F469060
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 611 | 229 | 611 | 109 |
Family's Representative Sequence
| Representative Sequence | 3300009148|Ga0105243_10184064|Ga0105243_101840641 |
| Length | 139 |
| Sequence | LFNGLAIVRLAKVKPMSLYRTLVLSLCAASAAIATPALARRNDGNGNQVSVPHPASEAPHLAWLDRPRDQDRAFRDKQQGRSMPLPQIEQRVLPRMGGADYLGPELRGQNLRMKFMDNGRVIWVDVDPRTGRIIGKSGD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 6 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 7 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 8 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 9 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 10 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 12 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 19 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 23 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 46 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 49 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 53 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 55 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 56 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 57 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 59 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 60 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 61 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 62 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 63 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 64 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 65 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 66 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 67 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 71 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 72 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 84 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 96 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 159 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 160 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 161 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 162 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 163 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 164 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 165 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 166 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 167 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 168 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 169 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 170 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 171 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 172 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 173 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 174 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 175 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 176 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 177 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 178 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 179 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 180 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 181 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 182 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 183 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 184 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 185 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 186 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 187 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 188 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 189 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 190 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 191 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 192 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 193 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 194 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 195 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 196 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 197 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 198 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 217 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 218 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 219 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 220 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 221 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 222 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 223 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 224 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 225 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 226 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 227 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 228 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 229 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 3.93 |
| Rhizosphere | 95.91 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.16 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24747J21853_1032562 | 3300001978 | Unclassified | 600 |
| 2 | JGI24739J22299_10002371 | 3300001989 | Bacteria | 7261 |
| 3 | JGI24739J22299_10069223 | 3300001989 | Bacteria | 1100 |
| 4 | JGI24739J22299_10231706 | 3300001989 | Unclassified | 541 |
| 5 | JGI24743J22301_10022914 | 3300001991 | Bacteria | 1199 |
| 6 | JGI24735J21928_10001196 | 3300002067 | Bacteria | 9240 |
| 7 | JGI24745J21846_1002102 | 3300002073 | Bacteria | 2001 |
| 8 | JGI24749J21850_1010626 | 3300002076 | Bacteria | 1291 |
| 9 | JGI24744J21845_10000224 | 3300002077 | Bacteria | 9003 |
| 10 | JGI24742J22300_10012760 | 3300002244 | Bacteria | 1403 |
| 11 | JGI24751J29686_10042277 | 3300002459 | Bacteria | 942 |
| 12 | Ga0065704_10454699 | 3300005289 | Unclassified | 702 |
| 13 | Ga0065712_10108055 | 3300005290 | Bacteria | 1883 |
| 14 | Ga0065715_10089593 | 3300005293 | Bacteria | 9340 |
| 15 | Ga0065715_10118184 | 3300005293 | Bacteria | 2323 |
| 16 | Ga0070658_10026219 | 3300005327 | Bacteria | 4676 |
| 17 | Ga0070658_10031643 | 3300005327 | Bacteria | 4249 |
| 18 | Ga0070658_10353556 | 3300005327 | Bacteria | 1258 |
| 19 | Ga0070658_10647320 | 3300005327 | Bacteria | 917 |
| 20 | Ga0070658_11485526 | 3300005327 | Bacteria | 588 |
| 21 | Ga0070676_10006525 | 3300005328 | Bacteria | 6234 |
| 22 | Ga0070676_10168198 | 3300005328 | Bacteria | 1416 |
| 23 | Ga0070676_10434936 | 3300005328 | Bacteria | 919 |
| 24 | Ga0070676_10561812 | 3300005328 | Bacteria | 818 |
| 25 | Ga0070676_11403008 | 3300005328 | Bacteria | 536 |
| 26 | Ga0070690_100016936 | 3300005330 | Bacteria | 4375 |
| 27 | Ga0070690_100359591 | 3300005330 | Bacteria | 1059 |
| 28 | Ga0070670_100003270 | 3300005331 | Bacteria | 13400 |
| 29 | Ga0070670_100006971 | 3300005331 | Bacteria | 9578 |
| 30 | Ga0070670_100023497 | 3300005331 | Bacteria | 5306 |
