F469060

General Info

Members Datasets Scaffolds Average Seq Length
611 229 611 109

Family's Representative Sequence

Representative Sequence 3300009148|Ga0105243_10184064|Ga0105243_101840641
Length 139
Sequence LFNGLAIVRLAKVKPMSLYRTLVLSLCAASAAIATPALARRNDGNGNQVSVPHPASEAPHLAWLDRPRDQDRAFRDKQQGRSMPLPQIEQRVLPRMGGADYLGPELRGQNLRMKFMDNGRVIWVDVDPRTGRIIGKSGD

Samples

Sample ID Description Type Environment
1 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
6 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
7 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
8 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
9 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
159 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
160 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
161 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
162 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
163 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
164 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
165 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
166 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
167 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
168 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
169 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
170 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
171 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
172 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
173 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
174 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
175 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
176 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
177 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
178 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
179 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
180 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
182 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
183 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
184 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
185 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
186 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
187 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
188 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
189 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
190 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
191 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
192 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
193 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
194 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
195 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
196 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
197 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
198 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
199 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
200 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
201 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
202 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
203 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
204 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
205 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
206 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
207 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
208 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
209 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
210 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
211 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
212 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
213 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
214 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
215 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
216 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
217 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
218 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
219 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
220 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
221 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
222 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
223 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
224 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
225 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
226 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
227 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
228 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
229 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.93
Rhizosphere 95.91
Stem 0
Stem Tuber 0
Unclassified 0.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24747J21853_1032562 3300001978 Unclassified 600
2 JGI24739J22299_10002371 3300001989 Bacteria 7261
3 JGI24739J22299_10069223 3300001989 Bacteria 1100
4 JGI24739J22299_10231706 3300001989 Unclassified 541
5 JGI24743J22301_10022914 3300001991 Bacteria 1199
6 JGI24735J21928_10001196 3300002067 Bacteria 9240
7 JGI24745J21846_1002102 3300002073 Bacteria 2001
8 JGI24749J21850_1010626 3300002076 Bacteria 1291
9 JGI24744J21845_10000224 3300002077 Bacteria 9003
10 JGI24742J22300_10012760 3300002244 Bacteria 1403
11 JGI24751J29686_10042277 3300002459 Bacteria 942
12 Ga0065704_10454699 3300005289 Unclassified 702
13 Ga0065712_10108055 3300005290 Bacteria 1883
14 Ga0065715_10089593 3300005293 Bacteria 9340
15 Ga0065715_10118184 3300005293 Bacteria 2323
16 Ga0070658_10026219 3300005327 Bacteria 4676
17 Ga0070658_10031643 3300005327 Bacteria 4249
18 Ga0070658_10353556 3300005327 Bacteria 1258
19 Ga0070658_10647320 3300005327 Bacteria 917
20 Ga0070658_11485526 3300005327 Bacteria 588
21 Ga0070676_10006525 3300005328 Bacteria 6234
22 Ga0070676_10168198 3300005328 Bacteria 1416
23 Ga0070676_10434936 3300005328 Bacteria 919
24 Ga0070676_10561812 3300005328 Bacteria 818
25 Ga0070676_11403008 3300005328 Bacteria 536
26 Ga0070690_100016936 3300005330 Bacteria 4375
27 Ga0070690_100359591 3300005330 Bacteria 1059
28 Ga0070670_100003270 3300005331 Bacteria 13400
29 Ga0070670_100006971 3300005331 Bacteria 9578
30 Ga0070670_100023497 3300005331 Bacteria 5306
31 Ga0070670_100061428 3300005331 Bacteria 3225
32 Ga0070670_100317338 3300005331 Bacteria 1365
33 Ga0070670_101738976 3300005331 Bacteria 574
34 Ga0070677_10000264 3300005333 Bacteria 18156
35 Ga0070677_10017816 3300005333 Bacteria 2548
36 Ga0070677_10589312 3300005333 Unclassified 614
37 Ga0068869_100548911 3300005334 Bacteria 970
38 Ga0070666_10255873 3300005335 Unclassified 1240
39 Ga0070680_101234448 3300005336 Bacteria 647
40 Ga0070682_100397808 3300005337 Bacteria 1041
41 Ga0068868_100000431 3300005338 Bacteria 28155
42 Ga0068868_100194703 3300005338 Bacteria 1687
43 Ga0068868_100338254 3300005338 Bacteria 1286
44 Ga0068868_100529423 3300005338 Unclassified 1036
45 Ga0068868_101340166 3300005338 Unclassified 666
46 Ga0070660_100084828 3300005339 Bacteria 2490
47 Ga0070660_100219006 3300005339 Bacteria 1547
48 Ga0070660_100377669 3300005339 Bacteria 1170
49 Ga0070660_100529821 3300005339 Bacteria 982
50 Ga0070660_100924526 3300005339 Bacteria 736
51 Ga0070660_101501802 3300005339 Bacteria 573
52 Ga0070689_100720949 3300005340 Bacteria 872
53 Ga0070687_100024887 3300005343 Bacteria 2865
54 Ga0070687_100470867 3300005343 Bacteria 840
55 Ga0070661_100056629 3300005344 Bacteria 2873
56 Ga0070661_100308309 3300005344 Bacteria 1234
57 Ga0070661_100358963 3300005344 Bacteria 1145
58 Ga0070661_100507572 3300005344 Bacteria 966
59 Ga0070661_100593362 3300005344 Bacteria 895
60 Ga0070661_101187281 3300005344 Bacteria 638
61 Ga0070668_100015963 3300005347 Bacteria 5618
62 Ga0070668_100043914 3300005347 Bacteria 3428
63 Ga0070668_100107854 3300005347 Bacteria 2214
64 Ga0070668_100145679 3300005347 Bacteria 1912
65 Ga0070668_100158391 3300005347 Bacteria 1836
66 Ga0070669_100002852 3300005353 Bacteria 12492
67 Ga0070669_100425131 3300005353 Bacteria 1091
68 Ga0070669_101858625 3300005353 Bacteria 526
69 Ga0070675_100002675 3300005354 Bacteria 13396
70 Ga0070675_100008719 3300005354 Bacteria 7877
71 Ga0070675_100072589 3300005354 Bacteria 2857
72 Ga0070671_100004423 3300005355 Bacteria 11116
73 Ga0070671_100005509 3300005355 Bacteria 10094
74 Ga0070671_100011993 3300005355 Bacteria 6971
75 Ga0070671_100028759 3300005355 Bacteria 4580
76 Ga0070671_100117733 3300005355 Bacteria 2234
77 Ga0070671_100239968 3300005355 Bacteria 1538
78 Ga0070671_100250483 3300005355 Unclassified 1504
79 Ga0070671_100325247 3300005355 Bacteria 1310
80 Ga0070674_100001611 3300005356 Bacteria 12109
81 Ga0070674_100008578 3300005356 Bacteria 6095
82 Ga0070674_100012341 3300005356 Bacteria 5245
83 Ga0070674_100035517 3300005356 Bacteria 3338
84 Ga0070674_100072517 3300005356 Bacteria 2438
85 Ga0070674_100588871 3300005356 Unclassified 938
86 Ga0070674_100644555 3300005356 Bacteria 900
87 Ga0070674_101789408 3300005356 Bacteria 557
88 Ga0070673_100003914 3300005364 Bacteria 9358
89 Ga0070673_100005256 3300005364 Bacteria 8266
90 Ga0070673_100200043 3300005364 Bacteria 1720
91 Ga0070673_100242477 3300005364 Bacteria 1568
92 Ga0070673_100276377 3300005364 Bacteria 1472
93 Ga0070659_100023328 3300005366 Bacteria 4734
94 Ga0070659_100150388 3300005366 Bacteria 1899
95 Ga0070659_100627322 3300005366 Bacteria 925
96 Ga0070659_101651667 3300005366 Unclassified 573
97 Ga0070659_102036443 3300005366 Unclassified 516
98 Ga0070667_100006261 3300005367 Bacteria 9897
99 Ga0070667_100032790 3300005367 Bacteria 4335
100 Ga0070667_100158894 3300005367 Unclassified 1990
101 Ga0070667_100631965 3300005367 Bacteria 988
102 Ga0070667_100996340 3300005367 Bacteria 782
103 Ga0070709_11323065 3300005434 Bacteria 582
104 Ga0070714_100242662 3300005435 Bacteria 1663
105 Ga0070713_100005305 3300005436 Bacteria 8791
106 Ga0070705_100279137 3300005440 Bacteria 1187
107 Ga0070700_100035491 3300005441 Bacteria 3018
108 Ga0070708_101204951 3300005445 Unclassified 708
109 Ga0070663_100035118 3300005455 Bacteria 3476
110 Ga0070663_100450483 3300005455 Bacteria 1061
111 Ga0070663_100523626 3300005455 Unclassified 987
112 Ga0070663_100569729 3300005455 Bacteria 949
113 Ga0070663_100627184 3300005455 Bacteria 907
114 Ga0070663_101553377 3300005455 Bacteria 589
115 Ga0070678_100000602 3300005456 Bacteria 17695
116 Ga0070678_100013160 3300005456 Bacteria 5176
117 Ga0070678_100025487 3300005456 Bacteria 3979
118 Ga0070678_100061022 3300005456 Bacteria 2778
119 Ga0070678_100244232 3300005456 Bacteria 1503
120 Ga0070678_100667663 3300005456 Bacteria 934
121 Ga0070662_100001864 3300005457 Bacteria 12913
122 Ga0070662_100018380 3300005457 Bacteria 4727
123 Ga0070662_100097110 3300005457 Bacteria 2223
124 Ga0070662_100140838 3300005457 Bacteria 1869
125 Ga0070662_100166087 3300005457 Bacteria 1730
126 Ga0070662_100369213 3300005457 Bacteria 1179
127 Ga0070662_100511333 3300005457 Bacteria 1003
128 Ga0070681_10385194 3300005458 Bacteria 1313
129 Ga0070681_11017424 3300005458 Unclassified 749
130 Ga0070681_11720576 3300005458 Unclassified 553
131 Ga0070681_11849206 3300005458 Bacteria 531
132 Ga0068867_100017993 3300005459 Bacteria 5021
133 Ga0068867_100121426 3300005459 Bacteria 2020
134 Ga0068867_100217003 3300005459 Bacteria 1539
135 Ga0068867_100424471 3300005459 Bacteria 1127
136 Ga0068867_100557920 3300005459 Bacteria 993
137 Ga0070685_10057449 3300005466 Bacteria 2265
138 Ga0070685_10190637 3300005466 Bacteria 1326
139 Ga0070679_100206905 3300005530 Bacteria 1927
140 Ga0070679_100260474 3300005530 Bacteria 1689
141 Ga0068853_100043354 3300005539 Bacteria 3848
142 Ga0068853_100478539 3300005539 Bacteria 1174
143 Ga0068853_100670147 3300005539 Bacteria 988
144 Ga0068853_101047968 3300005539 Bacteria 786
145 Ga0068853_102472204 3300005539 Bacteria 503
146 Ga0070672_100044717 3300005543 Bacteria 3422
147 Ga0070672_100053151 3300005543 Bacteria 3166
148 Ga0070672_100246880 3300005543 Bacteria 1503
149 Ga0070672_100276411 3300005543 Bacteria 1419
150 Ga0070672_100285088 3300005543 Bacteria 1397
151 Ga0070672_100570590 3300005543 Bacteria 984
152 Ga0070672_101747331 3300005543 Bacteria 559
153 Ga0070686_100040593 3300005544 Bacteria 2904
154 Ga0070686_100084071 3300005544 Bacteria 2114
155 Ga0070665_100001803 3300005548 Bacteria 24285
156 Ga0070665_100006577 3300005548 Bacteria 11814
157 Ga0070665_100007119 3300005548 Bacteria 11370
158 Ga0070665_100634851 3300005548 Bacteria 1081
159 Ga0070665_101199440 3300005548 Unclassified 770
160 Ga0068855_100243640 3300005563 Bacteria 2008
161 Ga0068855_100301795 3300005563 Bacteria 1773
162 Ga0070664_100001684 3300005564 Bacteria 17708
163 Ga0070664_100008505 3300005564 Bacteria 8297
164 Ga0070664_100147992 3300005564 Bacteria 2072
165 Ga0070664_100251248 3300005564 Bacteria 1589
166 Ga0070664_100326213 3300005564 Bacteria 1392
167 Ga0070664_101318425 3300005564 Unclassified 682
168 Ga0068857_100511610 3300005577 Bacteria 1128
169 Ga0068857_102053567 3300005577 Bacteria 561
170 Ga0068854_100034418 3300005578 Bacteria 3538
171 Ga0068854_100095867 3300005578 Bacteria 2215
172 Ga0068856_101632160 3300005614 Bacteria 658
173 Ga0070702_100675225 3300005615 Bacteria 784
174 Ga0068852_100184408 3300005616 Bacteria 1964
175 Ga0068852_100378126 3300005616 Bacteria 1389
176 Ga0068852_100673195 3300005616 Bacteria 1043
177 Ga0068859_101686042 3300005617 Bacteria 700
178 Ga0068859_102793319 3300005617 Bacteria 536
179 Ga0068864_100106295 3300005618 Bacteria 2495
180 Ga0068864_100175966 3300005618 Bacteria 1954
181 Ga0068864_101214357 3300005618 Bacteria 753
182 Ga0068866_10032299 3300005718 Bacteria 2530
183 Ga0068866_10047175 3300005718 Bacteria 2171
184 Ga0068866_10967316 3300005718 Bacteria 603
185 Ga0068861_100626123 3300005719 Bacteria 991
186 Ga0068851_10235407 3300005834 Unclassified 1034
187 Ga0068870_10121895 3300005840 Bacteria 1503
188 Ga0068870_10129364 3300005840 Bacteria 1465
189 Ga0068858_100001327 3300005842 Bacteria 25539
190 Ga0068858_100774053 3300005842 Bacteria 936
191 Ga0068860_100372856 3300005843 Bacteria 1408
192 Ga0068860_101758853 3300005843 Unclassified 642
193 Ga0070716_100015834 3300006173 Bacteria 3884
194 Ga0070712_100080287 3300006175 Bacteria 2361
195 Ga0097621_100226512 3300006237 Bacteria 1631
196 Ga0097621_100766079 3300006237 Bacteria 892
197 Ga0097621_102390137 3300006237 Unclassified 506
198 Ga0068871_100057898 3300006358 Bacteria 3154
199 Ga0068871_100851097 3300006358 Unclassified 843
200 Ga0068865_100107869 3300006881 Bacteria 2049
201 Ga0068865_100202401 3300006881 Bacteria 1542
202 Ga0068865_100528952 3300006881 Bacteria 987
203 Ga0068865_100724093 3300006881 Unclassified 852
204 Ga0097620_101686536 3300006931 Bacteria 700
205 Ga0097620_102794693 3300006931 Bacteria 536
206 Ga0105240_10138338 3300009093 Bacteria 2914
207 Ga0111539_10271562 3300009094 Bacteria 1974
208 Ga0111539_11393386 3300009094 Bacteria 813
209 Ga0105245_10563377 3300009098 Bacteria 1162
210 Ga0114129_13227386 3300009147 Bacteria 529
211 Ga0105243_10071021 3300009148 Bacteria 2814
212 Ga0105243_10184064 3300009148 Bacteria 1819
213 Ga0105243_11021130 3300009148 Bacteria 831
214 Ga0105241_10070560 3300009174 Bacteria 2711
215 Ga0105241_10364886 3300009174 Bacteria 1258
216 Ga0105241_10858818 3300009174 Bacteria 840
217 Ga0105248_10002558 3300009177 Bacteria 20245
218 Ga0105248_10222758 3300009177 Bacteria 2123
219 Ga0105248_10471314 3300009177 Bacteria 1415
220 Ga0105248_10482141 3300009177 Bacteria 1398
221 Ga0105248_10775096 3300009177 Bacteria 1082
222 Ga0105248_10984870 3300009177 Bacteria 952
223 Ga0105248_11612731 3300009177 Bacteria 735
224 Ga0105237_10070432 3300009545 Bacteria 3493
225 Ga0105249_10013720 3300009553 Bacteria 7154
226 Ga0105246_11612930 3300011119 Bacteria 613
227 Ga0105246_11708982 3300011119 Bacteria 598
228 Ga0157327_1015862 3300012512 Bacteria 789
229 Ga0157373_10063624 3300013100 Bacteria 2612
230 Ga0157373_10076392 3300013100 Bacteria 2363
231 Ga0157373_10613265 3300013100 Bacteria 793
232 Ga0157371_10077636 3300013102 Bacteria 2352
233 Ga0157371_10136912 3300013102 Bacteria 1744
234 Ga0157370_10116555 3300013104 Bacteria 2495
235 Ga0157369_10146616 3300013105 Bacteria 2495
236 Ga0157374_10132729 3300013296 Bacteria 2411
237 Ga0157374_10166455 3300013296 Bacteria 2148
238 Ga0157374_10536931 3300013296 Bacteria 1176
239 Ga0157378_10070028 3300013297 Bacteria 3148
240 Ga0157378_10193915 3300013297 Bacteria 1918
241 Ga0157378_10203835 3300013297 Bacteria 1872
242 Ga0157378_10649683 3300013297 Unclassified 1070
243 Ga0163162_10023779 3300013306 Bacteria 6048
244 Ga0163162_10245240 3300013306 Bacteria 1923
245 Ga0163162_10271101 3300013306 Bacteria 1829
246 Ga0163162_10363427 3300013306 Bacteria 1580
247 Ga0163162_10404809 3300013306 Bacteria 1497
248 Ga0157372_10036663 3300013307 Bacteria 5406
249 Ga0157372_11206751 3300013307 Unclassified 874
250 Ga0157375_10034637 3300013308 Bacteria 4812
251 Ga0157375_10123967 3300013308 Bacteria 2697
252 Ga0157375_10155256 3300013308 Bacteria 2427
253 Ga0157375_10372678 3300013308 Bacteria 1594
254 Ga0157375_11840263 3300013308 Bacteria 718
255 Ga0163163_10169084 3300014325 Bacteria 2232
256 Ga0163163_10647233 3300014325 Bacteria 1120
257 Ga0157380_10002629 3300014326 Bacteria 12158
258 Ga0157380_10003020 3300014326 Bacteria 11464
259 Ga0157380_10901205 3300014326 Bacteria 910
260 Ga0157380_11707726 3300014326 Bacteria 687
261 Ga0182008_10062977 3300014497 Bacteria 1827
262 Ga0157377_10051990 3300014745 Bacteria 2313
263 Ga0157377_10203105 3300014745 Bacteria 1259
264 Ga0157377_10219518 3300014745 Bacteria 1216
265 Ga0157379_10036797 3300014968 Bacteria 4364
266 Ga0157379_11155812 3300014968 Unclassified 743
267 Ga0157379_11738170 3300014968 Bacteria 612
268 Ga0157376_10895141 3300014969 Bacteria 905
269 Ga0163161_10061724 3300017792 Bacteria 2729
270 Ga0163161_10076067 3300017792 Bacteria 2464
271 Ga0163161_10465660 3300017792 Bacteria 1024
272 Ga0207666_1007291 3300025271 Bacteria 1453
273 Ga0207697_10009439 3300025315 Bacteria 4215
274 Ga0207697_10032044 3300025315 Bacteria 2151
275 Ga0207656_10113165 3300025321 Unclassified 1256
276 Ga0207682_10007627 3300025893 Bacteria 4305
277 Ga0207682_10453950 3300025893 Unclassified 607
278 Ga0207642_10261955 3300025899 Bacteria 986
279 Ga0207642_10296139 3300025899 Bacteria 936
280 Ga0207642_10769531 3300025899 Bacteria 611
281 Ga0207688_10006350 3300025901 Bacteria 6435
282 Ga0207688_10586927 3300025901 Bacteria 702
283 Ga0207680_10000735 3300025903 Bacteria 15442
284 Ga0207680_10117593 3300025903 Bacteria 1734
285 Ga0207680_10235933 3300025903 Unclassified 1259
286 Ga0207680_10332274 3300025903 Bacteria 1065
287 Ga0207647_10001187 3300025904 Bacteria 20060
288 Ga0207647_10240985 3300025904 Bacteria 1038
289 Ga0207699_10014882 3300025906 Bacteria 4027
290 Ga0207645_10032082 3300025907 Bacteria 3377
291 Ga0207645_10085947 3300025907 Unclassified 2020
292 Ga0207645_10287023 3300025907 Bacteria 1094
293 Ga0207643_10168649 3300025908 Bacteria 1320
294 Ga0207643_10213881 3300025908 Bacteria 1177
295 Ga0207705_10026507 3300025909 Bacteria 4133
296 Ga0207705_10536356 3300025909 Bacteria 909
297 Ga0207654_10082869 3300025911 Bacteria 1935
298 Ga0207707_10329609 3300025912 Bacteria 1317
299 Ga0207693_10113023 3300025915 Bacteria 2130
300 Ga0207662_10029162 3300025918 Bacteria 3195
301 Ga0207662_10254612 3300025918 Bacteria 1153
302 Ga0207657_10012888 3300025919 Bacteria 8221
303 Ga0207657_10040777 3300025919 Bacteria 4111
304 Ga0207657_10287436 3300025919 Bacteria 1304
305 Ga0207657_10666849 3300025919 Bacteria 809
306 Ga0207657_10766734 3300025919 Bacteria 747
307 Ga0207657_11235779 3300025919 Bacteria 567
308 Ga0207649_10059495 3300025920 Bacteria 2397
309 Ga0207649_10085199 3300025920 Bacteria 2056
310 Ga0207649_10089338 3300025920 Bacteria 2014
311 Ga0207649_10316366 3300025920 Bacteria 1145
312 Ga0207649_10330607 3300025920 Bacteria 1122
313 Ga0207649_10591926 3300025920 Bacteria 852
314 Ga0207652_11325638 3300025921 Bacteria 623
315 Ga0207681_10069297 3300025923 Bacteria 2453
316 Ga0207681_10473624 3300025923 Bacteria 1022
317 Ga0207681_10546157 3300025923 Bacteria 953
318 Ga0207650_10002198 3300025925 Bacteria 13634
319 Ga0207650_10008461 3300025925 Bacteria 7024
320 Ga0207650_10116431 3300025925 Bacteria 2075
321 Ga0207650_10158796 3300025925 Bacteria 1790
322 Ga0207650_10418263 3300025925 Bacteria 1112
323 Ga0207650_11122695 3300025925 Unclassified 669
324 Ga0207659_10017910 3300025926 Bacteria 4635
325 Ga0207659_10270408 3300025926 Bacteria 1386
326 Ga0207659_10288695 3300025926 Bacteria 1343
327 Ga0207700_10225793 3300025928 Bacteria 1590
328 Ga0207664_10014541 3300025929 Bacteria 5689
329 Ga0207644_10003385 3300025931 Bacteria 10291
330 Ga0207644_10008821 3300025931 Bacteria 6602
331 Ga0207644_10010334 3300025931 Bacteria 6152
332 Ga0207644_10035899 3300025931 Bacteria 3477
333 Ga0207644_10195282 3300025931 Bacteria 1593
334 Ga0207644_10870984 3300025931 Bacteria 754
335 Ga0207644_10886707 3300025931 Unclassified 747
336 Ga0207690_10395326 3300025932 Bacteria 1101
337 Ga0207690_11159762 3300025932 Bacteria 645
338 Ga0207706_10012753 3300025933 Bacteria 7649
339 Ga0207706_10013346 3300025933 Bacteria 7473
340 Ga0207706_10014810 3300025933 Bacteria 7059
341 Ga0207706_10054519 3300025933 Bacteria 3528
342 Ga0207706_10063865 3300025933 Bacteria 3241
343 Ga0207706_10151755 3300025933 Bacteria 2038
344 Ga0207706_10159766 3300025933 Bacteria 1981
345 Ga0207706_10168301 3300025933 Bacteria 1926
346 Ga0207706_10173180 3300025933 Bacteria 1896
347 Ga0207706_10640331 3300025933 Bacteria 911
348 Ga0207709_10078991 3300025935 Bacteria 2114
349 Ga0207670_11325090 3300025936 Bacteria 611
350 Ga0207669_10001445 3300025937 Bacteria 10126
351 Ga0207669_10002943 3300025937 Bacteria 7314
352 Ga0207669_10054673 3300025937 Bacteria 2413
353 Ga0207669_10068710 3300025937 Bacteria 2214
354 Ga0207669_10700272 3300025937 Bacteria 832
355 Ga0207669_11039744 3300025937 Bacteria 689
356 Ga0207704_10080568 3300025938 Bacteria 2102
357 Ga0207704_10182730 3300025938 Bacteria 1517
358 Ga0207704_10431792 3300025938 Bacteria 1047
359 Ga0207704_11827183 3300025938 Bacteria 522
360 Ga0207665_10067243 3300025939 Bacteria 2440
361 Ga0207691_10014156 3300025940 Bacteria 7610
362 Ga0207691_10036651 3300025940 Bacteria 4544
363 Ga0207691_10037007 3300025940 Bacteria 4521
364 Ga0207691_10040923 3300025940 Bacteria 4281
365 Ga0207691_10110674 3300025940 Bacteria 2443
366 Ga0207691_10232054 3300025940 Bacteria 1598
367 Ga0207691_11271062 3300025940 Bacteria 608
368 Ga0207711_10000477 3300025941 Bacteria 41350
369 Ga0207711_10313226 3300025941 Bacteria 1449
370 Ga0207711_10481600 3300025941 Bacteria 1156
371 Ga0207711_10605931 3300025941 Unclassified 1022
372 Ga0207711_10617808 3300025941 Bacteria 1011
373 Ga0207689_10011903 3300025942 Bacteria 7455
374 Ga0207689_11650635 3300025942 Bacteria 532
375 Ga0207679_10003633 3300025945 Bacteria 9563
376 Ga0207679_10288787 3300025945 Bacteria 1409
377 Ga0207679_10490492 3300025945 Bacteria 1095
378 Ga0207679_10778977 3300025945 Unclassified 871
379 Ga0207667_10275260 3300025949 Bacteria 1721
380 Ga0207651_10002537 3300025960 Bacteria 8721
381 Ga0207651_10005197 3300025960 Bacteria 6651
382 Ga0207651_10179734 3300025960 Bacteria 1677
383 Ga0207651_10198597 3300025960 Bacteria 1605
384 Ga0207651_10238760 3300025960 Bacteria 1480
385 Ga0207651_10542575 3300025960 Bacteria 1010
386 Ga0207651_11275413 3300025960 Bacteria 660
387 Ga0207712_10049509 3300025961 Bacteria 2928
388 Ga0207668_10132167 3300025972 Bacteria 1907
389 Ga0207668_10296603 3300025972 Bacteria 1332
390 Ga0207668_10351146 3300025972 Bacteria 1233
391 Ga0207668_10485749 3300025972 Bacteria 1060
392 Ga0207640_10171286 3300025981 Bacteria 1618
393 Ga0207640_10234371 3300025981 Bacteria 1414
394 Ga0207640_10372380 3300025981 Bacteria 1155
395 Ga0207658_10002851 3300025986 Bacteria 12384
396 Ga0207658_10577310 3300025986 Bacteria 1008
397 Ga0207658_10973080 3300025986 Unclassified 774
398 Ga0207677_10000754 3300026023 Bacteria 18643
399 Ga0207677_10034342 3300026023 Bacteria 3283
400 Ga0207677_10289851 3300026023 Bacteria 1348
401 Ga0207703_10001631 3300026035 Bacteria 20220
402 Ga0207703_10453604 3300026035 Bacteria 1198
403 Ga0207703_10636159 3300026035 Bacteria 1011
404 Ga0207703_10686792 3300026035 Bacteria 973
405 Ga0207639_10135661 3300026041 Bacteria 2043
406 Ga0207639_10828272 3300026041 Bacteria 863
407 Ga0207678_10044057 3300026067 Bacteria 3861
408 Ga0207678_10057412 3300026067 Bacteria 3349
409 Ga0207678_10455621 3300026067 Bacteria 1112
410 Ga0207678_10555444 3300026067 Bacteria 1004
411 Ga0207678_10894298 3300026067 Bacteria 785
412 Ga0207678_11172677 3300026067 Bacteria 680
413 Ga0207678_11314729 3300026067 Bacteria 640
414 Ga0207702_10527602 3300026078 Bacteria 1153
415 Ga0207702_10731468 3300026078 Bacteria 976
416 Ga0207641_11035884 3300026088 Bacteria 818
417 Ga0207648_10001859 3300026089 Bacteria 23056
418 Ga0207648_10053715 3300026089 Bacteria 3521
419 Ga0207648_10135408 3300026089 Bacteria 2170
420 Ga0207648_10196011 3300026089 Bacteria 1791
421 Ga0207648_10473577 3300026089 Bacteria 1143
422 Ga0207676_10139109 3300026095 Bacteria 2076
423 Ga0207676_11055490 3300026095 Bacteria 802
424 Ga0207674_10046179 3300026116 Bacteria 4474
425 Ga0207674_10266708 3300026116 Bacteria 1660
426 Ga0207674_11559980 3300026116 Bacteria 629
427 Ga0207675_100092389 3300026118 Bacteria 2846
428 Ga0207683_10004242 3300026121 Bacteria 12371
429 Ga0207683_10019589 3300026121 Bacteria 5780
430 Ga0207683_10070658 3300026121 Bacteria 3085
431 Ga0207683_10111254 3300026121 Bacteria 2452
432 Ga0207683_10254736 3300026121 Bacteria 1602
433 Ga0207698_10152912 3300026142 Bacteria 2006
434 Ga0207698_10319626 3300026142 Bacteria 1453
435 Ga0207698_10924706 3300026142 Bacteria 880
436 Ga0207698_11504024 3300026142 Bacteria 688
437 Ga0209974_10219430 3300027876 Bacteria 707
438 Ga0268266_10000135 3300028379 Bacteria 141959
439 Ga0268266_10021484 3300028379 Bacteria 5497
440 Ga0268266_10071905 3300028379 Bacteria 2998
441 Ga0268266_10523554 3300028379 Bacteria 1134
442 Ga0268266_11631157 3300028379 Bacteria 620
443 Ga0268265_10035410 3300028380 Bacteria 3647
444 Ga0268264_11189478 3300028381 Bacteria 772
445 Ga0307408_101580369 3300031548 Bacteria 622
446 Ga0307405_10165004 3300031731 Bacteria 1573
447 Ga0307405_10746717 3300031731 Bacteria 815
448 Ga0307413_10006937 3300031824 Bacteria 5215
449 Ga0307413_10314168 3300031824 Bacteria 1194
450 Ga0307413_10446501 3300031824 Bacteria 1025
451 Ga0307410_10002666 3300031852 Bacteria 8698
452 Ga0307410_10022258 3300031852 Bacteria 3914
453 Ga0307410_10377937 3300031852 Bacteria 1139
454 Ga0307406_10190009 3300031901 Bacteria 1502
455 Ga0307406_10322179 3300031901 Bacteria 1196
456 Ga0307406_10839010 3300031901 Bacteria 778
457 Ga0307407_10015490 3300031903 Bacteria 3771
458 Ga0307407_11193320 3300031903 Bacteria 594
459 Ga0307412_10163270 3300031911 Bacteria 1658
460 Ga0307412_10178992 3300031911 Bacteria 1593
461 Ga0307409_100015545 3300031995 Bacteria 4999
462 Ga0307409_100046540 3300031995 Bacteria 3284
463 Ga0307409_100182855 3300031995 Bacteria 1858
464 Ga0307409_101090035 3300031995 Bacteria 819
465 Ga0307416_100060446 3300032002 Bacteria 3086
466 Ga0307416_102197828 3300032002 Bacteria 653
467 Ga0307414_10018828 3300032004 Bacteria 4263
468 Ga0307414_10055326 3300032004 Bacteria 2778
469 Ga0307414_10075339 3300032004 Bacteria 2448
470 Ga0307414_10243639 3300032004 Bacteria 1490
471 Ga0307411_10003373 3300032005 Bacteria 7396
472 Ga0307411_10329234 3300032005 Bacteria 1237
473 Ga0307411_10335570 3300032005 Bacteria 1226
474 Ga0307411_10410073 3300032005 Bacteria 1122
475 Ga0307415_100279487 3300032126 Bacteria 1372
476 Ga0307415_100828919 3300032126 Bacteria 847
477 Ga0307415_101178782 3300032126 Bacteria 721
478 Ga0373930_0038094 3300034816 Bacteria 1015
479 Ga0373952_0173571 3300035092 Bacteria 618
480 Ga0373936_0127178 3300035113 Bacteria 1093
481 Ga0373960_0037345 3300035121 Bacteria 1388
482 Ga0373960_0324493 3300035121 Unclassified 578
483 Ga0373943_0984343 3300035170 Unclassified 505
484 Ga0373946_0701247 3300035171 Bacteria 529
485 Ga0373955_0201570 3300035172 Bacteria 1185
486 Ga0373942_0107855 3300035207 Bacteria 858
487 Ga0373931_0644315 3300035691 Bacteria 696
488 Ga0373935_0015642 3300035692 Bacteria 4588
489 Ga0373937_0518293 3300036401 Bacteria 1133
490 Ga0395899_0000326 3300037312 Bacteria 60434
491 Ga0395899_0001275 3300037312 Bacteria 21915
492 Ga0395899_0073981 3300037312 Bacteria 2490
493 Ga0395899_0132990 3300037312 Bacteria 1775
494 Ga0395899_0224751 3300037312 Bacteria 1299
495 Ga0395900_0000466 3300037418 Bacteria 58174
496 Ga0395900_0002846 3300037418 Bacteria 18877
497 Ga0395900_0008634 3300037418 Bacteria 10470
498 Ga0395900_0033455 3300037418 Bacteria 5290
499 Ga0395900_0217866 3300037418 Bacteria 1925
500 Ga0395900_0459460 3300037418 Bacteria 1228
501 Ga0395900_1287039 3300037418 Bacteria 645
502 Ga0395898_0000721 3300037466 Bacteria 58174
503 Ga0395898_0005406 3300037466 Bacteria 13804
504 Ga0395898_0013995 3300037466 Bacteria 8244
505 Ga0395898_0058025 3300037466 Bacteria 3770
506 Ga0395898_0262795 3300037466 Bacteria 1646
507 Ga0395898_0302261 3300037466 Bacteria 1526
508 Ga0395898_0498372 3300037466 Bacteria 1158
509 Ga0395905_0000439 3300037471 Bacteria 58163
510 Ga0395905_0000980 3300037471 Bacteria 36613
511 Ga0395905_0001011 3300037471 Bacteria 35880
512 Ga0395905_0006701 3300037471 Bacteria 11533
513 Ga0395905_0010322 3300037471 Bacteria 9088
514 Ga0395905_0033814 3300037471 Bacteria 4802
515 Ga0395905_0034438 3300037471 Bacteria 4755
516 Ga0395905_0219748 3300037471 Bacteria 1778
517 Ga0395905_0510412 3300037471 Bacteria 1102
518 Ga0395905_1380796 3300037471 Unclassified 608
519 Ga0395905_1488181 3300037471 Bacteria 581
520 Ga0395901_0003914 3300038443 Bacteria 14983
521 Ga0395901_0049362 3300038443 Bacteria 4372
522 Ga0395901_0442902 3300038443 Bacteria 1329
523 Ga0395901_0601514 3300038443 Bacteria 1109
524 Ga0395901_0713309 3300038443 Unclassified 999
525 Ga0395901_0953432 3300038443 Bacteria 836
526 Ga0395901_1794036 3300038443 Bacteria 563
527 Ga0436365_1373897 3300039437 Bacteria 564
528 Ga0439445_0010632 3300042004 Bacteria 2181
529 Ga0450920_080495 3300042122 Bacteria 667
530 Ga0466972_0578659 3300044658 Unclassified 530
531 Ga0466965_0428610 3300044683 Bacteria 734
532 Ga0466966_0050949 3300044684 Bacteria 2633
533 Ga0466966_0168285 3300044684 Bacteria 1332
534 Ga0466966_0192057 3300044684 Bacteria 1237
535 Ga0466961_0297146 3300044693 Bacteria 987
536 Ga0466963_0855416 3300044694 Bacteria 641
537 Ga0466970_0110391 3300044765 Bacteria 1502
538 Ga0466960_0024584 3300044901 Bacteria 2719
539 Ga0466960_0706046 3300044901 Unclassified 605
540 Ga0466959_0161778 3300045049 Bacteria 1574
541 Ga0466959_0566681 3300045049 Bacteria 765
542 Ga0466967_0686648 3300045976 Bacteria 1013
543 Ga0466967_1684389 3300045976 Bacteria 631
544 Ga0495585_0553835 3300046492 Unclassified 543
545 Ga0495606_0547735 3300046507 Bacteria 576
546 Ga0495610_0237637 3300046512 Bacteria 728
547 Ga0495616_0358354 3300046513 Bacteria 606
548 Ga0495663_0017360 3300046525 Bacteria 2042
549 Ga0495663_0059207 3300046525 Bacteria 1201
550 Ga0495663_0072052 3300046525 Bacteria 1101
551 Ga0495663_0134030 3300046525 Bacteria 837
552 Ga0495663_0270677 3300046525 Bacteria 607
553 Ga0495642_0047455 3300046528 Bacteria 1759
554 Ga0495642_0206987 3300046528 Bacteria 856
555 Ga0495598_0054313 3300046537 Bacteria 1216
556 Ga0495598_0083931 3300046537 Bacteria 1027
557 Ga0495621_0000115 3300046539 Bacteria 16944
558 Ga0495621_0005159 3300046539 Bacteria 3734
559 Ga0495621_0027519 3300046539 Bacteria 1926
560 Ga0495633_0014696 3300046558 Bacteria 4083
561 Ga0495633_0357828 3300046558 Unclassified 661
562 Ga0495668_0010268 3300046616 Bacteria 5681
563 Ga0495668_0210632 3300046616 Bacteria 1064
564 Ga0495625_0355765 3300046660 Bacteria 924
565 Ga0495659_0096416 3300046664 Bacteria 1141
566 Ga0495659_0181350 3300046664 Bacteria 857
567 Ga0495669_0000296 3300046684 Bacteria 27684
568 Ga0495669_0004307 3300046684 Bacteria 5872
569 Ga0495669_0008286 3300046684 Bacteria 4365
570 Ga0495669_0043683 3300046684 Bacteria 1996
571 Ga0495669_0048417 3300046684 Bacteria 1901
572 Ga0495669_0051755 3300046684 Bacteria 1844
573 Ga0495669_0061779 3300046684 Bacteria 1696
574 Ga0495669_0306755 3300046684 Bacteria 765
575 Ga0495670_0000250 3300046691 Bacteria 24933
576 Ga0495670_0033031 3300046691 Bacteria 2574
577 Ga0495660_0331592 3300046810 Bacteria 681
578 Ga0495677_0004644 3300047445 Bacteria 5242
579 Ga0495677_0023608 3300047445 Bacteria 2232
580 Ga0495677_0032573 3300047445 Bacteria 1898
581 Ga0495677_0080975 3300047445 Bacteria 1217
582 Ga0495685_048812 3300047447 Bacteria 1439
583 Ga0495685_122198 3300047447 Bacteria 854
584 Ga0495685_223976 3300047447 Bacteria 600
585 Ga0495681_0275901 3300047470 Bacteria 657
586 Ga0496100_0214369 3300048903 Bacteria 1410
587 Ga0496101_0411016 3300048904 Bacteria 1066
588 Ga0496101_0790514 3300048904 Bacteria 748
589 Ga0496102_0109143 3300048905 Bacteria 2578
590 Ga0496103_0064459 3300048906 Bacteria 2284
591 Ga0496106_0676516 3300048909 Bacteria 823
592 Ga0496106_0885568 3300048909 Bacteria 705
593 Ga0496106_0912379 3300048909 Bacteria 693
594 Ga0496107_0032339 3300048910 Bacteria 3739
595 Ga0496107_0046938 3300048910 Bacteria 3109
596 Ga0496107_0189725 3300048910 Bacteria 1527
597 Ga0496107_0437216 3300048910 Bacteria 972
598 Ga0496108_1169173 3300048911 Bacteria 652
599 Ga0496108_1627656 3300048911 Bacteria 534
600 Ga0496109_0548705 3300048912 Bacteria 1090
601 Ga0496109_2060170 3300048912 Bacteria 502
602 Ga0496112_0203820 3300048915 Bacteria 1936
603 Ga0496112_0529018 3300048915 Bacteria 1113
604 Ga0496112_0579957 3300048915 Bacteria 1054
605 Ga0496112_0738108 3300048915 Bacteria 911
606 Ga0496112_1558280 3300048915 Bacteria 574
607 Ga0496113_0110992 3300048916 Bacteria 2135
608 Ga0496114_0199265 3300048917 Bacteria 1753
609 Ga0496115_0000524 3300048918 Bacteria 29765
610 Ga0501069_0394348 3300049585 Bacteria 819
611 nmdc:mga08y16_302721_c1 3300050511 Bacteria 1648

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300011119 Ga0105246_11612930 Ga0105246_116129301 83
2 3300005367 Ga0070667_100158894 Ga0070667_1001588942 92
3 3300005455 Ga0070663_100523626 Ga0070663_1005236262 92
4 3300005530 Ga0070679_100260474 Ga0070679_1002604742 92
5 3300005563 Ga0068855_100301795 Ga0068855_1003017952 92
6 3300005564 Ga0070664_101318425 Ga0070664_1013184252 92
7 3300005614 Ga0068856_101632160 Ga0068856_1016321601 92
8 3300005834 Ga0068851_10235407 Ga0068851_102354072 92
9 3300009174 Ga0105241_10858818 Ga0105241_108588181 92
10 3300013297 Ga0157378_10649683 Ga0157378_106496832 92
11 3300014968 Ga0157379_11155812 Ga0157379_111558122 92
12 3300025321 Ga0207656_10113165 Ga0207656_101131652 92
13 3300025904 Ga0207647_10240985 Ga0207647_102409852 92
14 3300025920 Ga0207649_10316366 Ga0207649_103163662 92
15 3300025942 Ga0207689_11650635 Ga0207689_116506351 92
16 3300025945 Ga0207679_10778977 Ga0207679_107789772 92
17 3300025960 Ga0207651_11275413 Ga0207651_112754132 92
18 3300025986 Ga0207658_10973080 Ga0207658_109730802 92
19 3300026067 Ga0207678_10044057 Ga0207678_100440572 92
20 3300026078 Ga0207702_10731468 Ga0207702_107314682 92
21 3300026089 Ga0207648_10053715 Ga0207648_100537152 92
22 3300026116 Ga0207674_10046179 Ga0207674_100461793 92
23 3300014326 Ga0157380_10002629 Ga0157380_100026299 94
24 3300044684 Ga0466966_0168285 Ga0466966_0168285_734_1066 94
25 3300001991 JGI24743J22301_10022914 JGI24743J22301_100229141 95
26 3300005338 Ga0068868_100194703 Ga0068868_1001947032 95
27 3300005339 Ga0070660_100924526 Ga0070660_1009245261 95
28 3300005340 Ga0070689_100720949 Ga0070689_1007209492 95
29 3300005347 Ga0070668_100158391 Ga0070668_1001583912 95
30 3300005353 Ga0070669_100425131 Ga0070669_1004251312 95
31 3300005354 Ga0070675_100008719 Ga0070675_1000087194 95
32 3300005364 Ga0070673_100005256 Ga0070673_1000052565 95
33 3300005456 Ga0070678_100244232 Ga0070678_1002442322 95
34 3300005459 Ga0068867_100557920 Ga0068867_1005579202 95
