_10000004187 | 380 |
| 601 | 3300009174 | Ga0105241_10000037 | Ga0105241_1000003784 | 380 |
| 602 | 3300013100 | Ga0157373_10000046 | Ga0157373_1000004619 | 380 |
| 603 | 3300013104 | Ga0157370_10000071 | Ga0157370_1000007119 | 380 |
| 604 | 3300025911 | Ga0207654_10000032 | Ga0207654_1000003228 | 380 |
| 605 | 3300026067 | Ga0207678_10000038 | Ga0207678_1000003873 | 380 |
| 606 | 3300026078 | Ga0207702_10000061 | Ga0207702_1000006187 | 380 |
| 607 | 3300026078 | Ga0207702_10114574 | Ga0207702_101145743 | 380 |
| 608 | 3300026116 | Ga0207674_10070451 | Ga0207674_100704513 | 380 |
| 609 | 3300048924 | Ga0496121_0000670 | Ga0496121_0000670_46128_47270 | 380 |
| 610 | 3300048928 | Ga0496125_0036267 | Ga0496125_0036267_1964_3106 | 380 |
| 611 | 3300048929 | Ga0496126_0011152 | Ga0496126_0011152_6408_7550 | 380 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4dio-assembly1.cif.gz_B | the crystal structure of transhydrogenase from sinorhizobium meliloti | 0.9597 | 1 | 364 |
| 1u2g-assembly1.cif.gz_A | transhydrogenase (di.adpr)2(diii.nadph)1 asymmetric complex | 0.959 | 1 | 361 |
| 4dio-assembly1.cif.gz_A | the crystal structure of transhydrogenase from sinorhizobium meliloti | 0.9567 | 1 | 361 |
| 4dio-assembly1.cif.gz_A | the crystal structure of transhydrogenase from sinorhizobium meliloti | 0.954 | 1 | 361 |
| 4dio-assembly1.cif.gz_B | the crystal structure of transhydrogenase from sinorhizobium meliloti | 0.954 | 1 | 364 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A4HWA7_1_176_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9955 | 161 | 192 | 3.50.50.60 |
| af_Q54H99_9_164_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9758 | 161 | 192 | 3.50.50.60 |
| af_A0A0P0V2P7_13_181_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.971 | 163 | 193 | 3.50.50.60 |
| af_Q4CQU6_365_588_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9573 | 160 | 192 | 3.50.50.60 |
| af_Q54H02_2_246_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9551 | 161 | 192 | 3.50.50.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3S4IYE5-F1-model_v4 | proton-translocating NAD(P)(+) transhydrogenase (EC 7.1.1.1) | 0.9945 | 117 | 201 |
GO:0005886
GO:0006740 GO:0016491 GO:0050661 |
| AF-A0A4Q3CEL8-F1-model_v4 | proton-translocating NAD(P)(+) transhydrogenase (EC 7.1.1.1) | 0.9921 | 39 | 367 |
GO:0005886
GO:0006740 GO:0016491 GO:0050661 |
| AF-A0A377BBC3-F1-model_v4 | proton-translocating NAD(P)(+) transhydrogenase (EC 7.1.1.1) | 0.9917 | 108 | 209 |
GO:0005886
GO:0006740 GO:0008750 GO:0016491 GO:0050661 |
| AF-A0A520I8I6-F1-model_v4 | proton-translocating NAD(P)(+) transhydrogenase (EC 7.1.1.1) | 0.9902 | 116 | 367 |
GO:0005886
GO:0006740 GO:0016491 GO:0050661 |
| AF-A0A4Q3C5W8-F1-model_v4 | proton-translocating NAD(P)(+) transhydrogenase (EC 7.1.1.1) | 0.9893 | 1 | 205 |
GO:0005886
GO:0006740 GO:0016491 GO:0050661 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar