F469049

General Info

Members Datasets Scaffolds Average Seq Length
611 302 1222 236

Family's Representative Sequence

Representative Sequence 3300005618|Ga0068864_100574296|Ga0068864_1005742962
Length 254
Sequence VGRLEGRPICFIVQEYMEVRLQKLLADAGIASRRASEQVILEGRVSVNGKVVQTLGTKVDPLHDRVSVDGRPVKPKRKLYLAVNKPEGYICSSDDPERRKTVHALLPKEWSNLHSVGRLDYYSEGLIFYTNDGEFALRLTHPRYGVRKKYLVTVKGEVTLEHVHTFKKGIFHDGDVLKAESGRILKSNQSHSLVELTLTEGKNREVRRMFESLGFEIERLQRVQIGSVKLGQLPRGKWRTLTEPEIKSLMQPTV

Samples

Sample ID Description Type Environment
1 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
6 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
7 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
10 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
11 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
12 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
13 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
14 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
15 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
16 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
31 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
32 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
33 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
35 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
36 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
37 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
43 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
44 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
45 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
51 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
52 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
53 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
54 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
55 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
56 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
57 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
58 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
59 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
60 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
65 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
66 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
68 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
69 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
84 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
88 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
89 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
90 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
91 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
92 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
93 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
94 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
95 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
96 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
97 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
98 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
99 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
100 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
101 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
102 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
103 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
104 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
105 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
106 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
107 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
108 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
109 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
110 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
111 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
112 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
113 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
114 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
115 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
116 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
117 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
118 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
119 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
120 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
121 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
122 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
123 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
124 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
125 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
126 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
127 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
128 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
129 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
130 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
131 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
132 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
133 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
134 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
135 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
136 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
137 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
138 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
139 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
140 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
141 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
142 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
143 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
144 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
145 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
146 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
147 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
148 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
149 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
150 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
151 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
152 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
153 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
154 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
155 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
156 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
157 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
158 2506520008 Serratia plymuthica AS12 Isolate Unclassified
159 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
160 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
161 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
162 2547132181 Kosakonia sacchari SP1 Isolate Stem
163 2547132416 Enterobacter sp. MR1 Isolate Rhizoplane
164 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
165 2561511199 Enterobacter sp. R4-368 Isolate Nodule
166 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
167 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
168 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
169 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
170 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
171 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
172 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
173 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
174 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
175 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
176 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
177 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
178 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
179 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
180 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
181 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
182 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
183 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
184 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
185 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
186 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
187 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
188 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
189 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
190 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
191 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
192 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
193 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
194 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
195 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
196 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
197 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
198 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
199 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
200 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
201 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
202 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
203 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
204 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
205 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
206 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
207 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
208 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
209 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
210 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
211 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
212 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
213 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
214 2636415599 Klebsiella variicola DX120E Isolate Unclassified
215 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
216 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
217 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
218 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
219 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
220 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
221 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
222 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
223 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
224 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
225 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
226 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
227 2751185917 Enterobacter sp. HK169 Isolate Unclassified
228 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
229 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
230 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
231 2775507074 Klebsiella sp. D5A Isolate Unclassified
232 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
233 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
234 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
235 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
236 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
237 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
238 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
239 2821118458 Enterobacter asburiae 609 Isolate Unclassified
240 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
241 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
242 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
243 2846540461 Photorhabdus luminescens HIM3 Isolate Rhizosphere
244 2847085930 Erwinia persicina B64 Isolate Bulb
245 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
246 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
247 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
248 2865014394 Pantoea sp. R-71966 Isolate Unclassified
249 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
250 2876601092 Pantoea endophytica 596 Isolate Unclassified
251 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
252 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
253 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
254 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
255 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
256 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
257 2904504865 Serratia marcescens 1822 Isolate Unclassified
258 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
259 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
260 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
261 2919150387 Rahnella aceris 1817 Isolate Unclassified
262 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
263 2927143783 Rahnella sp. 2050 Isolate Unclassified
264 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
265 2932406140 Serratia sp. 2723 Isolate Rhizosphere
266 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
267 2937539931 Pantoea sp. LS15 Isolate Unclassified
268 2937967321 Serratia sp. YC16 Isolate Unclassified
269 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
270 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
271 2939577877 Serratia sp. 509 Isolate Rhizosphere
272 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
273 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
274 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
275 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
276 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
277 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
278 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
279 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
280 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
281 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
282 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified
283 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
284 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
285 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
286 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
287 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
288 640753048 Serratia proteamaculans 568 Isolate Endosphere
289 8004592986 Serratia sp. S119 Isolate Unclassified
290 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
291 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
292 8018221730 Enterobacter sp. CM29 Isolate Unclassified
293 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
294 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
295 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
296 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
297 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
298 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
299 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
300 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
301 8055693939 Hafnia alvei A23BA Isolate Rhizosphere
302 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 76.1
Metatranscriptomes 0
Isolates 23.9

Biome Distribution

Category Percentage (%)
Aerial Root 0.65
Bulb 0.16
Endosphere 4.91
Nodule 3.11
Rhizoplane 10.8
Rhizosphere 53.36
Stem 0.16
Stem Tuber 0.16
Unclassified 2.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068864_100574296 3300005618 Unclassified 1092
2 SwRhRL2b_contig_1329075 2162886007 Bacteria 1260
3 JGI24739J22299_10000567 3300001989 Bacteria 13316
4 JGI25162J39368_1000002 3300002737 Bacteria 663004
5 JGI25162J39368_1001702 3300002737 Bacteria 10703
6 JGI25163J39215_1001254 3300002771 Bacteria 4635
7 JGI25164J39214_1000098 3300002772 Bacteria 86651
8 JGI25152J39213_1000995 3300002773 Bacteria 13736
9 rootH2_10024276 3300003320 Bacteria 11259
10 Ga0055538_1000003 3300003751 Bacteria 663004
11 Ga0055539_1000003 3300003752 Bacteria 663004
12 Ga0055533_1000005 3300003756 Bacteria 663004
13 Ga0055525_1000005 3300003759 Bacteria 663004
14 Ga0055541_1000003 3300003841 Bacteria 663004
15 Ga0058692_1000106 3300003856 Bacteria 55531
16 Ga0058692_1000175 3300003856 Bacteria 39563
17 Ga0058692_1000395 3300003856 Bacteria 20950
18 Ga0058692_1000855 3300003856 Bacteria 11985
19 Ga0058692_1001429 3300003856 Bacteria 8786
20 Ga0058692_1001949 3300003856 Bacteria 7188
21 Ga0058692_1007602 3300003856 Bacteria 2862
22 Ga0058692_1023535 3300003856 Bacteria 1250
23 Ga0065703_1018888 3300005272 Bacteria 5476
24 Ga0065704_10000327 3300005289 Bacteria 32577
25 Ga0065704_10000732 3300005289 Bacteria 21869
26 Ga0065704_10000978 3300005289 Bacteria 23575
27 Ga0065704_10076269 3300005289 Bacteria 5163
28 Ga0065704_10089745 3300005289 Bacteria 2835
29 Ga0070689_100032277 3300005340 Unclassified 3982
30 Ga0070674_100137777 3300005356 Bacteria 1828
31 Ga0070674_100678773 3300005356 Unclassified 878
32 Ga0070688_100018097 3300005365 Unclassified 4059
33 Ga0070659_100386593 3300005366 Bacteria 1179
34 Ga0070705_100428066 3300005440 Bacteria 987
35 Ga0070681_10090634 3300005458 Unclassified 3008
36 Ga0070681_10851216 3300005458 Bacteria 830
37 Ga0070685_10414909 3300005466 Unclassified 935
38 Ga0070679_100129040 3300005530 Unclassified 2509
39 Ga0070665_100000276 3300005548 Bacteria 84448
40 Ga0070665_100002172 3300005548 Bacteria 21859
41 Ga0068857_100000064 3300005577 Bacteria 59060
42 Ga0068859_100162265 3300005617 Unclassified 2314
43 Ga0068851_10035723 3300005834 Bacteria 2486
44 Ga0081455_10003913 3300005937 Bacteria 16953
45 Ga0075364_10003640 3300006051 Bacteria 8792
46 Ga0075364_10026033 3300006051 Bacteria 3728
47 Ga0075364_10028840 3300006051 Bacteria 3555
48 Ga0075364_10048831 3300006051 Bacteria 2759
49 Ga0075432_10082190 3300006058 Bacteria 1169
50 Ga0075366_10087467 3300006195 Bacteria 1865
51 Ga0097620_100162282 3300006931 Unclassified 2314
52 Ga0079104_1000018 3300006946 Bacteria 271088
53 Ga0079104_1000182 3300006946 Bacteria 89724
54 Ga0079104_1000293 3300006946 Bacteria 63236
55 Ga0079104_1000407 3300006946 Bacteria 49595
56 Ga0079104_1001296 3300006946 Bacteria 17231
57 Ga0079104_1003121 3300006946 Bacteria 8059
58 Ga0079104_1015315 3300006946 Bacteria 2276
59 Ga0105251_10000045 3300009011 Bacteria 113579
60 Ga0105251_10000258 3300009011 Bacteria 53140
61 Ga0105251_10000458 3300009011 Bacteria 39099
62 Ga0105251_10003308 3300009011 Bacteria 11786
63 Ga0105251_10004070 3300009011 Bacteria 10264
64 Ga0105251_10005319 3300009011 Bacteria 8462
65 Ga0105251_10012087 3300009011 Bacteria 4899
66 Ga0105251_10015556 3300009011 Bacteria 4152
67 Ga0105251_10025171 3300009011 Bacteria 3048
68 Ga0105251_10074560 3300009011 Bacteria 1576
69 Ga0105244_10000009 3300009036 Bacteria 286143
70 Ga0105244_10000040 3300009036 Bacteria 157237
71 Ga0105244_10000714 3300009036 Bacteria 28702
72 Ga0105244_10001316 3300009036 Bacteria 20311
73 Ga0105244_10001320 3300009036 Bacteria 20281
74 Ga0105244_10001390 3300009036 Bacteria 19668
75 Ga0105244_10001391 3300009036 Bacteria 19665
76 Ga0105244_10003921 3300009036 Bacteria 10456
77 Ga0105244_10004681 3300009036 Bacteria 9323
78 Ga0105244_10005561 3300009036 Bacteria 8343
79 Ga0105244_10019872 3300009036 Bacteria 3738
80 Ga0105244_10020677 3300009036 Bacteria 3652
81 Ga0105244_10268441 3300009036 Bacteria 793
82 Ga0105250_10000007 3300009092 Bacteria 355249
83 Ga0105250_10000018 3300009092 Bacteria 246692
84 Ga0105250_10000054 3300009092 Bacteria 114370
85 Ga0105250_10000233 3300009092 Bacteria 46449
86 Ga0105250_10002333 3300009092 Bacteria 9610
87 Ga0105250_10004697 3300009092 Bacteria 6238
88 Ga0105250_10004948 3300009092 Bacteria 6044
89 Ga0105250_10007526 3300009092 Bacteria 4672
90 Ga0105250_10007655 3300009092 Bacteria 4629
91 Ga0105250_10062798 3300009092 Bacteria 1495
92 Ga0105250_10127744 3300009092 Bacteria 1048
93 Ga0111539_10604470 3300009094 Unclassified 1277
94 Ga0105247_10000100 3300009101 Bacteria 93272
95 Ga0105243_10001641 3300009148 Bacteria 19451
96 Ga0105241_10000001 3300009174 Bacteria 879793
97 Ga0105246_10039252 3300011119 Bacteria 3188
98 Ga0105246_10086371 3300011119 Bacteria 2249
99 Ga0105246_10237120 3300011119 Bacteria 1440
100 Ga0157373_10000270 3300013100 Bacteria 41755
101 Ga0157373_10001635 3300013100 Bacteria 17113
102 Ga0157373_10002612 3300013100 Bacteria 13675
103 Ga0157371_10000006 3300013102 Bacteria 404774
104 Ga0157371_10000859 3300013102 Bacteria 34664
105 Ga0157371_10003773 3300013102 Bacteria 13561
106 Ga0157371_10007580 3300013102 Bacteria 8758
107 Ga0157371_10009468 3300013102 Bacteria 7664
108 Ga0157371_10019331 3300013102 Bacteria 5026
109 Ga0157371_10489624 3300013102 Bacteria 907
110 Ga0157370_10001215 3300013104 Bacteria 32262
111 Ga0157370_10005087 3300013104 Bacteria 14834
112 Ga0157370_10006193 3300013104 Bacteria 13267
113 Ga0157369_10003193 3300013105 Bacteria 19550
114 Ga0157374_10651418 3300013296 Bacteria 1065
115 Ga0163162_10019288 3300013306 Bacteria 6686
116 Ga0163162_10104194 3300013306 Bacteria 2931
117 Ga0163162_10343894 3300013306 Bacteria 1624
118 Ga0157372_10008247 3300013307 Bacteria 11075
119 Ga0157372_10013110 3300013307 Bacteria 8844
120 Ga0157372_10038780 3300013307 Bacteria 5257
121 Ga0157372_10189453 3300013307 Bacteria 2382
122 Ga0157372_10194329 3300013307 Bacteria 2351
123 Ga0157372_10952105 3300013307 Bacteria 995
124 Ga0182008_10027720 3300014497 Bacteria 2867
125 Ga0182006_1000018 3300015261 Bacteria 299376
126 Ga0182007_10022136 3300015262 Bacteria 2248
127 Ga0183366_1001 3300015679 Bacteria 2743932
128 Ga0183370_1001 3300015680 Bacteria 2743932
129 Ga0183369_1001 3300015685 Bacteria 2743932
130 Ga0183368_1001 3300015687 Bacteria 2743932
131 Ga0163161_10000003 3300017792 Bacteria 339847
132 Ga0213876_10000023 3300021384 Bacteria 255370
133 Ga0209760_100138 3300025207 Bacteria 46217
134 Ga0209784_100001 3300025224 Bacteria 3600592
135 Ga0209566_100001 3300025225 Bacteria 3600765
136 Ga0209674_100002 3300025226 Bacteria 3600592
137 Ga0209563_100002 3300025230 Bacteria 2045675
138 Ga0207427_100009 3300025231 Bacteria 663036
139 Ga0209437_100001 3300025233 Bacteria 2045675
140 Ga0209437_100103 3300025233 Bacteria 221904
141 Ga0209677_100002 3300025253 Bacteria 2045675
142 Ga0209129_1000037 3300025258 Bacteria 326534
143 Ga0209233_1003911 3300025261 Bacteria 5171
144 Ga0207656_10033075 3300025321 Bacteria 2152
145 Ga0207696_1000001 3300025711 Bacteria 2579611
146 Ga0207696_1000013 3300025711 Bacteria 524881
147 Ga0207696_1000029 3300025711 Bacteria 398074
148 Ga0207696_1000053 3300025711 Bacteria 268590
149 Ga0207696_1000124 3300025711 Bacteria 139229
150 Ga0207696_1000296 3300025711 Bacteria 58111
151 Ga0207696_1000442 3300025711 Bacteria 36954
152 Ga0207696_1001588 3300025711 Bacteria 12013
153 Ga0207696_1003108 3300025711 Bacteria 7738
154 Ga0207696_1009246 3300025711 Bacteria 3685
155 Ga0207696_1019078 3300025711 Bacteria 2240
156 Ga0207696_1048971 3300025711 Bacteria 1213
157 Ga0207655_1000002 3300025728 Bacteria 1148694
158 Ga0207655_1000004 3300025728 Bacteria 1021221
159 Ga0207655_1000007 3300025728 Bacteria 773492
160 Ga0207655_1000036 3300025728 Bacteria 356747
161 Ga0207655_1000041 3300025728 Bacteria 333962
162 Ga0207655_1000359 3300025728 Bacteria 64874
163 Ga0207655_1000649 3300025728 Bacteria 41592
164 Ga0207655_1001593 3300025728 Bacteria 20322
165 Ga0207655_1002132 3300025728 Bacteria 16490
166 Ga0207655_1004420 3300025728 Bacteria 9978
167 Ga0207655_1004664 3300025728 Bacteria 9612
168 Ga0207655_1010241 3300025728 Bacteria 5706
169 Ga0207655_1015431 3300025728 Bacteria 4247
170 Ga0207655_1043928 3300025728 Bacteria 1883
171 Ga0207713_1000001 3300025735 Bacteria 2295391
172 Ga0207713_1000004 3300025735 Bacteria 702781
173 Ga0207713_1000018 3300025735 Bacteria 362635
174 Ga0207713_1000022 3300025735 Bacteria 351775
175 Ga0207713_1000023 3300025735 Bacteria 346097
176 Ga0207713_1000047 3300025735 Bacteria 229463
177 Ga0207713_1001451 3300025735 Bacteria 18899
178 Ga0207713_1005490 3300025735 Bacteria 7915
179 Ga0207713_1014791 3300025735 Bacteria 4031
180 Ga0207713_1034081 3300025735 Bacteria 2216
181 Ga0207713_1035731 3300025735 Bacteria 2141
182 Ga0207713_1036026 3300025735 Bacteria 2127
183 Ga0207713_1040716 3300025735 Bacteria 1946
184 Ga0207713_1046336 3300025735 Bacteria 1769
185 Ga0207710_10000116 3300025900 Bacteria 99007
186 Ga0207654_10000004 3300025911 Bacteria 902334
187 Ga0207707_10110887 3300025912 Unclassified 2398
188 Ga0207690_10136924 3300025932 Bacteria 1799
189 Ga0207709_10029252 3300025935 Bacteria 3193
190 Ga0207670_10033442 3300025936 Unclassified 3313
191 Ga0207668_10019931 3300025972 Bacteria 4251
192 Ga0207702_10448185 3300026078 Bacteria 1252
193 Ga0207676_10425049 3300026095 Unclassified 1247
194 Ga0207674_10002026 3300026116 Bacteria 25721
195 Ga0209281_1000004 3300027111 Bacteria 1253949
196 Ga0209281_1000006 3300027111 Bacteria 1170244
197 Ga0209281_1000014 3300027111 Bacteria 643021
198 Ga0209281_1000038 3300027111 Bacteria 361154
199 Ga0209281_1000300 3300027111 Bacteria 89506
200 Ga0209281_1000379 3300027111 Bacteria 70495
201 Ga0209281_1000464 3300027111 Bacteria 57109
202 Ga0209281_1000473 3300027111 Bacteria 56260
203 Ga0209281_1000597 3300027111 Bacteria 41134
204 Ga0209281_1000672 3300027111 Bacteria 35791
205 Ga0209281_1002295 3300027111 Bacteria 8035
206 Ga0209371_1000001 3300027312 Bacteria 2771503
207 Ga0209371_1000002 3300027312 Bacteria 1551985
208 Ga0209371_1000005 3300027312 Bacteria 1061740
209 Ga0209371_1000015 3300027312 Bacteria 659640
210 Ga0209371_1000100 3300027312 Bacteria 154467
211 Ga0209371_1000216 3300027312 Bacteria 78017
212 Ga0209371_1000262 3300027312 Bacteria 62261
213 Ga0209371_1000389 3300027312 Bacteria 46271
214 Ga0209371_1000947 3300027312 Bacteria 22582
215 Ga0209371_1001072 3300027312 Bacteria 20478
216 Ga0209371_1001085 3300027312 Bacteria 20327
217 Ga0209371_1001902 3300027312 Bacteria 12788
218 Ga0209371_1001946 3300027312 Bacteria 12543
219 Ga0209371_1004339 3300027312 Bacteria 6239
220 Ga0209371_1005229 3300027312 Bacteria 5242
221 Ga0209371_1007904 3300027312 Bacteria 3617
222 Ga0209371_1013556 3300027312 Bacteria 2281
223 Ga0268266_10002326 3300028379 Bacteria 20593
224 Ga0268266_10005650 3300028379 Bacteria 11601
225 Ga0268265_10346450 3300028380 Unclassified 1355
226 Ga0265334_10063480 3300028573 Bacteria 1388
227 Ga0265338_10356126 3300028800 Unclassified 1051
228 Ga0268256_1000001 3300030500 Bacteria 2771065
229 Ga0268256_1000002 3300030500 Bacteria 1535763
230 Ga0268256_1000006 3300030500 Bacteria 1063991
231 Ga0268256_1000018 3300030500 Bacteria 594572
232 Ga0268256_1000035 3300030500 Bacteria 384794
233 Ga0268256_1000089 3300030500 Bacteria 154491
234 Ga0268256_1000842 3300030500 Bacteria 21773
235 Ga0268256_1000902 3300030500 Bacteria 20478
236 Ga0268256_1001703 3300030500 Bacteria 12543
237 Ga0268256_1002768 3300030500 Bacteria 8523
238 Ga0268256_1003005 3300030500 Bacteria 7966
239 Ga0268256_1006284 3300030500 Bacteria 4452
240 Ga0268256_1008190 3300030500 Bacteria 3617
241 Ga0268256_1014964 3300030500 Bacteria 2281
242 Ga0436365_0965775 3300039437 Bacteria 470291
243 Ga0439438_000002 3300041405 Bacteria 618223
244 Ga0439438_000477 3300041405 Bacteria 18105
245 Ga0439438_004782 3300041405 Bacteria 5113
246 Ga0439438_033808 3300041405 Bacteria 1349
247 Ga0439447_001364 3300041407 Bacteria 8917
248 Ga0439447_002947 3300041407 Bacteria 6098
249 Ga0439447_004736 3300041407 Bacteria 4635
250 Ga0439466_0000001 3300041411 Bacteria 647258
251 Ga0451853_1670835 3300041512 Bacteria 2255
252 Ga0439432_000380 3300042006 Bacteria 16421
253 Ga0439432_006040 3300042006 Bacteria 4346
254 Ga0439432_006734 3300042006 Bacteria 4093
255 Ga0439432_015741 3300042006 Bacteria 2549
256 Ga0439432_046623 3300042006 Bacteria 1361
257 Ga0439452_000001 3300042010 Bacteria 1725439
258 Ga0439452_000002 3300042010 Bacteria 1377577
259 Ga0439452_000020 3300042010 Bacteria 309345
260 Ga0439452_000032 3300042010 Bacteria 184797
261 Ga0439452_000214 3300042010 Bacteria 40944
262 Ga0439452_011680 3300042010 Bacteria 2516
263 Ga0439452_017005 3300042010 Bacteria 1965
264 Ga0439463_004130 3300042016 Bacteria 3648
265 Ga0450902_000606 3300042137 Bacteria 4554
266 Ga0450907_000334 3300042146 Bacteria 14859
267 Ga0439464_0001343 3300042439 Bacteria 5750
268 Ga0439464_0001475 3300042439 Bacteria 5561
269 Ga0439464_0056401 3300042439 Bacteria 1144
270 Ga0466981_0000003 3300044669 Bacteria 248458
271 Ga0453684_0279731 3300044712 Bacteria 1904
272 Ga0495627_000019 3300046453 Bacteria 309691
273 Ga0495591_000001 3300046458 Bacteria 503087
274 Ga0495591_000175 3300046458 Bacteria 66184
275 Ga0495591_000815 3300046458 Bacteria 22065
276 Ga0495591_005986 3300046458 Bacteria 5489
277 Ga0495591_039017 3300046458 Bacteria 1363
278 Ga0495638_0007173 3300046460 Bacteria 8024
279 Ga0495650_0000018 3300046471 Bacteria 538888
280 Ga0495650_0000047 3300046471 Bacteria 335136
281 Ga0495650_0000065 3300046471 Bacteria 275124
282 Ga0495605_0017190 3300046474 Bacteria 3898
283 Ga0495584_0018433 3300046491 Bacteria 3547
284 Ga0495585_0028752 3300046492 Bacteria 3168
285 Ga0495594_0236709 3300046499 Unclassified 1041
286 Ga0495596_0001927 3300046500 Bacteria 11499
287 Ga0495606_0000930 3300046507 Bacteria 43161
288 Ga0495620_0021798 3300046515 Bacteria 3103
289 Ga0495630_0200745 3300046517 Unclassified 1522
290 Ga0495631_0091085 3300046518 Bacteria 1313
291 Ga0495632_0077953 3300046519 Bacteria 1584
292 Ga0495637_0113821 3300046520 Bacteria 1046
293 Ga0495643_0014552 3300046522 Bacteria 4678
294 Ga0495643_0082375 3300046522 Bacteria 1672
295 Ga0495644_0009132 3300046523 Bacteria 3819
296 Ga0495648_0004278 3300046524 Bacteria 12243
297 Ga0495654_0000009 3300046530 Bacteria 381872
298 Ga0495654_0000529 3300046530 Bacteria 30931
299 Ga0495654_0000612 3300046530 Bacteria 28400
300 Ga0495654_0025247 3300046530 Bacteria 3062
301 Ga0495668_0016631 3300046616 Bacteria 4276
302 Ga0495625_0001758 3300046660 Bacteria 25035
303 Ga0495588_0003339 3300046674 Bacteria 6970
304 Ga0495669_0064128 3300046684 Bacteria 1667
305 Ga0495671_0005703 3300046692 Bacteria 7258
306 Ga0495649_0002071 3300046694 Bacteria 14426
307 Ga0495649_0002141 3300046694 Bacteria 14126
308 Ga0495589_0000003 3300046794 Bacteria 453448
309 Ga0495660_0000004 3300046810 Bacteria 1003183
310 Ga0495660_0000015 3300046810 Bacteria 324892
311 Ga0495660_0021096 3300046810 Bacteria 3732
312 Ga0495672_0000001 3300047320 Bacteria 1458820
313 Ga0495672_0000009 3300047320 Bacteria 557755
314 Ga0495672_0000038 3300047320 Bacteria 273489
315 Ga0495683_0036023 3300047323 Bacteria 2513
316 Ga0495679_000113 3300047446 Bacteria 72806
317 Ga0495679_001509 3300047446 Bacteria 13164
318 Ga0495679_004889 3300047446 Bacteria 6048
319 Ga0495673_0000019 3300047469 Bacteria 554389
320 Ga0495673_0000114 3300047469 Bacteria 159048
321 Ga0495681_0014827 3300047470 Bacteria 4447
322 Ga0495681_0024950 3300047470 Bacteria 3135
323 Ga0496100_0051634 3300048903 Bacteria 2670
324 Ga0496100_0056691 3300048903 Bacteria 2564
325 Ga0496101_0000169 3300048904 Bacteria 54000
326 Ga0496101_0062965 3300048904 Bacteria 2699
327 Ga0496102_0015929 3300048905 Bacteria 6560
328 Ga0496103_0007453 3300048906 Bacteria 6522
329 Ga0496104_0000250 3300048907 Bacteria 47643
330 Ga0496104_0003114 3300048907 Bacteria 14306
331 Ga0496104_0353053 3300048907 Bacteria 1383
332 Ga0496105_0048278 3300048908 Bacteria 3514
333 Ga0496105_0050287 3300048908 Bacteria 3442
334 Ga0496105_0278650 3300048908 Bacteria 1349
335 Ga0496116_0000007 3300048919 Bacteria 795464
336 Ga0496116_0000110 3300048919 Bacteria 185668
337 Ga0496116_0000118 3300048919 Bacteria 168946
338 Ga0496116_0000132 3300048919 Bacteria 156427
339 Ga0496116_0002735 3300048919 Bacteria 18118
340 Ga0496116_0005619 3300048919 Bacteria 11551
341 Ga0496116_0040055 3300048919 Bacteria 3230
342 Ga0496116_0047346 3300048919 Bacteria 2894
343 Ga0496116_0049322 3300048919 Bacteria 2816
344 Ga0496116_0087335 3300048919 Bacteria 1909
345 Ga0496116_0091164 3300048919 Bacteria 1852
346 Ga0496117_0000009 3300048920 Bacteria 613759
347 Ga0496117_0000113 3300048920 Bacteria 181737
348 Ga0496117_0000723 3300048920 Bacteria 52069
349 Ga0496117_0001854 3300048920 Bacteria 28514
350 Ga0496117_0002247 3300048920 Bacteria 24923
351 Ga0496117_0003803 3300048920 Bacteria 17204
352 Ga0496117_0007131 3300048920 Bacteria 11044
353 Ga0496117_0009318 3300048920 Bacteria 9157
354 Ga0496117_0049173 3300048920 Bacteria 3002
355 Ga0496117_0066727 3300048920 Bacteria 2438
356 Ga0496117_0088369 3300048920 Bacteria 2005
357 Ga0496118_0000017 3300048921 Bacteria 549445
358 Ga0496118_0000484 3300048921 Bacteria 65796
359 Ga0496118_0000544 3300048921 Bacteria 61985
360 Ga0496118_0000961 3300048921 Bacteria 44977
361 Ga0496118_0002191 3300048921 Bacteria 27151
362 Ga0496118_0004182 3300048921 Bacteria 17364
363 Ga0496118_0004735 3300048921 Bacteria 15924
364 Ga0496118_0012421 3300048921 Bacteria 8179
365 Ga0496118_0016692 3300048921 Bacteria 6724
366 Ga0496118_0055139 3300048921 Bacteria 3002
367 Ga0496118_0178884 3300048921 Bacteria 1284
368 Ga0496119_0000012 3300048922 Bacteria 411917
369 Ga0496119_0000049 3300048922 Bacteria 185482
370 Ga0496119_0000167 3300048922 Bacteria 91883
371 Ga0496119_0000807 3300048922 Bacteria 41929
372 Ga0496119_0001408 3300048922 Bacteria 29115
373 Ga0496119_0001500 3300048922 Bacteria 27903
374 Ga0496119_0001717 3300048922 Bacteria 25562
375 Ga0496119_0003846 3300048922 Bacteria 15337
376 Ga0496119_0005111 3300048922 Bacteria 12730
377 Ga0496119_0015813 3300048922 Bacteria 5779
378 Ga0496119_0027874 3300048922 Bacteria 3869
379 Ga0496119_0030276 3300048922 Bacteria 3654
380 Ga0496119_0030511 3300048922 Bacteria 3632
381 Ga0496119_0036720 3300048922 Bacteria 3194
382 Ga0496119_0279481 3300048922 Bacteria 830
383 Ga0496120_0000004 3300048923 Bacteria 534793
384 Ga0496120_0000048 3300048923 Bacteria 187988
385 Ga0496120_0000057 3300048923 Bacteria 177460
386 Ga0496120_0000198 3300048923 Bacteria 103186
387 Ga0496120_0000411 3300048923 Bacteria 68454
388 Ga0496120_0000441 3300048923 Bacteria 65743
389 Ga0496120_0000991 3300048923 Bacteria 38461
390 Ga0496120_0001544 3300048923 Bacteria 26984
391 Ga0496120_0002889 3300048923 Bacteria 16460
392 Ga0496120_0006293 3300048923 Bacteria 9154
393 Ga0496120_0020132 3300048923 Bacteria 4249
394 Ga0496120_0049534 3300048923 Bacteria 2411
395 Ga0496120_0075878 3300048923 Bacteria 1833
396 Ga0496121_0000912 3300048924 Bacteria 53301
397 Ga0496121_0003659 3300048924 Bacteria 21616
398 Ga0496121_0005425 3300048924 Bacteria 16365
399 Ga0496121_0009259 3300048924 Bacteria 11370
400 Ga0496121_0017628 3300048924 Bacteria 7275
401 Ga0496121_0051925 3300048924 Bacteria 3448
402 Ga0496121_0067527 3300048924 Bacteria 2897
403 Ga0496121_0151553 3300048924 Bacteria 1705
404 Ga0496122_0000003 3300048925 Bacteria 645810
405 Ga0496122_0000088 3300048925 Bacteria 207600
406 Ga0496122_0000135 3300048925 Bacteria 170955
407 Ga0496122_0001369 3300048925 Bacteria 39655
408 Ga0496122_0002208 3300048925 Bacteria 28409
409 Ga0496122_0004930 3300048925 Bacteria 16182
410 Ga0496122_0005358 3300048925 Bacteria 15324
411 Ga0496122_0018660 3300048925 Bacteria 6388
412 Ga0496122_0115360 3300048925 Bacteria 1750
413 Ga0496122_0137823 3300048925 Bacteria 1533
414 Ga0496122_0149756 3300048925 Bacteria 1442
415 Ga0496123_0000004 3300048926 Bacteria 777230
416 Ga0496123_0000012 3300048926 Bacteria 458760
417 Ga0496123_0000606 3300048926 Bacteria 60830
418 Ga0496123_0001200 3300048926 Bacteria 37939
419 Ga0496123_0002256 3300048926 Bacteria 24312
420 Ga0496123_0002847 3300048926 Bacteria 20428
421 Ga0496123_0003991 3300048926 Bacteria 15973
422 Ga0496123_0004719 3300048926 Bacteria 14102
423 Ga0496123_0036956 3300048926 Bacteria 3454
424 Ga0496123_0039710 3300048926 Bacteria 3288
425 Ga0496123_0079007 3300048926 Bacteria 2012
426 Ga0496124_0000027 3300048927 Bacteria 376097
427 Ga0496124_0000028 3300048927 Bacteria 357219
428 Ga0496124_0000045 3300048927 Bacteria 287396
429 Ga0496124_0000165 3300048927 Bacteria 134661
430 Ga0496124_0000992 3300048927 Bacteria 44940
431 Ga0496124_0004198 3300048927 Bacteria 16961
432 Ga0496124_0007518 3300048927 Bacteria 11568
433 Ga0496124_0012042 3300048927 Bacteria 8592
434 Ga0496124_0013200 3300048927 Bacteria 8079
435 Ga0496124_0015958 3300048927 Bacteria 7169
436 Ga0496124_0057367 3300048927 Bacteria 3281
437 Ga0496124_0108042 3300048927 Bacteria 2244
438 Ga0496124_0165755 3300048927 Bacteria 1717
439 Ga0496124_0257765 3300048927 Bacteria 1285
440 Ga0496124_0298260 3300048927 Bacteria 1165
441 Ga0496125_0000091 3300048928 Bacteria 212668
442 Ga0496125_0002318 3300048928 Bacteria 25090
443 Ga0496125_0004369 3300048928 Bacteria 16377
444 Ga0496125_0011610 3300048928 Bacteria 8799
445 Ga0496125_0047341 3300048928 Bacteria 3597
446 Ga0496125_0102095 3300048928 Bacteria 2108
447 Ga0496125_0352733 3300048928 Bacteria 878
448 Ga0496126_0004558 3300048929 Bacteria 16461
449 Ga0496126_0005305 3300048929 Bacteria 14795
450 Ga0496126_0034376 3300048929 Bacteria 4760
451 Ga0496126_0041048 3300048929 Bacteria 4286
452 Ga0496126_0048867 3300048929 Bacteria 3863
453 Ga0496126_0054543 3300048929 Bacteria 3619
454 Ga0496126_0098720 3300048929 Bacteria 2559
455 Ga0496126_0157685 3300048929 Bacteria 1941
456 Ga0496126_0168159 3300048929 Bacteria 1870
457 Ga0496126_0188218 3300048929 Bacteria 1749
458 Ga0496126_0335127 3300048929 Bacteria 1240
459 Ga0495678_001440 3300049459 Bacteria 18715
460 Ga0495678_013300 3300049459 Bacteria 3870
461 Ga0495682_0000001 3300049460 Bacteria 1559116
462 nmdc:mga00v17_1516_c1 3300050491 Bacteria 12130
463 nmdc:mga00v17_35621_c1 3300050491 Bacteria 2963
464 nmdc:mga09592_160331_c1 3300050508 Unclassified 1943
465 Ga0500621_000002 3300053126 Bacteria 849473
466 2506579469 2506520007 Bacteria 5442880
467 2506584608 2506520008 Bacteria 5443009
468 2508853313 2508501071 Bacteria 5454741
469 2511380006 2511231025 Bacteria 5324661
470 2511434993 2511231035 Bacteria 5341610
471 2547697261 2547132181 Bacteria 4945084
472 2548648922 2547132416 Bacteria 4633861
473 2555259779 2554235234 Bacteria 5762085
474 2562463473 2561511199 Bacteria 5155034
475 2585827780 2585427591 Bacteria 5482980
476 2585834657 2585427592 Bacteria 5370892
477 2599411325 2599185169 Bacteria 5441380
478 2599926456 2599185299 Bacteria 4854625
479 2601524320 2600255254 Bacteria 5281859
480 2601529474 2600255255 Bacteria 5282785
481 2601534956 2600255256 Bacteria 5597742
482 2601539415 2600255257 Bacteria 5597196
483 2601616308 2600255280 Bacteria 5292309
484 2601621030 2600255281 Bacteria 5288753
485 2601644377 2600255287 Bacteria 5210468
486 2601649427 2600255288 Bacteria 5282738
487 2601654354 2600255289 Bacteria 5281907
488 2601659776 2600255290 Bacteria 5282218
489 2601664199 2600255291 Bacteria 5217298
490 2601697159 2600255298 Bacteria 5215185
491 2601702205 2600255299 Bacteria 5218662
492 2601707098 2600255300 Bacteria 5287774
493 2601711950 2600255301 Bacteria 5280532
494 2601717615 2600255302 Bacteria 5288235
495 2601722115 2600255303 Bacteria 5219315
496 2601727543 2600255304 Bacteria 5283973
497 2601732392 2600255305 Bacteria 5282329
498 2601737093 2600255306 Bacteria 5281613
499 2601741375 2600255307 Bacteria 5439064
500 2601752371 2600255309 Bacteria 5431045
501 2601757765 2600255310 Bacteria 5600903
502 2601764123 2600255311 Bacteria 5598766
503 2602019212 2600255392 Bacteria 5437392
504 2603636933 2602042046 Bacteria 5483348
505 2603644891 2602042047 Bacteria 4697674
506 2603662362 2602042052 Bacteria 5215873
507 2603667258 2602042053 Bacteria 5214361
508 2603699280 2602042066 Bacteria 4423871
509 2603705313 2602042067 Bacteria 4863713
510 2603839967 2602042103 Bacteria 5284714
511 2603845044 2602042104 Bacteria 5281639
512 2603849952 2602042105 Bacteria 5282303
513 2603855185 2602042106 Bacteria 5282744
514 2603867999 2602042109 Bacteria 5152801
515 2603872765 2602042110 Bacteria 5283285
516 2603878069 2602042111 Bacteria 5212080
517 2606049778 2603880178 Bacteria 5283018
518 2606071438 2603880184 Bacteria 5217896
519 2606147629 2603880202 Bacteria 5284684
520 2606177667 2603880211 Bacteria 5284226
521 2608669984 2608642108 Bacteria 4104624
522 2609909717 2609459761 Bacteria 5513740
523 2637224145 2636415599 Bacteria 5718434
524 2650897200 2648501693 Bacteria 5069560
525 2656275987 2654587920 Bacteria 5475511
526 2671101185 2667528172 Bacteria 5170840
527 2671107049 2667528173 Bacteria 5375747
528 2671584598 2671180115 Bacteria 5353919
529 2676405550 2675903046 Bacteria 5451247
530 2681996278 2681812866 Bacteria 4552357
531 2682006376 2681812869 Bacteria 5014465
532 2686354108 2684622997 Bacteria 4624240
533 2689446044 2687453601 Bacteria 5546041
534 2707100504 2706794495 Bacteria 4536932
535 2712468977 2711768156 Bacteria 4471618
536 2753856860 2751185917 Bacteria 4551186
537 2765589955 2765235842 Bacteria 4799256
538 2772439926 2772190666 Bacteria 5117644
539 2775541363 2775506706 Bacteria 4873073
540 2777020882 2775507074 Bacteria 5532402
541 2791922239 2791354903 Bacteria 4937680
542 2792312085 2791355010 Bacteria 4864581
543 2793404795 2791355275 Bacteria 4429597
544 2807180019 2806310673 Bacteria 4801221
545 2809125661 2808606414 Bacteria 4917181
546 2813727944 2811995292 Bacteria 5303342
547 2814695486 2814123068 Bacteria 5687681
548 2821120984 2821118458 Bacteria 4714306
549 2823375609 2823373977 Bacteria 4779415
550 2844428303 2844425489 Bacteria 4854065
551 2844529084 2844528606 Bacteria 4733806
552 2846543321 2846540461 Bacteria 5471451
553 2847086676 2847085930 Bacteria 5070450
554 2847799036 2847797336 Bacteria 5176640
555 2852103910 2852103415 Bacteria 5193810
556 2854605263 2854601825 Bacteria 4797592
557 2865016494 2865014394 Bacteria 4764573
558 2869555389 2869551831 Bacteria 5474685
559 2876603322 2876601092 Bacteria 5114497
560 2881612854 2881609920 Bacteria 4405319
561 2884087994 2884086401 Bacteria 5005459
562 2888370035 2888366609 Bacteria 5155009
563 2888377464 2888373701 Bacteria 5098052
564 2891671530 2891670763 Bacteria 4967099
565 2904475978 2904474040 Bacteria 5504324
566 2904506376 2904504865 Bacteria 5152820
567 2904515459 2904513164 Bacteria 5476410
568 2908672373 2908669403 Bacteria 5740494
569 2919110890 2919108558 Bacteria 5897419
570 2919152147 2919150387 Bacteria 5500879
571 2923635769 2923634449 Bacteria 4753480
572 2927144816 2927143783 Bacteria 5504251
573 2927837729 2927833300 Bacteria 4923934
574 2932410574 2932406140 Bacteria 5134491
575 2935625820 2935625433 Bacteria 5042964
576 2937542511 2937539931 Bacteria 4639830
577 2937968570 2937967321 Bacteria 5094075
578 2939569979 2939568625 Bacteria 4542555
579 2939575269 2939573065 Bacteria 4926053
580 2939581957 2939577877 Bacteria 5132791
581 2939604758 2939602548 Bacteria 4950493
582 2939608737 2939607340 Bacteria 4719256
583 2939618431 2939617950 Bacteria 4820956
584 2939643002 2939642701 Bacteria 4475280
585 2945876906 2945874760 Bacteria 5527237
586 2945952273 2945951305 Bacteria 4918162
587 2969081180 2969079654 Bacteria 5439582
588 2971822566 2971820967 Bacteria 5823634
589 2974311159 2974310843 Bacteria 4947816
590 2974439226 2974435778 Bacteria 4876478
591 2978978750 2978975091 Bacteria 4704313
592 2984497472 2984494565 Bacteria 5000175
593 2984563638 2984559226 Bacteria 5683096
594 2984596372 2984595703 Bacteria 5682994
595 2990261422 2990261002 Bacteria 4919493
596 3000378430 3000376612 Bacteria 4705565
597 640938795 640753048 Bacteria 5495657
598 8004596100 8004592986 Bacteria 5122074
599 8015396605 8015394850 Bacteria 5064660
600 8016735115 8016733728 Bacteria 5274317
601 8018222583 8018221730 Bacteria 4616064
602 8018409307 8018405270 Bacteria 4978981
603 8019501402 8019499862 Bacteria 5169538
604 8019505231 8019504834 Bacteria 4819156
605 8054846576 8054844752 Bacteria 4450330
606 8054851913 8054849141 Bacteria 5232694
607 8055092108 8055087960 Bacteria 4784273
608 8055095441 8055092621 Bacteria 4873875
609 8055100144 8055097453 Bacteria 4865496
610 8055696745 8055693939 Bacteria 4772047
611 8057306834 8057304971 Bacteria 4649742
612 Ga0068864_100574296
613 SwRhRL2b_contig_1329075
614 JGI24739J22299_10000567
615 JGI25162J39368_1000002
616 JGI25162J39368_1001702
617 JGI25163J39215_1001254
618 JGI25164J39214_1000098
619 JGI25152J39213_1000995
620 rootH2_10024276
621 Ga0055538_1000003
622 Ga0055539_1000003
623 Ga0055533_1000005
624 Ga0055525_1000005
625 Ga0055541_1000003
626 Ga0058692_1000106
627 Ga0058692_1000175
628 Ga0058692_1000395
629 Ga0058692_1000855
630 Ga0058692_1001429
631 Ga0058692_1001949
632 Ga0058692_1007602
633 Ga0058692_1023535
634 Ga0065703_1018888
635 Ga0065704_10000327
636 Ga0065704_10000732
637 Ga0065704_10000978
638 Ga0065704_10076269
639 Ga0065704_10089745
640 Ga0070689_100032277
641 Ga0070674_100137777
642 Ga0070674_100678773
643 Ga0070688_100018097
644 Ga0070659_100386593
645 Ga0070705_100428066
646 Ga0070681_10090634
647 Ga0070681_10851216
648 Ga0070685_10414909
649 Ga0070679_100129040
650 Ga0070665_100000276
651 Ga0070665_100002172
652 Ga0068857_100000064
653 Ga0068859_100162265
654 Ga0068851_10035723
655 Ga0081455_10003913
656 Ga0075364_10003640
657 Ga0075364_10026033
658 Ga0075364_10028840
659 Ga0075364_10048831
660 Ga0075432_10082190
661 Ga0075366_10087467
662 Ga0097620_100162282
663 Ga0079104_1000018
664 Ga0079104_1000182
665 Ga0079104_1000293
666 Ga0079104_1000407
667 Ga0079104_1001296
668 Ga0079104_1003121
669 Ga0079104_1015315
670 Ga0105251_10000045
671 Ga0105251_10000258
672 Ga0105251_10000458
673 Ga0105251_10003308
674 Ga0105251_10004070
675 Ga0105251_10005319
676 Ga0105251_10012087
677 Ga0105251_10015556
678 Ga0105251_10025171
679 Ga0105251_10074560
680 Ga0105244_10000009
681 Ga0105244_10000040
682 Ga0105244_10000714
683 Ga0105244_10001316
684 Ga0105244_10001320
685 Ga0105244_10001390
686 Ga0105244_10001391
687 Ga0105244_10003921
688 Ga0105244_10004681
689 Ga0105244_10005561
690 Ga0105244_10019872
691 Ga0105244_10020677
692 Ga0105244_10268441
693 Ga0105250_10000007
694 Ga0105250_10000018
695 Ga0105250_10000054
696 Ga0105250_10000233
697 Ga0105250_10002333
698 Ga0105250_10004697
699 Ga0105250_10004948
700 Ga0105250_10007526
701 Ga0105250_10007655
702 Ga0105250_10062798
703 Ga0105250_10127744
704 Ga0111539_10604470
705 Ga0105247_10000100
706 Ga0105243_10001641
707 Ga0105241_10000001
708 Ga0105246_10039252
709 Ga0105246_10086371
710 Ga0105246_10237120
711 Ga0157373_10000270
712 Ga0157373_10001635
713 Ga0157373_10002612
714 Ga0157371_10000006
715 Ga0157371_10000859
716 Ga0157371_10003773
717 Ga0157371_10007580
718 Ga0157371_10009468
719 Ga0157371_10019331
720 Ga0157371_10489624
721 Ga0157370_10001215
722 Ga0157370_10005087
723 Ga0157370_10006193
724 Ga0157369_10003193
725 Ga0157374_10651418
726 Ga0163162_10019288
727 Ga0163162_10104194
728 Ga0163162_10343894
729 Ga0157372_10008247
730 Ga0157372_10013110
731 Ga0157372_10038780
732 Ga0157372_10189453
733 Ga0157372_10194329
734 Ga0157372_10952105
735 Ga0182008_10027720
736 Ga0182006_1000018
737 Ga0182007_10022136
738 Ga0183366_1001
739 Ga0183370_1001
740 Ga0183369_1001
741 Ga0183368_1001
742 Ga0163161_10000003
743 Ga0213876_10000023
744 Ga0209760_100138
745 Ga0209784_100001
746 Ga0209566_100001
747 Ga0209674_100002
748 Ga0209563_100002
749 Ga0207427_100009
750 Ga0209437_100001
751 Ga0209437_100103
752 Ga0209677_100002
753 Ga0209129_1000037
754 Ga0209233_1003911
755 Ga0207656_10033075
756 Ga0207696_1000001
757 Ga0207696_1000013
758 Ga0207696_1000029
759 Ga0207696_1000053
760 Ga0207696_1000124
761 Ga0207696_1000296
762 Ga0207696_1000442
763 Ga0207696_1001588
764 Ga0207696_1003108
765 Ga0207696_1009246
766 Ga0207696_1019078
767 Ga0207696_1048971
768 Ga0207655_1000002
769 Ga0207655_1000004
770 Ga0207655_1000007
771 Ga0207655_1000036
772 Ga0207655_1000041
773 Ga0207655_1000359
774 Ga0207655_1000649
775 Ga0207655_1001593
776 Ga0207655_1002132
777 Ga0207655_1004420
778 Ga0207655_1004664
779 Ga0207655_1010241
780 Ga0207655_1015431
781 Ga0207655_1043928
782 Ga0207713_1000001
783 Ga0207713_1000004
784 Ga0207713_1000018
785 Ga0207713_1000022
786 Ga0207713_1000023
787 Ga0207713_1000047
788 Ga0207713_1001451
789 Ga0207713_1005490
790 Ga0207713_1014791
791 Ga0207713_1034081
792 Ga0207713_1035731
793 Ga0207713_1036026
794 Ga0207713_1040716
795 Ga0207713_1046336
796 Ga0207710_10000116
797 Ga0207654_10000004
798 Ga0207707_10110887
799 Ga0207690_10136924
800 Ga0207709_10029252
801 Ga0207670_10033442
802 Ga0207668_10019931
803 Ga0207702_10448185
804 Ga0207676_10425049
805 Ga0207674_10002026
806 Ga0209281_1000004
807 Ga0209281_1000006
808 Ga0209281_1000014
809 Ga0209281_1000038
810 Ga0209281_1000300
811 Ga0209281_1000379
812 Ga0209281_1000464
813 Ga0209281_1000473
814 Ga0209281_1000597
815 Ga0209281_1000672
816 Ga0209281_1002295
817 Ga0209371_1000001
818 Ga0209371_1000002
819 Ga0209371_1000005
820 Ga0209371_1000015
821 Ga0209371_1000100
822 Ga0209371_1000216
823 Ga0209371_1000262
824 Ga0209371_1000389
825 Ga0209371_1000947
826 Ga0209371_1001072
827 Ga0209371_1001085
828 Ga0209371_1001902
829 Ga0209371_1001946
830 Ga0209371_1004339
831 Ga0209371_1005229
832 Ga0209371_1007904
833 Ga0209371_1013556
834 Ga0268266_10002326
835 Ga0268266_10005650
836 Ga0268265_10346450
837 Ga0265334_10063480
838 Ga0265338_10356126
839 Ga0268256_1000001
840 Ga0268256_1000002
841 Ga0268256_1000006
842 Ga0268256_1000018
843 Ga0268256_1000035
844 Ga0268256_1000089
845 Ga0268256_1000842
846 Ga0268256_1000902
847 Ga0268256_1001703
848 Ga0268256_1002768
849 Ga0268256_1003005
850 Ga0268256_1006284
851 Ga0268256_1008190
852 Ga0268256_1014964
853 Ga0436365_0965775
854 Ga0439438_000002
855 Ga0439438_000477
856 Ga0439438_004782
857 Ga0439438_033808
858 Ga0439447_001364
859 Ga0439447_002947
860 Ga0439447_004736
861 Ga0439466_0000001
862 Ga0451853_1670835
863 Ga0439432_000380
864 Ga0439432_006040
865 Ga0439432_006734
866 Ga0439432_015741
867 Ga0439432_046623
868 Ga0439452_000001
869 Ga0439452_000002
870 Ga0439452_000020
871 Ga0439452_000032
872 Ga0439452_000214
873 Ga0439452_011680
874 Ga0439452_017005
875 Ga0439463_004130
876 Ga0450902_000606
877 Ga0450907_000334
878 Ga0439464_0001343
879 Ga0439464_0001475
880 Ga0439464_0056401
881 Ga0466981_0000003
882 Ga0453684_0279731
883 Ga0495627_000019
884 Ga0495591_000001
885 Ga0495591_000175
886 Ga0495591_000815
887 Ga0495591_005986
888 Ga0495591_039017
889 Ga0495638_0007173
890 Ga0495650_0000018
891 Ga0495650_0000047
892 Ga0495650_0000065
893 Ga0495605_0017190
894 Ga0495584_0018433
895 Ga0495585_0028752
896 Ga0495594_0236709
897 Ga0495596_0001927
898 Ga0495606_0000930
899 Ga0495620_0021798
900 Ga0495630_0200745
901 Ga0495631_0091085
902 Ga0495632_0077953
903 Ga0495637_0113821
904 Ga0495643_0014552
905 Ga0495643_0082375
906 Ga0495644_0009132
907 Ga0495648_0004278
908 Ga0495654_0000009
909 Ga0495654_0000529
910 Ga0495654_0000612
911 Ga0495654_0025247
912 Ga0495668_0016631
913 Ga0495625_0001758
914 Ga0495588_0003339
915 Ga0495669_0064128
916 Ga0495671_0005703
917 Ga0495649_0002071
918 Ga0495649_0002141
919 Ga0495589_0000003
920 Ga0495660_0000004
921 Ga0495660_0000015
922 Ga0495660_0021096
923 Ga0495672_0000001
924 Ga0495672_0000009
925 Ga0495672_0000038
926 Ga0495683_0036023
927 Ga0495679_000113
928 Ga0495679_001509
929 Ga0495679_004889
930 Ga0495673_0000019
931 Ga0495673_0000114
932 Ga0495681_0014827
933 Ga0495681_0024950
934 Ga0496100_0051634
935 Ga0496100_0056691
936 Ga0496101_0000169
937 Ga0496101_0062965
938 Ga0496102_0015929
939 Ga0496103_0007453
940 Ga0496104_0000250
941 Ga0496104_0003114
942 Ga0496104_0353053
943 Ga0496105_0048278
944 Ga0496105_0050287
945 Ga0496105_0278650
946 Ga0496116_0000007
947 Ga0496116_0000110
948 Ga0496116_0000118
949 Ga0496116_0000132
950 Ga0496116_0002735
951 Ga0496116_0005619
952 Ga0496116_0040055
953 Ga0496116_0047346
954 Ga0496116_0049322
955 Ga0496116_0087335
956 Ga0496116_0091164
957 Ga0496117_0000009
958 Ga0496117_0000113
959 Ga0496117_0000723
960 Ga0496117_0001854
961 Ga0496117_0002247
962 Ga0496117_0003803
963 Ga0496117_0007131
964 Ga0496117_0009318
965 Ga0496117_0049173
966 Ga0496117_0066727
967 Ga0496117_0088369
968 Ga0496118_0000017
969 Ga0496118_0000484
970 Ga0496118_0000544
971 Ga0496118_0000961
972 Ga0496118_0002191
973 Ga0496118_0004182
974 Ga0496118_0004735
975 Ga0496118_0012421
976 Ga0496118_0016692
977 Ga0496118_0055139
978 Ga0496118_0178884
979 Ga0496119_0000012
980 Ga0496119_0000049
981 Ga0496119_0000167
982 Ga0496119_0000807
983 Ga0496119_0001408
984 Ga0496119_0001500
985 Ga0496119_0001717
986 Ga0496119_0003846
987 Ga0496119_0005111
988 Ga0496119_0015813
989 Ga0496119_0027874
990 Ga0496119_0030276
991 Ga0496119_0030511
992 Ga0496119_0036720
993 Ga0496119_0279481
994 Ga0496120_0000004
995 Ga0496120_0000048
996 Ga0496120_0000057
997 Ga0496120_0000198
998 Ga0496120_0000411
999 Ga0496120_0000441
1000 Ga0496120_0000991
1001 Ga0496120_0001544
1002 Ga0496120_0002889
1003 Ga0496120_0006293
1004 Ga0496120_0020132
1005 Ga0496120_0049534
1006 Ga0496120_0075878
1007 Ga0496121_0000912
1008 Ga0496121_0003659
1009 Ga0496121_0005425
1010 Ga0496121_0009259
1011 Ga0496121_0017628
1012 Ga0496121_0051925
1013 Ga0496121_0067527
1014 Ga0496121_0151553
1015 Ga0496122_0000003
1016 Ga0496122_0000088
1017 Ga0496122_0000135
1018 Ga0496122_0001369
1019 Ga0496122_0002208
1020 Ga0496122_0004930
1021 Ga0496122_0005358
1022 Ga0496122_0018660
1023 Ga0496122_0115360
1024 Ga0496122_0137823
1025 Ga0496122_0149756
1026 Ga0496123_0000004
1027 Ga0496123_0000012
1028 Ga0496123_0000606
1029 Ga0496123_0001200
1030 Ga0496123_0002256
1031 Ga0496123_0002847
1032 Ga0496123_0003991
1033 Ga0496123_0004719
1034 Ga0496123_0036956
1035 Ga0496123_0039710
1036 Ga0496123_0079007
1037 Ga0496124_0000027
1038 Ga0496124_0000028
1039 Ga0496124_0000045
1040 Ga0496124_0000165
1041 Ga0496124_0000992
1042 Ga0496124_0004198
1043 Ga0496124_0007518
1044 Ga0496124_0012042
1045 Ga0496124_0013200
1046 Ga0496124_0015958
1047 Ga0496124_0057367
1048 Ga0496124_0108042
1049 Ga0496124_0165755
1050 Ga0496124_0257765
1051 Ga0496124_0298260
1052 Ga0496125_0000091
1053 Ga0496125_0002318
1054 Ga0496125_0004369
1055 Ga0496125_0011610
1056 Ga0496125_0047341
1057 Ga0496125_0102095
1058 Ga0496125_0352733
1059 Ga0496126_0004558
1060 Ga0496126_0005305
1061 Ga0496126_0034376
1062 Ga0496126_0041048
1063 Ga0496126_0048867
1064 Ga0496126_0054543
1065 Ga0496126_0098720
1066 Ga0496126_0157685
1067 Ga0496126_0168159
1068 Ga0496126_0188218
1069 Ga0496126_0335127
1070 Ga0495678_001440
1071 Ga0495678_013300
1072 Ga0495682_0000001
1073 nmdc:mga00v17_1516_c1
1074 nmdc:mga00v17_35621_c1
1075 nmdc:mga09592_160331_c1
1076 Ga0500621_000002
1077 2506579469
1078 2506584608
1079 2508853313
1080 2511380006
1081 2511434993
1082 2547697261
1083 2548648922
1084 2555259779
1085 2562463473
1086 2585827780
1087 2585834657
1088 2599411325
1089 2599926456
1090 2601524320
1091 2601529474
1092 2601534956
1093 2601539415
1094 2601616308
1095 2601621030
1096 2601644377
1097 2601649427
1098 2601654354
1099 2601659776
1100 2601664199
1101 2601697159
1102 2601702205
1103 2601707098
1104 2601711950
1105 2601717615
1106 2601722115
1107 2601727543
1108 2601732392
1109 2601737093
1110 2601741375
1111 2601752371
1112 2601757765
1113 2601764123
1114 2602019212
1115 2603636933
1116 2603644891
1117 2603662362
1118 2603667258
1119 2603699280
1120 2603705313
1121 2603839967
1122 2603845044
1123 2603849952
1124 2603855185
1125 2603867999
1126 2603872765
1127 2603878069
1128 2606049778
1129 2606071438
1130 2606147629
1131 2606177667
1132 2608669984
1133 2609909717
1134 2637224145
1135 2650897200
1136 2656275987
1137 2671101185
1138 2671107049
1139 2671584598
1140 2676405550
1141 2681996278
1142 2682006376
1143 2686354108
1144 2689446044
1145 2707100504
1146 2712468977
1147 2753856860
1148 2765589955
1149 2772439926
1150 2775541363
1151 2777020882
1152 2791922239
1153 2792312085
1154 2793404795
1155 2807180019
1156 2809125661
1157 2813727944
1158 2814695486
1159 2821120984
1160 2823375609
1161 2844428303
1162 2844529084
1163 2846543321
1164 2847086676
1165 2847799036
1166 2852103910
1167 2854605263
1168 2865016494
1169 2869555389
1170 2876603322
1171 2881612854
1172 2884087994
1173 2888370035
1174 2888377464
1175 2891671530
1176 2904475978
1177 2904506376
1178 2904515459
1179 2908672373
1180 2919110890
1181 2919152147
1182 2923635769
1183 2927144816
1184 2927837729
1185 2932410574
1186 2935625820
1187 2937542511
1188 2937968570
1189 2939569979
1190 2939575269
1191 2939581957
1192 2939604758
1193 2939608737
1194 2939618431
1195 2939643002
1196 2945876906
1197 2945952273
1198 2969081180
1199 2971822566
1200 2974311159
1201 2974439226
1202 2978978750
1203 2984497472
1204 2984563638
1205 2984596372
1206 2990261422
1207 3000378430
1208 640938795
1209 8004596100
1210 8015396605
1211 8016735115
1212 8018222583
1213 8018409307
1214 8019501402
1215 8019505231
1216 8054846576
1217 8054851913
1218 8055092108
1219 8055095441
1220 8055100144
1221 8055696745
1222 8057306834

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01479

S4

S4 domain

19

61

0.97

PF00849

PseudoU_synth_2

RNA pseudouridylate synthase

79

212

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
8d8k-assembly1.cif.gz_D yeast mitochondrial small subunit assembly intermediate (state 2) 0.9363 2 49
4v47-assembly1.cif.gz_BD real space refined coordinates of the 30s and 50s subunits fitted into the low resolution cryo-em map of the ef-g.gtp state of e. coli 70s ribosome 0.9284 2 49
4wqr-assembly2.cif.gz_32 complex of 70s ribosome with trna-phe and mrna with c-a mismatch in the first position in the a-site. 0.9277 2 49
4v5z-assembly1.cif.gz_Ad structure of a mammalian 80s ribosome obtained by docking homology models of the rna and proteins into an 8.7 a cryo-em map 0.9255 2 49
8fr8-assembly1.cif.gz_e structure of mycobacterium smegmatis rsh bound to a 70s translation initiation complex 0.923 2 49
ID Description Score Start End Superfamily
1kslA01 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9935 2 59 3.10.290.10
1vioB01 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.978 1 55 3.10.290.10
1vioB02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Pseudouridine synthase I, catalytic domain, N-terminal subdomain 0.9648 60 231 3.30.70.580
1ksvA02 Alpha Beta;2-Layer Sandwich;Pseudouridine synthase;Pseudouridine synthase 0.9617 65 231 3.30.2350.10
af_O96270_43_101_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9598 1 55 3.10.290.10
ID Description Score Start End GO Terms
AF-A0A4P1AZS3-F1-model_v4 deleted 0.9739 48 221
AF-A0A376ZGL3-F1-model_v4 Pseudouridine synthase (EC 5.4.99.-) 0.9731 1 191 GO:0000455
GO:0003723
GO:0016829
GO:0160136
AF-A0A832N6E7-F1-model_v4 Pseudouridine synthase (EC 5.4.99.-) 0.972 58 231 GO:0001522
GO:0003723
GO:0006364
GO:0009982
GO:0140098
AF-A0A080KAN1-F1-model_v4 deleted 0.9694 65 231
AF-A0A832N6E7-F1-model_v4 Pseudouridine synthase (EC 5.4.99.-) 0.9665 58 231 GO:0001522
GO:0003723
GO:0006364
GO:0009982
GO:0140098

Map