35 3300005466 Ga0070685_10057449 Ga0070685_100574492 95
36 3300005548 Ga0070665_100007119 Ga0070665_1000071195 95
37 3300005718 Ga0068866_10967316 Ga0068866_109673162 95
38 3300005842 Ga0068858_100774053 Ga0068858_1007740532 95
39 3300009177 Ga0105248_10471314 Ga0105248_104713142 95
40 3300013306 Ga0163162_10023779 Ga0163162_100237793 95
41 3300013308 Ga0157375_10034637 Ga0157375_100346372 95
42 3300014745 Ga0157377_10203105 Ga0157377_102031052 95
43 3300025315 Ga0207697_10032044 Ga0207697_100320442 95
44 3300025899 Ga0207642_10769531 Ga0207642_107695312 95
45 3300025923 Ga0207681_10546157 Ga0207681_105461572 95
46 3300025926 Ga0207659_10017910 Ga0207659_100179105 95
47 3300025933 Ga0207706_10013346 Ga0207706_100133464 95
48 3300025936 Ga0207670_11325090 Ga0207670_113250901 95
49 3300025937 Ga0207669_10054673 Ga0207669_100546732 95
50 3300025938 Ga0207704_11827183 Ga0207704_118271831 95
51 3300025941 Ga0207711_10617808 Ga0207711_106178081 95
52 3300025960 Ga0207651_10002537 Ga0207651_100025374 95
53 3300025972 Ga0207668_10132167 Ga0207668_101321672 95
54 3300026023 Ga0207677_10289851 Ga0207677_102898512 95
55 3300026035 Ga0207703_10453604 Ga0207703_104536042 95
56 3300026089 Ga0207648_10473577 Ga0207648_104735772 95
57 3300026121 Ga0207683_10111254 Ga0207683_101112542 95
58 3300028379 Ga0268266_10021484 Ga0268266_100214842 95
59 3300025901 Ga0207688_10586927 Ga0207688_105869272 96
60 3300046528 Ga0495642_0206987 Ga0495642_0206987_243_581 96
61 3300001989 JGI24739J22299_10069223 JGI24739J22299_100692232 97
62 3300005355 Ga0070671_100325247 Ga0070671_1003252472 97
63 3300005543 Ga0070672_100053151 Ga0070672_1000531512 97
64 3300005548 Ga0070665_100001803 Ga0070665_1000018038 97
65 3300009177 Ga0105248_10222758 Ga0105248_102227583 97
66 3300013297 Ga0157378_10203835 Ga0157378_102038352 97
67 3300025931 Ga0207644_10008821 Ga0207644_100088216 97
68 3300025940 Ga0207691_10110674 Ga0207691_101106743 97
69 3300028379 Ga0268266_10000135 Ga0268266_1000013591 97
70 3300031852 Ga0307410_10022258 Ga0307410_100222582 97
71 3300031995 Ga0307409_101090035 Ga0307409_1010900352 97
72 3300032004 Ga0307414_10055326 Ga0307414_100553262 97
73 3300032005 Ga0307411_10335570 Ga0307411_103355702 97
74 3300049585 Ga0501069_0394348 Ga0501069_0394348_393_689 97
75 3300005327 Ga0070658_10647320 Ga0070658_106473202 98
76 3300005344 Ga0070661_100593362 Ga0070661_1005933621 98
77 3300005355 Ga0070671_100011993 Ga0070671_1000119932 98
78 3300005458 Ga0070681_11720576 Ga0070681_117205761 98
79 3300006237 Ga0097621_100226512 Ga0097621_1002265121 98
80 3300013296 Ga0157374_10132729 Ga0157374_101327292 98
81 3300025928 Ga0207700_10225793 Ga0207700_102257932 98
82 3300025931 Ga0207644_10010334 Ga0207644_100103342 98
83 3300026035 Ga0207703_10686792 Ga0207703_106867922 98
84 3300034816 Ga0373930_0038094 Ga0373930_0038094_293_589 98
85 3300035092 Ga0373952_0173571 Ga0373952_0173571_40_336 98
86 3300035121 Ga0373960_0037345 Ga0373960_0037345_345_641 98
87 3300035172 Ga0373955_0201570 Ga0373955_0201570_718_1014 98
88 3300035207 Ga0373942_0107855 Ga0373942_0107855_265_561 98
89 3300035691 Ga0373931_0644315 Ga0373931_0644315_265_561 98
90 3300039437 Ga0436365_1373897 Ga0436365_1373897_219_515 98
91 3300046616 Ga0495668_0210632 Ga0495668_0210632_362_658 98
92 3300046684 Ga0495669_0051755 Ga0495669_0051755_558_854 98
93 3300048903 Ga0496100_0214369 Ga0496100_0214369_236_532 98
94 3300048904 Ga0496101_0411016 Ga0496101_0411016_574_870 98
95 3300048909 Ga0496106_0912379 Ga0496106_0912379_86_382 98
96 3300048910 Ga0496107_0189725 Ga0496107_0189725_987_1283 98
97 3300048911 Ga0496108_1627656 Ga0496108_1627656_114_413 98
98 3300048915 Ga0496112_0529018 Ga0496112_0529018_387_683 98
99 3300048917 Ga0496114_0199265 Ga0496114_0199265_1083_1379 98
100 3300048918 Ga0496115_0000524 Ga0496115_0000524_20697_20993 98
101 3300001989 JGI24739J22299_10231706 JGI24739J22299_102317061 99
102 3300005327 Ga0070658_10353556 Ga0070658_103535562 99
103 3300005331 Ga0070670_100006971 Ga0070670_1000069712 99
104 3300005339 Ga0070660_100219006 Ga0070660_1002190062 99
105 3300005344 Ga0070661_100308309 Ga0070661_1003083092 99
106 3300005353 Ga0070669_101858625 Ga0070669_1018586252 99
107 3300005355 Ga0070671_100004423 Ga0070671_1000044235 99
108 3300005356 Ga0070674_100008578 Ga0070674_1000085784 99
109 3300005356 Ga0070674_100072517 Ga0070674_1000725173 99
110 3300005356 Ga0070674_100644555 Ga0070674_1006445552 99
111 3300005356 Ga0070674_101789408 Ga0070674_1017894081 99
112 3300005364 Ga0070673_100242477 Ga0070673_1002424772 99
113 3300005366 Ga0070659_101651667 Ga0070659_1016516671 99
114 3300005366 Ga0070659_102036443 Ga0070659_1020364431 99
115 3300005367 Ga0070667_100996340 Ga0070667_1009963401 99
116 3300005434 Ga0070709_11323065 Ga0070709_113230651 99
117 3300005435 Ga0070714_100242662 Ga0070714_1002426622 99
118 3300005436 Ga0070713_100005305 Ga0070713_1000053052 99
119 3300005455 Ga0070663_100569729 Ga0070663_1005697292 99
120 3300005455 Ga0070663_100627184 Ga0070663_1006271841 99
121 3300005456 Ga0070678_100000602 Ga0070678_10000060212 99
122 3300005456 Ga0070678_100667663 Ga0070678_1006676632 99
123 3300005457 Ga0070662_100018380 Ga0070662_1000183804 99
124 3300005457 Ga0070662_100140838 Ga0070662_1001408382 99
125 3300005539 Ga0068853_101047968 Ga0068853_1010479681 99
126 3300005543 Ga0070672_100044717 Ga0070672_1000447172 99
127 3300005543 Ga0070672_100570590 Ga0070672_1005705902 99
128 3300005548 Ga0070665_100006577 Ga0070665_1000065775 99
129 3300005548 Ga0070665_101199440 Ga0070665_1011994401 99
130 3300005564 Ga0070664_100001684 Ga0070664_1000016844 99
131 3300005577 Ga0068857_100511610 Ga0068857_1005116102 99
132 3300005616 Ga0068852_100378126 Ga0068852_1003781262 99
133 3300005618 Ga0068864_101214357 Ga0068864_1012143572 99
134 3300005843 Ga0068860_101758853 Ga0068860_1017588531 99
135 3300006173 Ga0070716_100015834 Ga0070716_1000158344 99
136 3300006175 Ga0070712_100080287 Ga0070712_1000802872 99
137 3300006237 Ga0097621_100766079 Ga0097621_1007660791 99
138 3300009177 Ga0105248_10984870 Ga0105248_109848701 99
139 3300012512 Ga0157327_1015862 Ga0157327_10158621 99
140 3300013306 Ga0163162_10245240 Ga0163162_102452402 99
141 3300013307 Ga0157372_11206751 Ga0157372_112067512 99
142 3300014326 Ga0157380_10901205 Ga0157380_109012051 99
143 3300014968 Ga0157379_11738170 Ga0157379_117381701 99
144 3300017792 Ga0163161_10465660 Ga0163161_104656601 99
145 3300025893 Ga0207682_10453950 Ga0207682_104539502 99
146 3300025903 Ga0207680_10117593 Ga0207680_101175932 99
147 3300025906 Ga0207699_10014882 Ga0207699_100148822 99
148 3300025907 Ga0207645_10287023 Ga0207645_102870232 99
149 3300025909 Ga0207705_10536356 Ga0207705_105363562 99
150 3300025915 Ga0207693_10113023 Ga0207693_101130232 99
151 3300025919 Ga0207657_10766734 Ga0207657_107667342 99
152 3300025919 Ga0207657_11235779 Ga0207657_112357791 99
153 3300025920 Ga0207649_10085199 Ga0207649_100851992 99
154 3300025925 Ga0207650_10008461 Ga0207650_100084612 99
155 3300025926 Ga0207659_10288695 Ga0207659_102886952 99
156 3300025929 Ga0207664_10014541 Ga0207664_100145411 99
157 3300025931 Ga0207644_10003385 Ga0207644_100033855 99
158 3300025931 Ga0207644_10870984 Ga0207644_108709842 99
159 3300025932 Ga0207690_11159762 Ga0207690_111597622 99
160 3300025933 Ga0207706_10054519 Ga0207706_100545192 99
161 3300025933 Ga0207706_10151755 Ga0207706_101517552 99
162 3300025933 Ga0207706_10168301 Ga0207706_101683012 99
163 3300025937 Ga0207669_10068710 Ga0207669_100687102 99
164 3300025937 Ga0207669_10700272 Ga0207669_107002721 99
165 3300025937 Ga0207669_11039744 Ga0207669_110397441 99
166 3300025939 Ga0207665_10067243 Ga0207665_100672433 99
167 3300025940 Ga0207691_10036651 Ga0207691_100366512 99
168 3300025940 Ga0207691_10037007 Ga0207691_100370074 99
169 3300025941 Ga0207711_10481600 Ga0207711_104816001 99
170 3300025945 Ga0207679_10288787 Ga0207679_102887872 99
171 3300025960 Ga0207651_10179734 Ga0207651_101797342 99
172 3300025981 Ga0207640_10234371 Ga0207640_102343712 99
173 3300026041 Ga0207639_10828272 Ga0207639_108282722 99
174 3300026067 Ga0207678_10555444 Ga0207678_105554441 99
175 3300026067 Ga0207678_10894298 Ga0207678_108942981 99
176 3300026095 Ga0207676_11055490 Ga0207676_110554902 99
177 3300026116 Ga0207674_11559980 Ga0207674_115599802 99
178 3300026121 Ga0207683_10004242 Ga0207683_100042422 99
179 3300026121 Ga0207683_10070658 Ga0207683_100706582 99
180 3300026142 Ga0207698_10319626 Ga0207698_103196262 99
181 3300026142 Ga0207698_11504024 Ga0207698_115040242 99
182 3300028379 Ga0268266_10071905 Ga0268266_100719052 99
183 3300028379 Ga0268266_11631157 Ga0268266_116311571 99
184 3300028381 Ga0268264_11189478 Ga0268264_111894782 99
185 3300035170 Ga0373943_0984343 Ga0373943_0984343_17_361 99
186 3300036401 Ga0373937_0518293 Ga0373937_0518293_334_678 99
187 3300037418 Ga0395900_0459460 Ga0395900_0459460_597_896 99
188 3300037418 Ga0395900_1287039 Ga0395900_1287039_37_336 99
189 3300037466 Ga0395898_0302261 Ga0395898_0302261_879_1178 99
190 3300037471 Ga0395905_0000980 Ga0395905_0000980_18756_19055 99
191 3300037471 Ga0395905_0010322 Ga0395905_0010322_8644_8943 99
192 3300038443 Ga0395901_0601514 Ga0395901_0601514_637_936 99
193 3300044658 Ga0466972_0578659 Ga0466972_0578659_88_387 99
194 3300044683 Ga0466965_0428610 Ga0466965_0428610_97_396 99
195 3300044901 Ga0466960_0024584 Ga0466960_0024584_383_682 99
196 3300046492 Ga0495585_0553835 Ga0495585_0553835_142_486 99
197 3300046507 Ga0495606_0547735 Ga0495606_0547735_89_391 99
198 3300046512 Ga0495610_0237637 Ga0495610_0237637_411_713 99
199 3300046513 Ga0495616_0358354 Ga0495616_0358354_261_563 99
200 3300046525 Ga0495663_0072052 Ga0495663_0072052_221_565 99
201 3300046525 Ga0495663_0134030 Ga0495663_0134030_356_658 99
202 3300046528 Ga0495642_0047455 Ga0495642_0047455_45_389 99
203 3300046539 Ga0495621_0000115 Ga0495621_0000115_4140_4484 99
204 3300046558 Ga0495633_0014696 Ga0495633_0014696_2943_3287 99
205 3300046616 Ga0495668_0010268 Ga0495668_0010268_666_968 99
206 3300046660 Ga0495625_0355765 Ga0495625_0355765_422_724 99
207 3300046664 Ga0495659_0181350 Ga0495659_0181350_45_389 99
208 3300046684 Ga0495669_0000296 Ga0495669_0000296_19171_19473 99
209 3300046684 Ga0495669_0004307 Ga0495669_0004307_285_629 99
210 3300046684 Ga0495669_0008286 Ga0495669_0008286_1995_2297 99
211 3300046684 Ga0495669_0061779 Ga0495669_0061779_199_501 99
212 3300046684 Ga0495669_0306755 Ga0495669_0306755_261_563 99
213 3300046691 Ga0495670_0000250 Ga0495670_0000250_16824_17168 99
214 3300046810 Ga0495660_0331592 Ga0495660_0331592_313_615 99
215 3300047445 Ga0495677_0023608 Ga0495677_0023608_1215_1517 99
216 3300047445 Ga0495677_0080975 Ga0495677_0080975_550_852 99
217 3300047447 Ga0495685_048812 Ga0495685_048812_585_887 99
218 3300047447 Ga0495685_223976 Ga0495685_223976_41_343 99
219 3300047470 Ga0495681_0275901 Ga0495681_0275901_321_623 99
220 3300048904 Ga0496101_0790514 Ga0496101_0790514_339_638 99
221 3300048909 Ga0496106_0885568 Ga0496106_0885568_147_482 99
222 3300048911 Ga0496108_1169173 Ga0496108_1169173_120_419 99
223 3300048915 Ga0496112_0579957 Ga0496112_0579957_634_933 99
224 3300005338 Ga0068868_100529423 Ga0068868_1005294232 100
225 3300005355 Ga0070671_100250483 Ga0070671_1002504832 100
226 3300005458 Ga0070681_11017424 Ga0070681_110174242 100
227 3300013100 Ga0157373_10613265 Ga0157373_106132651 100
228 3300013102 Ga0157371_10077636 Ga0157371_100776361 100
229 3300025907 Ga0207645_10085947 Ga0207645_100859472 100
230 3300025912 Ga0207707_10329609 Ga0207707_103296092 100
231 3300025918 Ga0207662_10254612 Ga0207662_102546122 100
232 3300025919 Ga0207657_10012888 Ga0207657_100128885 100
233 3300025933 Ga0207706_10063865 Ga0207706_100638653 100
234 3300025935 Ga0207709_10078991 Ga0207709_100789912 100
235 3300005458 Ga0070681_11849206 Ga0070681_118492062 103
236 3300031903 Ga0307407_11193320 Ga0307407_111933202 104
237 3300035171 Ga0373946_0701247 Ga0373946_0701247_83_403 104
238 3300035692 Ga0373935_0015642 Ga0373935_0015642_3471_3791 104
239 3300005344 Ga0070661_101187281 Ga0070661_1011872811 105
240 3300005356 Ga0070674_100588871 Ga0070674_1005888712 105
241 3300005455 Ga0070663_101553377 Ga0070663_1015533771 105
242 3300005539 Ga0068853_102472204 Ga0068853_1024722041 105
243 3300014326 Ga0157380_10003020 Ga0157380_100030204 105
244 3300025920 Ga0207649_10591926 Ga0207649_105919262 105
245 3300026067 Ga0207678_11314729 Ga0207678_113147291 105
246 3300031824 Ga0307413_10314168 Ga0307413_103141682 105
247 3300031901 Ga0307406_10322179 Ga0307406_103221793 105
248 3300031911 Ga0307412_10163270 Ga0307412_101632702 105
249 3300032005 Ga0307411_10329234 Ga0307411_103292342 105
250 3300032126 Ga0307415_100828919 Ga0307415_1008289191 105
251 3300044684 Ga0466966_0050949 Ga0466966_0050949_2115_2489 105
252 3300044694 Ga0466963_0855416 Ga0466963_0855416_41_373 105
253 3300044765 Ga0466970_0110391 Ga0466970_0110391_1054_1428 105
254 3300044901 Ga0466960_0706046 Ga0466960_0706046_104_478 105
255 3300045049 Ga0466959_0566681 Ga0466959_0566681_12_386 105
256 3300005328 Ga0070676_11403008 Ga0070676_114030081 106
257 3300005331 Ga0070670_100317338 Ga0070670_1003173382 106
258 3300005344 Ga0070661_100507572 Ga0070661_1005075722 106
259 3300005440 Ga0070705_100279137 Ga0070705_1002791372 106
260 3300005543 Ga0070672_101747331 Ga0070672_1017473311 106
261 3300009094 Ga0111539_11393386 Ga0111539_113933862 106
262 3300025923 Ga0207681_10473624 Ga0207681_104736242 106
263 3300025933 Ga0207706_10640331 Ga0207706_106403312 106
264 3300025940 Ga0207691_11271062 Ga0207691_112710622 106
265 3300025945 Ga0207679_10490492 Ga0207679_104904922 106
266 3300031731 Ga0307405_10746717 Ga0307405_107467171 106
267 3300031995 Ga0307409_100182855 Ga0307409_1001828552 106
268 3300032004 Ga0307414_10243639 Ga0307414_102436393 106
269 3300042004 Ga0439445_0010632 Ga0439445_0010632_1374_1721 106
270 3300045976 Ga0466967_1684389 Ga0466967_1684389_273_608 106
271 3300002076 JGI24749J21850_1010626 JGI24749J21850_10106262 107
272 3300002459 JGI24751J29686_10042277 JGI24751J29686_100422772 107
273 3300005289 Ga0065704_10454699 Ga0065704_104546991 107
274 3300005290 Ga0065712_10108055 Ga0065712_101080553 107
275 3300005293 Ga0065715_10089593 Ga0065715_100895937 107
276 3300005328 Ga0070676_10006525 Ga0070676_100065254 107
277 3300005331 Ga0070670_100003270 Ga0070670_1000032703 107
278 3300005331 Ga0070670_100061428 Ga0070670_1000614282 107
279 3300005333 Ga0070677_10000264 Ga0070677_100002647 107
280 3300005335 Ga0070666_10255873 Ga0070666_102558731 107
281 3300005347 Ga0070668_100015963 Ga0070668_1000159633 107
282 3300005347 Ga0070668_100043914 Ga0070668_1000439142 107
283 3300005347 Ga0070668_100107854 Ga0070668_1001078542 107
284 3300005353 Ga0070669_100002852 Ga0070669_1000028523 107
285 3300005354 Ga0070675_100002675 Ga0070675_1000026752 107
286 3300005355 Ga0070671_100005509 Ga0070671_1000055098 107
287 3300005356 Ga0070674_100012341 Ga0070674_1000123413 107
288 3300005366 Ga0070659_100150388 Ga0070659_1001503882 107
289 3300005367 Ga0070667_100032790 Ga0070667_1000327902 107
290 3300005441 Ga0070700_100035491 Ga0070700_1000354912 107
291 3300005445 Ga0070708_101204951 Ga0070708_1012049512 107
292 3300005456 Ga0070678_100013160 Ga0070678_1000131604 107
293 3300005457 Ga0070662_100001864 Ga0070662_10000186411 107
294 3300005459 Ga0068867_100017993 Ga0068867_1000179934 107
295 3300005539 Ga0068853_100478539 Ga0068853_1004785391 107
296 3300005539 Ga0068853_100670147 Ga0068853_1006701472 107
297 3300005544 Ga0070686_100084071 Ga0070686_1000840713 107
298 3300005577 Ga0068857_102053567 Ga0068857_1020535671 107
299 3300005618 Ga0068864_100106295 Ga0068864_1001062952 107
300 3300005840 Ga0068870_10121895 Ga0068870_101218952 107
301 3300005843 Ga0068860_100372856 Ga0068860_1003728562 107
302 3300006881 Ga0068865_100724093 Ga0068865_1007240931 107
303 3300009094 Ga0111539_10271562 Ga0111539_102715623 107
304 3300009147 Ga0114129_13227386 Ga0114129_132273861 107
305 3300009148 Ga0105243_10184064 Ga0105243_101840641 107
306 3300009177 Ga0105248_11612731 Ga0105248_116127312 107
307 3300009553 Ga0105249_10013720 Ga0105249_100137202 107
308 3300013306 Ga0163162_10363427 Ga0163162_103634272 107
309 3300013308 Ga0157375_10372678 Ga0157375_103726782 107
310 3300013308 Ga0157375_11840263 Ga0157375_118402631 107
311 3300014325 Ga0163163_10169084 Ga0163163_101690842 107
312 3300014325 Ga0163163_10647233 Ga0163163_106472332 107
313 3300014745 Ga0157377_10051990 Ga0157377_100519902 107
314 3300017792 Ga0163161_10061724 Ga0163161_100617242 107
315 3300025271 Ga0207666_1007291 Ga0207666_10072913 107
316 3300025903 Ga0207680_10235933 Ga0207680_102359332 107
317 3300025908 Ga0207643_10168649 Ga0207643_101686492 107
318 3300025923 Ga0207681_10069297 Ga0207681_100692972 107
319 3300025925 Ga0207650_10002198 Ga0207650_1000219810 107
320 3300025941 Ga0207711_10605931 Ga0207711_106059311 107
321 3300025961 Ga0207712_10049509 Ga0207712_100495092 107
322 3300025972 Ga0207668_10296603 Ga0207668_102966032 107
323 3300025972 Ga0207668_10485749 Ga0207668_104857492 107
324 3300026095 Ga0207676_10139109 Ga0207676_101391092 107
325 3300027876 Ga0209974_10219430 Ga0209974_102194301 107
326 3300028380 Ga0268265_10035410 Ga0268265_100354102 107
327 3300031548 Ga0307408_101580369 Ga0307408_1015803691 107
328 3300031731 Ga0307405_10165004 Ga0307405_101650042 107
329 3300031824 Ga0307413_10006937 Ga0307413_100069374 107
330 3300031824 Ga0307413_10446501 Ga0307413_104465012 107
331 3300031852 Ga0307410_10002666 Ga0307410_100026666 107
332 3300031852 Ga0307410_10377937 Ga0307410_103779372 107
333 3300031901 Ga0307406_10190009 Ga0307406_101900092 107
334 3300031901 Ga0307406_10839010 Ga0307406_108390101 107
335 3300031903 Ga0307407_10015490 Ga0307407_100154902 107
336 3300031911 Ga0307412_10178992 Ga0307412_101789922 107
337 3300031995 Ga0307409_100015545 Ga0307409_1000155454 107
338 3300031995 Ga0307409_100046540 Ga0307409_1000465402 107
339 3300032002 Ga0307416_100060446 Ga0307416_1000604463 107
340 3300032002 Ga0307416_102197828 Ga0307416_1021978281 107
341 3300032004 Ga0307414_10018828 Ga0307414_100188284 107
342 3300032004 Ga0307414_10075339 Ga0307414_100753392 107
343 3300032005 Ga0307411_10003373 Ga0307411_100033734 107
344 3300032005 Ga0307411_10410073 Ga0307411_104100732 107
345 3300032126 Ga0307415_100279487 Ga0307415_1002794872 107
346 3300032126 Ga0307415_101178782 Ga0307415_1011787822 107
347 3300042122 Ga0450920_080495 Ga0450920_080495_221_592 107
348 3300044684 Ga0466966_0192057 Ga0466966_0192057_20_397 107
349 3300044693 Ga0466961_0297146 Ga0466961_0297146_459_836 107
350 3300045049 Ga0466959_0161778 Ga0466959_0161778_212_589 107
351 3300046525 Ga0495663_0059207 Ga0495663_0059207_63_437 107
352 3300046537 Ga0495598_0054313 Ga0495598_0054313_116_490 107
353 3300046537 Ga0495598_0083931 Ga0495598_0083931_12_386 107
354 3300046539 Ga0495621_0005159 Ga0495621_0005159_1905_2279 107
355 3300046558 Ga0495633_0357828 Ga0495633_0357828_240_614 107
356 3300046664 Ga0495659_0096416 Ga0495659_0096416_485_919 107
357 3300046691 Ga0495670_0033031 Ga0495670_0033031_670_1044 107
358 3300047445 Ga0495677_0032573 Ga0495677_0032573_1132_1506 107
359 3300047447 Ga0495685_122198 Ga0495685_122198_469_843 107
360 3300050511 nmdc:mga08y16_302721_c1 nmdc:mga08y16_302721_c1_1263_1637 107
361 3300005337 Ga0070682_100397808 Ga0070682_1003978081 108
362 3300005617 Ga0068859_102793319 Ga0068859_1027933191 108
363 3300006931 Ga0097620_102794693 Ga0097620_1027946931 108
364 3300025960 Ga0207651_10238760 Ga0207651_102387602 108
365 3300026035 Ga0207703_10636159 Ga0207703_106361592 108
366 3300037471 Ga0395905_1380796 Ga0395905_1380796_222_575 108
367 3300037471 Ga0395905_1488181 Ga0395905_1488181_91_435 108
368 3300046525 Ga0495663_0017360 Ga0495663_0017360_492_824 108
369 3300046684 Ga0495669_0048417 Ga0495669_0048417_1277_1609 108
370 3300047445 Ga0495677_0004644 Ga0495677_0004644_1919_2251 108
371 3300048912 Ga0496109_0548705 Ga0496109_0548705_250_585 108
372 3300005331 Ga0070670_101738976 Ga0070670_1017389761 109
373 3300005344 Ga0070661_100358963 Ga0070661_1003589632 109
374 3300005355 Ga0070671_100117733 Ga0070671_1001177332 109
375 3300005457 Ga0070662_100369213 Ga0070662_1003692132 109
376 3300005564 Ga0070664_100008505 Ga0070664_1000085051 109
377 3300005564 Ga0070664_100147992 Ga0070664_1001479922 109
378 3300009093 Ga0105240_10138338 Ga0105240_101383382 109
379 3300009174 Ga0105241_10364886 Ga0105241_103648862 109
380 3300009177 Ga0105248_10775096 Ga0105248_107750961 109
381 3300009545 Ga0105237_10070432 Ga0105237_100704322 109
382 3300013100 Ga0157373_10076392 Ga0157373_100763922 109
383 3300013102 Ga0157371_10136912 Ga0157371_101369122 109
384 3300013104 Ga0157370_10116555 Ga0157370_101165552 109
385 3300013105 Ga0157369_10146616 Ga0157369_101466162 109
386 3300013307 Ga0157372_10036663 Ga0157372_100366633 109
387 3300025903 Ga0207680_10332274 Ga0207680_103322742 109
388 3300025920 Ga0207649_10059495 Ga0207649_100594952 109
389 3300025925 Ga0207650_10158796 Ga0207650_101587962 109
390 3300025931 Ga0207644_10035899 Ga0207644_100358993 109
391 3300025933 Ga0207706_10159766 Ga0207706_101597662 109
392 3300025945 Ga0207679_10003633 Ga0207679_100036333 109
393 3300026067 Ga0207678_11172677 Ga0207678_111726772 109
394 3300037312 Ga0395899_0224751 Ga0395899_0224751_848_1204 109
395 3300037466 Ga0395898_0013995 Ga0395898_0013995_4506_4841 109
396 3300037471 Ga0395905_0034438 Ga0395905_0034438_2358_2693 109
397 3300038443 Ga0395901_1794036 Ga0395901_1794036_124_483 109
398 3300046525 Ga0495663_0270677 Ga0495663_0270677_31_399 109
399 3300046684 Ga0495669_0043683 Ga0495669_0043683_939_1307 109
400 3300048910 Ga0496107_0437216 Ga0496107_0437216_588_926 109
401 3300048912 Ga0496109_2060170 Ga0496109_2060170_19_387 109
402 3300002067 JGI24735J21928_10001196 JGI24735J21928_100011966 110
403 3300005327 Ga0070658_10026219 Ga0070658_100262194 110
404 3300005327 Ga0070658_11485526 Ga0070658_114855261 110
405 3300005333 Ga0070677_10589312 Ga0070677_105893121 110
406 3300005355 Ga0070671_100239968 Ga0070671_1002399682 110
407 3300005456 Ga0070678_100025487 Ga0070678_1000254872 110
408 3300005457 Ga0070662_100166087 Ga0070662_1001660872 110
409 3300005459 Ga0068867_100424471 Ga0068867_1004244712 110
410 3300005543 Ga0070672_100276411 Ga0070672_1002764112 110
411 3300006237 Ga0097621_102390137 Ga0097621_1023901371 110
412 3300006358 Ga0068871_100851097 Ga0068871_1008510973 110
413 3300006881 Ga0068865_100202401 Ga0068865_1002024012 110
414 3300009177 Ga0105248_10482141 Ga0105248_104821412 110
415 3300013306 Ga0163162_10271101 Ga0163162_102711012 110
416 3300017792 Ga0163161_10076067 Ga0163161_100760672 110
417 3300025925 Ga0207650_11122695 Ga0207650_111226952 110
418 3300025931 Ga0207644_10886707 Ga0207644_108867072 110
419 3300025933 Ga0207706_10012753 Ga0207706_100127532 110
420 3300025938 Ga0207704_10182730 Ga0207704_101827302 110
421 3300025940 Ga0207691_10014156 Ga0207691_100141565 110
422 3300025941 Ga0207711_10313226 Ga0207711_103132262 110
423 3300026078 Ga0207702_10527602 Ga0207702_105276022 110
424 3300026089 Ga0207648_10196011 Ga0207648_101960112 110
425 3300026121 Ga0207683_10254736 Ga0207683_102547362 110
426 3300037312 Ga0395899_0001275 Ga0395899_0001275_7252_7593 110
427 3300037418 Ga0395900_0008634 Ga0395900_0008634_2063_2404 110
428 3300037466 Ga0395898_0005406 Ga0395898_0005406_8474_8815 110
429 3300037471 Ga0395905_0006701 Ga0395905_0006701_7252_7593 110
430 3300037471 Ga0395905_0033814 Ga0395905_0033814_3622_3969 110
431 3300038443 Ga0395901_0003914 Ga0395901_0003914_13613_13954 110
432 3300045976 Ga0466967_0686648 Ga0466967_0686648_136_477 110
433 3300046539 Ga0495621_0027519 Ga0495621_0027519_929_1267 110
434 3300048910 Ga0496107_0046938 Ga0496107_0046938_1812_2156 110
435 3300001978 JGI24747J21853_1032562 JGI24747J21853_10325622 111
436 3300001989 JGI24739J22299_10002371 JGI24739J22299_100023715 111
437 3300002073 JGI24745J21846_1002102 JGI24745J21846_10021022 111
438 3300002077 JGI24744J21845_10000224 JGI24744J21845_100002246 111
439 3300002244 JGI24742J22300_10012760 JGI24742J22300_100127602 111
440 3300005293 Ga0065715_10118184 Ga0065715_101181842 111
441 3300005327 Ga0070658_10031643 Ga0070658_100316433 111
442 3300005328 Ga0070676_10168198 Ga0070676_101681982 111
443 3300005328 Ga0070676_10434936 Ga0070676_104349362 111
444 3300005328 Ga0070676_10561812 Ga0070676_105618121 111
445 3300005330 Ga0070690_100016936 Ga0070690_1000169363 111
446 3300005330 Ga0070690_100359591 Ga0070690_1003595912 111
447 3300005331 Ga0070670_100023497 Ga0070670_1000234974 111
448 3300005333 Ga0070677_10017816 Ga0070677_100178162 111
449 3300005334 Ga0068869_100548911 Ga0068869_1005489111 111
450 3300005336 Ga0070680_101234448 Ga0070680_1012344481 111
451 3300005338 Ga0068868_100000431 Ga0068868_10000043113 111
452 3300005338 Ga0068868_100338254 Ga0068868_1003382542 111
453 3300005338 Ga0068868_101340166 Ga0068868_1013401661 111
454 3300005339 Ga0070660_100084828 Ga0070660_1000848282 111
455 3300005339 Ga0070660_100377669 Ga0070660_1003776692 111
456 3300005339 Ga0070660_100529821 Ga0070660_1005298211 111
457 3300005339 Ga0070660_101501802 Ga0070660_1015018021 111
458 3300005343 Ga0070687_100024887 Ga0070687_1000248872 111
459 3300005343 Ga0070687_100470867 Ga0070687_1004708671 111
460 3300005344 Ga0070661_100056629 Ga0070661_1000566292 111
461 3300005347 Ga0070668_100145679 Ga0070668_1001456793 111
462 3300005354 Ga0070675_100072589 Ga0070675_1000725892 111
463 3300005355 Ga0070671_100028759 Ga0070671_1000287592 111
464 3300005356 Ga0070674_100001611 Ga0070674_1000016115 111
465 3300005356 Ga0070674_100035517 Ga0070674_1000355173 111
466 3300005364 Ga0070673_100003914 Ga0070673_1000039147 111
467 3300005364 Ga0070673_100200043 Ga0070673_1002000432 111
468 3300005364 Ga0070673_100276377 Ga0070673_1002763772 111
469 3300005366 Ga0070659_100023328 Ga0070659_1000233284 111
470 3300005366 Ga0070659_100627322 Ga0070659_1006273222 111
471 3300005367 Ga0070667_100006261 Ga0070667_1000062615 111
472 3300005367 Ga0070667_100631965 Ga0070667_1006319652 111
473 3300005455 Ga0070663_100035118 Ga0070663_1000351183 111
474 3300005455 Ga0070663_100450483 Ga0070663_1004504832 111
475 3300005456 Ga0070678_100061022 Ga0070678_1000610222 111
476 3300005457 Ga0070662_100097110 Ga0070662_1000971102 111
477 3300005457 Ga0070662_100511333 Ga0070662_1005113332 111
478 3300005458 Ga0070681_10385194 Ga0070681_103851942 111
479 3300005459 Ga0068867_100121426 Ga0068867_1001214262 111
480 3300005459 Ga0068867_100217003 Ga0068867_1002170032 111
481 3300005466 Ga0070685_10190637 Ga0070685_101906371 111
482 3300005530 Ga0070679_100206905 Ga0070679_1002069053 111
483 3300005539 Ga0068853_100043354 Ga0068853_1000433543 111
484 3300005543 Ga0070672_100246880 Ga0070672_1002468802 111
485 3300005543 Ga0070672_100285088 Ga0070672_1002850882 111
486 3300005544 Ga0070686_100040593 Ga0070686_1000405932 111
487 3300005548 Ga0070665_100634851 Ga0070665_1006348511 111
488 3300005563 Ga0068855_100243640 Ga0068855_1002436402 111
489 3300005564 Ga0070664_100251248 Ga0070664_1002512482 111