| 31 | Ga0070670_100061428 | 3300005331 | Bacteria | 3225 |
| 32 | Ga0070670_100317338 | 3300005331 | Bacteria | 1365 |
| 33 | Ga0070670_101738976 | 3300005331 | Bacteria | 574 |
| 34 | Ga0070677_10000264 | 3300005333 | Bacteria | 18156 |
| 35 | Ga0070677_10017816 | 3300005333 | Bacteria | 2548 |
| 36 | Ga0070677_10589312 | 3300005333 | Unclassified | 614 |
| 37 | Ga0068869_100548911 | 3300005334 | Bacteria | 970 |
| 38 | Ga0070666_10255873 | 3300005335 | Unclassified | 1240 |
| 39 | Ga0070680_101234448 | 3300005336 | Bacteria | 647 |
| 40 | Ga0070682_100397808 | 3300005337 | Bacteria | 1041 |
| 41 | Ga0068868_100000431 | 3300005338 | Bacteria | 28155 |
| 42 | Ga0068868_100194703 | 3300005338 | Bacteria | 1687 |
| 43 | Ga0068868_100338254 | 3300005338 | Bacteria | 1286 |
| 44 | Ga0068868_100529423 | 3300005338 | Unclassified | 1036 |
| 45 | Ga0068868_101340166 | 3300005338 | Unclassified | 666 |
| 46 | Ga0070660_100084828 | 3300005339 | Bacteria | 2490 |
| 47 | Ga0070660_100219006 | 3300005339 | Bacteria | 1547 |
| 48 | Ga0070660_100377669 | 3300005339 | Bacteria | 1170 |
| 49 | Ga0070660_100529821 | 3300005339 | Bacteria | 982 |
| 50 | Ga0070660_100924526 | 3300005339 | Bacteria | 736 |
| 51 | Ga0070660_101501802 | 3300005339 | Bacteria | 573 |
| 52 | Ga0070689_100720949 | 3300005340 | Bacteria | 872 |
| 53 | Ga0070687_100024887 | 3300005343 | Bacteria | 2865 |
| 54 | Ga0070687_100470867 | 3300005343 | Bacteria | 840 |
| 55 | Ga0070661_100056629 | 3300005344 | Bacteria | 2873 |
| 56 | Ga0070661_100308309 | 3300005344 | Bacteria | 1234 |
| 57 | Ga0070661_100358963 | 3300005344 | Bacteria | 1145 |
| 58 | Ga0070661_100507572 | 3300005344 | Bacteria | 966 |
| 59 | Ga0070661_100593362 | 3300005344 | Bacteria | 895 |
| 60 | Ga0070661_101187281 | 3300005344 | Bacteria | 638 |
| 61 | Ga0070668_100015963 | 3300005347 | Bacteria | 5618 |
| 62 | Ga0070668_100043914 | 3300005347 | Bacteria | 3428 |
| 63 | Ga0070668_100107854 | 3300005347 | Bacteria | 2214 |
| 64 | Ga0070668_100145679 | 3300005347 | Bacteria | 1912 |
| 65 | Ga0070668_100158391 | 3300005347 | Bacteria | 1836 |
| 66 | Ga0070669_100002852 | 3300005353 | Bacteria | 12492 |
| 67 | Ga0070669_100425131 | 3300005353 | Bacteria | 1091 |
| 68 | Ga0070669_101858625 | 3300005353 | Bacteria | 526 |
| 69 | Ga0070675_100002675 | 3300005354 | Bacteria | 13396 |
| 70 | Ga0070675_100008719 | 3300005354 | Bacteria | 7877 |
| 71 | Ga0070675_100072589 | 3300005354 | Bacteria | 2857 |
| 72 | Ga0070671_100004423 | 3300005355 | Bacteria | 11116 |
| 73 | Ga0070671_100005509 | 3300005355 | Bacteria | 10094 |
| 74 | Ga0070671_100011993 | 3300005355 | Bacteria | 6971 |
| 75 | Ga0070671_100028759 | 3300005355 | Bacteria | 4580 |
| 76 | Ga0070671_100117733 | 3300005355 | Bacteria | 2234 |
| 77 | Ga0070671_100239968 | 3300005355 | Bacteria | 1538 |
| 78 | Ga0070671_100250483 | 3300005355 | Unclassified | 1504 |
| 79 | Ga0070671_100325247 | 3300005355 | Bacteria | 1310 |
| 80 | Ga0070674_100001611 | 3300005356 | Bacteria | 12109 |
| 81 | Ga0070674_100008578 | 3300005356 | Bacteria | 6095 |
| 82 | Ga0070674_100012341 | 3300005356 | Bacteria | 5245 |
| 83 | Ga0070674_100035517 | 3300005356 | Bacteria | 3338 |
| 84 | Ga0070674_100072517 | 3300005356 | Bacteria | 2438 |
| 85 | Ga0070674_100588871 | 3300005356 | Unclassified | 938 |
| 86 | Ga0070674_100644555 | 3300005356 | Bacteria | 900 |
| 87 | Ga0070674_101789408 | 3300005356 | Bacteria | 557 |
| 88 | Ga0070673_100003914 | 3300005364 | Bacteria | 9358 |
| 89 | Ga0070673_100005256 | 3300005364 | Bacteria | 8266 |
| 90 | Ga0070673_100200043 | 3300005364 | Bacteria | 1720 |
| 91 | Ga0070673_100242477 | 3300005364 | Bacteria | 1568 |
| 92 | Ga0070673_100276377 | 3300005364 | Bacteria | 1472 |
| 93 | Ga0070659_100023328 | 3300005366 | Bacteria | 4734 |
| 94 | Ga0070659_100150388 | 3300005366 | Bacteria | 1899 |
| 95 | Ga0070659_100627322 | 3300005366 | Bacteria | 925 |
| 96 | Ga0070659_101651667 | 3300005366 | Unclassified | 573 |
| 97 | Ga0070659_102036443 | 3300005366 | Unclassified | 516 |
| 98 | Ga0070667_100006261 | 3300005367 | Bacteria | 9897 |
| 99 | Ga0070667_100032790 | 3300005367 | Bacteria | 4335 |
| 100 | Ga0070667_100158894 | 3300005367 | Unclassified | 1990 |
| 101 | Ga0070667_100631965 | 3300005367 | Bacteria | 988 |
| 102 | Ga0070667_100996340 | 3300005367 | Bacteria | 782 |
| 103 | Ga0070709_11323065 | 3300005434 | Bacteria | 582 |
| 104 | Ga0070714_100242662 | 3300005435 | Bacteria | 1663 |
| 105 | Ga0070713_100005305 | 3300005436 | Bacteria | 8791 |
| 106 | Ga0070705_100279137 | 3300005440 | Bacteria | 1187 |
| 107 | Ga0070700_100035491 | 3300005441 | Bacteria | 3018 |
| 108 | Ga0070708_101204951 | 3300005445 | Unclassified | 708 |
| 109 | Ga0070663_100035118 | 3300005455 | Bacteria | 3476 |
| 110 | Ga0070663_100450483 | 3300005455 | Bacteria | 1061 |
| 111 | Ga0070663_100523626 | 3300005455 | Unclassified | 987 |
| 112 | Ga0070663_100569729 | 3300005455 | Bacteria | 949 |
| 113 | Ga0070663_100627184 | 3300005455 | Bacteria | 907 |
| 114 | Ga0070663_101553377 | 3300005455 | Bacteria | 589 |
| 115 | Ga0070678_100000602 | 3300005456 | Bacteria | 17695 |
| 116 | Ga0070678_100013160 | 3300005456 | Bacteria | 5176 |
| 117 | Ga0070678_100025487 | 3300005456 | Bacteria | 3979 |
| 118 | Ga0070678_100061022 | 3300005456 | Bacteria | 2778 |
| 119 | Ga0070678_100244232 | 3300005456 | Bacteria | 1503 |
| 120 | Ga0070678_100667663 | 3300005456 | Bacteria | 934 |
| 121 | Ga0070662_100001864 | 3300005457 | Bacteria | 12913 |
| 122 | Ga0070662_100018380 | 3300005457 | Bacteria | 4727 |
| 123 | Ga0070662_100097110 | 3300005457 | Bacteria | 2223 |
| 124 | Ga0070662_100140838 | 3300005457 | Bacteria | 1869 |
| 125 | Ga0070662_100166087 | 3300005457 | Bacteria | 1730 |
| 126 | Ga0070662_100369213 | 3300005457 | Bacteria | 1179 |
| 127 | Ga0070662_100511333 | 3300005457 | Bacteria | 1003 |
| 128 | Ga0070681_10385194 | 3300005458 | Bacteria | 1313 |
| 129 | Ga0070681_11017424 | 3300005458 | Unclassified | 749 |
| 130 | Ga0070681_11720576 | 3300005458 | Unclassified | 553 |
| 131 | Ga0070681_11849206 | 3300005458 | Bacteria | 531 |
| 132 | Ga0068867_100017993 | 3300005459 | Bacteria | 5021 |
| 133 | Ga0068867_100121426 | 3300005459 | Bacteria | 2020 |
| 134 | Ga0068867_100217003 | 3300005459 | Bacteria | 1539 |
| 135 | Ga0068867_100424471 | 3300005459 | Bacteria | 1127 |
| 136 | Ga0068867_100557920 | 3300005459 | Bacteria | 993 |
| 137 | Ga0070685_10057449 | 3300005466 | Bacteria | 2265 |
| 138 | Ga0070685_10190637 | 3300005466 | Bacteria | 1326 |
| 139 | Ga0070679_100206905 | 3300005530 | Bacteria | 1927 |
| 140 | Ga0070679_100260474 | 3300005530 | Bacteria | 1689 |
| 141 | Ga0068853_100043354 | 3300005539 | Bacteria | 3848 |
| 142 | Ga0068853_100478539 | 3300005539 | Bacteria | 1174 |
| 143 | Ga0068853_100670147 | 3300005539 | Bacteria | 988 |
| 144 | Ga0068853_101047968 | 3300005539 | Bacteria | 786 |
| 145 | Ga0068853_102472204 | 3300005539 | Bacteria | 503 |
| 146 | Ga0070672_100044717 | 3300005543 | Bacteria | 3422 |
| 147 | Ga0070672_100053151 | 3300005543 | Bacteria | 3166 |
| 148 | Ga0070672_100246880 | 3300005543 | Bacteria | 1503 |
| 149 | Ga0070672_100276411 | 3300005543 | Bacteria | 1419 |
| 150 | Ga0070672_100285088 | 3300005543 | Bacteria | 1397 |
| 151 | Ga0070672_100570590 | 3300005543 | Bacteria | 984 |
| 152 | Ga0070672_101747331 | 3300005543 | Bacteria | 559 |
| 153 | Ga0070686_100040593 | 3300005544 | Bacteria | 2904 |
| 154 | Ga0070686_100084071 | 3300005544 | Bacteria | 2114 |
| 155 | Ga0070665_100001803 | 3300005548 | Bacteria | 24285 |
| 156 | Ga0070665_100006577 | 3300005548 | Bacteria | 11814 |
| 157 | Ga0070665_100007119 | 3300005548 | Bacteria | 11370 |
| 158 | Ga0070665_100634851 | 3300005548 | Bacteria | 1081 |
| 159 | Ga0070665_101199440 | 3300005548 | Unclassified | 770 |
| 160 | Ga0068855_100243640 | 3300005563 | Bacteria | 2008 |
| 161 | Ga0068855_100301795 | 3300005563 | Bacteria | 1773 |
| 162 | Ga0070664_100001684 | 3300005564 | Bacteria | 17708 |
| 163 | Ga0070664_100008505 | 3300005564 | Bacteria | 8297 |
| 164 | Ga0070664_100147992 | 3300005564 | Bacteria | 2072 |
| 165 | Ga0070664_100251248 | 3300005564 | Bacteria | 1589 |
| 166 | Ga0070664_100326213 | 3300005564 | Bacteria | 1392 |
| 167 | Ga0070664_101318425 | 3300005564 | Unclassified | 682 |
| 168 | Ga0068857_100511610 | 3300005577 | Bacteria | 1128 |
| 169 | Ga0068857_102053567 | 3300005577 | Bacteria | 561 |
| 170 | Ga0068854_100034418 | 3300005578 | Bacteria | 3538 |
| 171 | Ga0068854_100095867 | 3300005578 | Bacteria | 2215 |
| 172 | Ga0068856_101632160 | 3300005614 | Bacteria | 658 |
| 173 | Ga0070702_100675225 | 3300005615 | Bacteria | 784 |
| 174 | Ga0068852_100184408 | 3300005616 | Bacteria | 1964 |
| 175 | Ga0068852_100378126 | 3300005616 | Bacteria | 1389 |
| 176 | Ga0068852_100673195 | 3300005616 | Bacteria | 1043 |
| 177 | Ga0068859_101686042 | 3300005617 | Bacteria | 700 |
| 178 | Ga0068859_102793319 | 3300005617 | Bacteria | 536 |
| 179 | Ga0068864_100106295 | 3300005618 | Bacteria | 2495 |
| 180 | Ga0068864_100175966 | 3300005618 | Bacteria | 1954 |
| 181 | Ga0068864_101214357 | 3300005618 | Bacteria | 753 |
| 182 | Ga0068866_10032299 | 3300005718 | Bacteria | 2530 |
| 183 | Ga0068866_10047175 | 3300005718 | Bacteria | 2171 |
| 184 | Ga0068866_10967316 | 3300005718 | Bacteria | 603 |
| 185 | Ga0068861_100626123 | 3300005719 | Bacteria | 991 |
| 186 | Ga0068851_10235407 | 3300005834 | Unclassified | 1034 |
| 187 | Ga0068870_10121895 | 3300005840 | Bacteria | 1503 |
| 188 | Ga0068870_10129364 | 3300005840 | Bacteria | 1465 |
| 189 | Ga0068858_100001327 | 3300005842 | Bacteria | 25539 |
| 190 | Ga0068858_100774053 | 3300005842 | Bacteria | 936 |
| 191 | Ga0068860_100372856 | 3300005843 | Bacteria | 1408 |
| 192 | Ga0068860_101758853 | 3300005843 | Unclassified | 642 |
| 193 | Ga0070716_100015834 | 3300006173 | Bacteria | 3884 |
| 194 | Ga0070712_100080287 | 3300006175 | Bacteria | 2361 |
| 195 | Ga0097621_100226512 | 3300006237 | Bacteria | 1631 |
| 196 | Ga0097621_100766079 | 3300006237 | Bacteria | 892 |
| 197 | Ga0097621_102390137 | 3300006237 | Unclassified | 506 |
| 198 | Ga0068871_100057898 | 3300006358 | Bacteria | 3154 |
| 199 | Ga0068871_100851097 | 3300006358 | Unclassified | 843 |
| 200 | Ga0068865_100107869 | 3300006881 | Bacteria | 2049 |
| 201 | Ga0068865_100202401 | 3300006881 | Bacteria | 1542 |
| 202 | Ga0068865_100528952 | 3300006881 | Bacteria | 987 |
| 203 | Ga0068865_100724093 | 3300006881 | Unclassified | 852 |
| 204 | Ga0097620_101686536 | 3300006931 | Bacteria | 700 |
| 205 | Ga0097620_102794693 | 3300006931 | Bacteria | 536 |
| 206 | Ga0105240_10138338 | 3300009093 | Bacteria | 2914 |
| 207 | Ga0111539_10271562 | 3300009094 | Bacteria | 1974 |
| 208 | Ga0111539_11393386 | 3300009094 | Bacteria | 813 |
| 209 | Ga0105245_10563377 | 3300009098 | Bacteria | 1162 |
| 210 | Ga0114129_13227386 | 3300009147 | Bacteria | 529 |
| 211 | Ga0105243_10071021 | 3300009148 | Bacteria | 2814 |
| 212 | Ga0105243_10184064 | 3300009148 | Bacteria | 1819 |
| 213 | Ga0105243_11021130 | 3300009148 | Bacteria | 831 |
| 214 | Ga0105241_10070560 | 3300009174 | Bacteria | 2711 |
| 215 | Ga0105241_10364886 | 3300009174 | Bacteria | 1258 |
| 216 | Ga0105241_10858818 | 3300009174 | Bacteria | 840 |
| 217 | Ga0105248_10002558 | 3300009177 | Bacteria | 20245 |
| 218 | Ga0105248_10222758 | 3300009177 | Bacteria | 2123 |
| 219 | Ga0105248_10471314 | 3300009177 | Bacteria | 1415 |
| 220 | Ga0105248_10482141 | 3300009177 | Bacteria | 1398 |
| 221 | Ga0105248_10775096 | 3300009177 | Bacteria | 1082 |
| 222 | Ga0105248_10984870 | 3300009177 | Bacteria | 952 |
| 223 | Ga0105248_11612731 | 3300009177 | Bacteria | 735 |
| 224 | Ga0105237_10070432 | 3300009545 | Bacteria | 3493 |
| 225 | Ga0105249_10013720 | 3300009553 | Bacteria | 7154 |
| 226 | Ga0105246_11612930 | 3300011119 | Bacteria | 613 |
| 227 | Ga0105246_11708982 | 3300011119 | Bacteria | 598 |
| 228 | Ga0157327_1015862 | 3300012512 | Bacteria | 789 |
| 229 | Ga0157373_10063624 | 3300013100 | Bacteria | 2612 |
| 230 | Ga0157373_10076392 | 3300013100 | Bacteria | 2363 |
| 231 | Ga0157373_10613265 | 3300013100 | Bacteria | 793 |
| 232 | Ga0157371_10077636 | 3300013102 | Bacteria | 2352 |
| 233 | Ga0157371_10136912 | 3300013102 | Bacteria | 1744 |
| 234 | Ga0157370_10116555 | 3300013104 | Bacteria | 2495 |
| 235 | Ga0157369_10146616 | 3300013105 | Bacteria | 2495 |
| 236 | Ga0157374_10132729 | 3300013296 | Bacteria | 2411 |
| 237 | Ga0157374_10166455 | 3300013296 | Bacteria | 2148 |
| 238 | Ga0157374_10536931 | 3300013296 | Bacteria | 1176 |
| 239 | Ga0157378_10070028 | 3300013297 | Bacteria | 3148 |
| 240 | Ga0157378_10193915 | 3300013297 | Bacteria | 1918 |
| 241 | Ga0157378_10203835 | 3300013297 | Bacteria | 1872 |
| 242 | Ga0157378_10649683 | 3300013297 | Unclassified | 1070 |
| 243 | Ga0163162_10023779 | 3300013306 | Bacteria | 6048 |
| 244 | Ga0163162_10245240 | 3300013306 | Bacteria | 1923 |
| 245 | Ga0163162_10271101 | 3300013306 | Bacteria | 1829 |
| 246 | Ga0163162_10363427 | 3300013306 | Bacteria | 1580 |
| 247 | Ga0163162_10404809 | 3300013306 | Bacteria | 1497 |
| 248 | Ga0157372_10036663 | 3300013307 | Bacteria | 5406 |
| 249 | Ga0157372_11206751 | 3300013307 | Unclassified | 874 |
| 250 | Ga0157375_10034637 | 3300013308 | Bacteria | 4812 |
| 251 | Ga0157375_10123967 | 3300013308 | Bacteria | 2697 |
| 252 | Ga0157375_10155256 | 3300013308 | Bacteria | 2427 |
| 253 | Ga0157375_10372678 | 3300013308 | Bacteria | 1594 |
| 254 | Ga0157375_11840263 | 3300013308 | Bacteria | 718 |
| 255 | Ga0163163_10169084 | 3300014325 | Bacteria | 2232 |
| 256 | Ga0163163_10647233 | 3300014325 | Bacteria | 1120 |
| 257 | Ga0157380_10002629 | 3300014326 | Bacteria | 12158 |
| 258 | Ga0157380_10003020 | 3300014326 | Bacteria | 11464 |
| 259 | Ga0157380_10901205 | 3300014326 | Bacteria | 910 |
| 260 | Ga0157380_11707726 | 3300014326 | Bacteria | 687 |