490 3300005564 Ga0070664_100326213 Ga0070664_1003262132 111
491 3300005578 Ga0068854_100034418 Ga0068854_1000344183 111
492 3300005578 Ga0068854_100095867 Ga0068854_1000958672 111
493 3300005615 Ga0070702_100675225 Ga0070702_1006752252 111
494 3300005616 Ga0068852_100184408 Ga0068852_1001844082 111
495 3300005616 Ga0068852_100673195 Ga0068852_1006731951 111
496 3300005617 Ga0068859_101686042 Ga0068859_1016860421 111
497 3300005618 Ga0068864_100175966 Ga0068864_1001759662 111
498 3300005718 Ga0068866_10032299 Ga0068866_100322993 111
499 3300005718 Ga0068866_10047175 Ga0068866_100471752 111
500 3300005719 Ga0068861_100626123 Ga0068861_1006261231 111
501 3300005840 Ga0068870_10129364 Ga0068870_101293643 111
502 3300005842 Ga0068858_100001327 Ga0068858_10000132713 111
503 3300006358 Ga0068871_100057898 Ga0068871_1000578983 111
504 3300006881 Ga0068865_100107869 Ga0068865_1001078692 111
505 3300006881 Ga0068865_100528952 Ga0068865_1005289521 111
506 3300006931 Ga0097620_101686536 Ga0097620_1016865361 111
507 3300009098 Ga0105245_10563377 Ga0105245_105633772 111
508 3300009148 Ga0105243_10071021 Ga0105243_100710212 111
509 3300009148 Ga0105243_11021130 Ga0105243_110211302 111
510 3300009174 Ga0105241_10070560 Ga0105241_100705602 111
511 3300009177 Ga0105248_10002558 Ga0105248_1000255813 111
512 3300011119 Ga0105246_11708982 Ga0105246_117089821 111
513 3300013100 Ga0157373_10063624 Ga0157373_100636243 111
514 3300013296 Ga0157374_10166455 Ga0157374_101664553 111
515 3300013296 Ga0157374_10536931 Ga0157374_105369312 111
516 3300013297 Ga0157378_10070028 Ga0157378_100700284 111
517 3300013297 Ga0157378_10193915 Ga0157378_101939151 111
518 3300013306 Ga0163162_10404809 Ga0163162_104048092 111
519 3300013308 Ga0157375_10123967 Ga0157375_101239673 111
520 3300013308 Ga0157375_10155256 Ga0157375_101552562 111
521 3300014326 Ga0157380_11707726 Ga0157380_117077262 111
522 3300014497 Ga0182008_10062977 Ga0182008_100629772 111
523 3300014745 Ga0157377_10219518 Ga0157377_102195182 111
524 3300014968 Ga0157379_10036797 Ga0157379_100367974 111
525 3300014969 Ga0157376_10895141 Ga0157376_108951412 111
526 3300025315 Ga0207697_10009439 Ga0207697_100094394 111
527 3300025893 Ga0207682_10007627 Ga0207682_100076272 111
528 3300025899 Ga0207642_10261955 Ga0207642_102619552 111
529 3300025899 Ga0207642_10296139 Ga0207642_102961391 111
530 3300025901 Ga0207688_10006350 Ga0207688_100063504 111
531 3300025903 Ga0207680_10000735 Ga0207680_100007355 111
532 3300025904 Ga0207647_10001187 Ga0207647_100011875 111
533 3300025907 Ga0207645_10032082 Ga0207645_100320822 111
534 3300025908 Ga0207643_10213881 Ga0207643_102138812 111
535 3300025909 Ga0207705_10026507 Ga0207705_100265073 111
536 3300025911 Ga0207654_10082869 Ga0207654_100828693 111
537 3300025918 Ga0207662_10029162 Ga0207662_100291623 111
538 3300025919 Ga0207657_10040777 Ga0207657_100407773 111
539 3300025919 Ga0207657_10287436 Ga0207657_102874362 111
540 3300025919 Ga0207657_10666849 Ga0207657_106668492 111
541 3300025920 Ga0207649_10089338 Ga0207649_100893382 111
542 3300025920 Ga0207649_10330607 Ga0207649_103306072 111
543 3300025921 Ga0207652_11325638 Ga0207652_113256382 111
544 3300025925 Ga0207650_10116431 Ga0207650_101164311 111
545 3300025925 Ga0207650_10418263 Ga0207650_104182632 111
546 3300025926 Ga0207659_10270408 Ga0207659_102704082 111
547 3300025931 Ga0207644_10195282 Ga0207644_101952821 111
548 3300025932 Ga0207690_10395326 Ga0207690_103953262 111
549 3300025933 Ga0207706_10014810 Ga0207706_100148105 111
550 3300025933 Ga0207706_10173180 Ga0207706_101731803 111
551 3300025937 Ga0207669_10001445 Ga0207669_100014455 111
552 3300025937 Ga0207669_10002943 Ga0207669_100029436 111
553 3300025938 Ga0207704_10080568 Ga0207704_100805681 111
554 3300025938 Ga0207704_10431792 Ga0207704_104317921 111
555 3300025940 Ga0207691_10040923 Ga0207691_100409234 111
556 3300025940 Ga0207691_10232054 Ga0207691_102320542 111
557 3300025941 Ga0207711_10000477 Ga0207711_1000047725 111
558 3300025942 Ga0207689_10011903 Ga0207689_100119035 111
559 3300025949 Ga0207667_10275260 Ga0207667_102752603 111
560 3300025960 Ga0207651_10005197 Ga0207651_100051972 111
561 3300025960 Ga0207651_10198597 Ga0207651_101985972 111
562 3300025960 Ga0207651_10542575 Ga0207651_105425752 111
563 3300025972 Ga0207668_10351146 Ga0207668_103511461 111
564 3300025981 Ga0207640_10171286 Ga0207640_101712861 111
565 3300025981 Ga0207640_10372380 Ga0207640_103723801 111
566 3300025986 Ga0207658_10002851 Ga0207658_100028515 111
567 3300025986 Ga0207658_10577310 Ga0207658_105773102 111
568 3300026023 Ga0207677_10000754 Ga0207677_100007544 111
569 3300026023 Ga0207677_10034342 Ga0207677_100343422 111
570 3300026035 Ga0207703_10001631 Ga0207703_1000163110 111
571 3300026041 Ga0207639_10135661 Ga0207639_101356613 111
572 3300026067 Ga0207678_10057412 Ga0207678_100574123 111
573 3300026067 Ga0207678_10455621 Ga0207678_104556212 111
574 3300026088 Ga0207641_11035884 Ga0207641_110358842 111
575 3300026089 Ga0207648_10001859 Ga0207648_1000185910 111
576 3300026089 Ga0207648_10135408 Ga0207648_101354082 111
577 3300026116 Ga0207674_10266708 Ga0207674_102667082 111
578 3300026118 Ga0207675_100092389 Ga0207675_1000923893 111
579 3300026121 Ga0207683_10019589 Ga0207683_100195894 111
580 3300026142 Ga0207698_10152912 Ga0207698_101529122 111
581 3300026142 Ga0207698_10924706 Ga0207698_109247062 111
582 3300028379 Ga0268266_10523554 Ga0268266_105235541 111
583 3300035113 Ga0373936_0127178 Ga0373936_0127178_175_516 111
584 3300035121 Ga0373960_0324493 Ga0373960_0324493_129_464 111
585 3300037312 Ga0395899_0000326 Ga0395899_0000326_47248_47628 111
586 3300037312 Ga0395899_0073981 Ga0395899_0073981_1956_2291 111
587 3300037312 Ga0395899_0132990 Ga0395899_0132990_344_679 111
588 3300037418 Ga0395900_0000466 Ga0395900_0000466_18542_18922 111
589 3300037418 Ga0395900_0002846 Ga0395900_0002846_14797_15147 111
590 3300037418 Ga0395900_0033455 Ga0395900_0033455_3866_4201 111
591 3300037418 Ga0395900_0217866 Ga0395900_0217866_757_1092 111
592 3300037466 Ga0395898_0000721 Ga0395898_0000721_18542_18922 111
593 3300037466 Ga0395898_0058025 Ga0395898_0058025_2890_3225 111
594 3300037466 Ga0395898_0262795 Ga0395898_0262795_948_1283 111
595 3300037466 Ga0395898_0498372 Ga0395898_0498372_698_1048 111
596 3300037471 Ga0395905_0000439 Ga0395905_0000439_18542_18922 111
597 3300037471 Ga0395905_0001011 Ga0395905_0001011_3887_4237 111
598 3300037471 Ga0395905_0219748 Ga0395905_0219748_1114_1449 111
599 3300037471 Ga0395905_0510412 Ga0395905_0510412_417_752 111
600 3300038443 Ga0395901_0049362 Ga0395901_0049362_1807_2142 111
601 3300038443 Ga0395901_0442902 Ga0395901_0442902_500_880 111
602 3300038443 Ga0395901_0713309 Ga0395901_0713309_500_880 111
603 3300038443 Ga0395901_0953432 Ga0395901_0953432_237_572 111
604 3300048905 Ga0496102_0109143 Ga0496102_0109143_1059_1394 111
605 3300048906 Ga0496103_0064459 Ga0496103_0064459_1403_1738 111
606 3300048909 Ga0496106_0676516 Ga0496106_0676516_112_447 111
607 3300048910 Ga0496107_0032339 Ga0496107_0032339_2021_2356 111
608 3300048915 Ga0496112_0203820 Ga0496112_0203820_1006_1341 111
609 3300048915 Ga0496112_0738108 Ga0496112_0738108_106_441 111
610 3300048915 Ga0496112_1558280 Ga0496112_1558280_72_413 111
611 3300048916 Ga0496113_0110992 Ga0496113_0110992_70_405 111

Structural Annotation

Top 5 Hits

ID Description Score Start End
3iur-assembly1.cif.gz_A appep_d266nx+h2h3 opened state 0.9546 75 107
3mun-assembly1.cif.gz_A appep_pepclose closed state 0.8907 75 107
4hbr-assembly4.cif.gz_D crystal structure of a putative periplasmic proteins (bacegg_01429) from bacteroides eggerthii dsm 20697 at 2.40 a resolution 0.8742 60 105
2bkl-assembly1.cif.gz_A structural and mechanistic analysis of two prolyl endopeptidases: role of inter-domain dynamics in catalysis and specificity 0.8542 69 107
4k61-assembly2.cif.gz_B crystal structure of a duf2874 family protein (bacuni_01296) from bacteroides uniformis atcc 8492 at 1.70 a resolution 0.8383 55 105
ID Description Score Start End Superfamily
af_Q7KRR5_243_283_3.10.620.30 Alpha Beta;Roll;C8orf32 fold; 0.8508 69 97 3.10.620.30
2bklB02 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;Prolyl oligopeptidase, N-terminal domain 0.8491 69 107 2.130.10.120
af_Q2G105_44_121_3.10.450.40 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8298 54 108 3.10.450.40
af_P09833_289_351_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8203 71 99 2.40.50.100
3u1wA01 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8062 55 104 3.10.450.360
ID Description Score Start End GO Terms
AF-A0A845F8I6-F1-model_v4 PepSY domain-containing protein 0.8863 55 108 GO:0016020
AF-A0A2V6BA42-F1-model_v4 PepSY domain-containing protein 0.8759 60 110
AF-A0A227HC06-F1-model_v4 Peptidase S9A N-terminal domain-containing protein 0.8733 70 109 GO:0004252
AF-A0A102D951-F1-model_v4 PepSY domain-containing protein 0.8721 34 109
AF-A0A244D2L1-F1-model_v4 deleted 0.8643 60 105

Feature Viewer

pLDDT pTM Quality
70.31 0.54 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map