| 261 | Ga0182008_10062977 | 3300014497 | Bacteria | 1827 |
| 262 | Ga0157377_10051990 | 3300014745 | Bacteria | 2313 |
| 263 | Ga0157377_10203105 | 3300014745 | Bacteria | 1259 |
| 264 | Ga0157377_10219518 | 3300014745 | Bacteria | 1216 |
| 265 | Ga0157379_10036797 | 3300014968 | Bacteria | 4364 |
| 266 | Ga0157379_11155812 | 3300014968 | Unclassified | 743 |
| 267 | Ga0157379_11738170 | 3300014968 | Bacteria | 612 |
| 268 | Ga0157376_10895141 | 3300014969 | Bacteria | 905 |
| 269 | Ga0163161_10061724 | 3300017792 | Bacteria | 2729 |
| 270 | Ga0163161_10076067 | 3300017792 | Bacteria | 2464 |
| 271 | Ga0163161_10465660 | 3300017792 | Bacteria | 1024 |
| 272 | Ga0207666_1007291 | 3300025271 | Bacteria | 1453 |
| 273 | Ga0207697_10009439 | 3300025315 | Bacteria | 4215 |
| 274 | Ga0207697_10032044 | 3300025315 | Bacteria | 2151 |
| 275 | Ga0207656_10113165 | 3300025321 | Unclassified | 1256 |
| 276 | Ga0207682_10007627 | 3300025893 | Bacteria | 4305 |
| 277 | Ga0207682_10453950 | 3300025893 | Unclassified | 607 |
| 278 | Ga0207642_10261955 | 3300025899 | Bacteria | 986 |
| 279 | Ga0207642_10296139 | 3300025899 | Bacteria | 936 |
| 280 | Ga0207642_10769531 | 3300025899 | Bacteria | 611 |
| 281 | Ga0207688_10006350 | 3300025901 | Bacteria | 6435 |
| 282 | Ga0207688_10586927 | 3300025901 | Bacteria | 702 |
| 283 | Ga0207680_10000735 | 3300025903 | Bacteria | 15442 |
| 284 | Ga0207680_10117593 | 3300025903 | Bacteria | 1734 |
| 285 | Ga0207680_10235933 | 3300025903 | Unclassified | 1259 |
| 286 | Ga0207680_10332274 | 3300025903 | Bacteria | 1065 |
| 287 | Ga0207647_10001187 | 3300025904 | Bacteria | 20060 |
| 288 | Ga0207647_10240985 | 3300025904 | Bacteria | 1038 |
| 289 | Ga0207699_10014882 | 3300025906 | Bacteria | 4027 |
| 290 | Ga0207645_10032082 | 3300025907 | Bacteria | 3377 |
| 291 | Ga0207645_10085947 | 3300025907 | Unclassified | 2020 |
| 292 | Ga0207645_10287023 | 3300025907 | Bacteria | 1094 |
| 293 | Ga0207643_10168649 | 3300025908 | Bacteria | 1320 |
| 294 | Ga0207643_10213881 | 3300025908 | Bacteria | 1177 |
| 295 | Ga0207705_10026507 | 3300025909 | Bacteria | 4133 |
| 296 | Ga0207705_10536356 | 3300025909 | Bacteria | 909 |
| 297 | Ga0207654_10082869 | 3300025911 | Bacteria | 1935 |
| 298 | Ga0207707_10329609 | 3300025912 | Bacteria | 1317 |
| 299 | Ga0207693_10113023 | 3300025915 | Bacteria | 2130 |
| 300 | Ga0207662_10029162 | 3300025918 | Bacteria | 3195 |
| 301 | Ga0207662_10254612 | 3300025918 | Bacteria | 1153 |
| 302 | Ga0207657_10012888 | 3300025919 | Bacteria | 8221 |
| 303 | Ga0207657_10040777 | 3300025919 | Bacteria | 4111 |
| 304 | Ga0207657_10287436 | 3300025919 | Bacteria | 1304 |
| 305 | Ga0207657_10666849 | 3300025919 | Bacteria | 809 |
| 306 | Ga0207657_10766734 | 3300025919 | Bacteria | 747 |
| 307 | Ga0207657_11235779 | 3300025919 | Bacteria | 567 |
| 308 | Ga0207649_10059495 | 3300025920 | Bacteria | 2397 |
| 309 | Ga0207649_10085199 | 3300025920 | Bacteria | 2056 |
| 310 | Ga0207649_10089338 | 3300025920 | Bacteria | 2014 |
| 311 | Ga0207649_10316366 | 3300025920 | Bacteria | 1145 |
| 312 | Ga0207649_10330607 | 3300025920 | Bacteria | 1122 |
| 313 | Ga0207649_10591926 | 3300025920 | Bacteria | 852 |
| 314 | Ga0207652_11325638 | 3300025921 | Bacteria | 623 |
| 315 | Ga0207681_10069297 | 3300025923 | Bacteria | 2453 |
| 316 | Ga0207681_10473624 | 3300025923 | Bacteria | 1022 |
| 317 | Ga0207681_10546157 | 3300025923 | Bacteria | 953 |
| 318 | Ga0207650_10002198 | 3300025925 | Bacteria | 13634 |
| 319 | Ga0207650_10008461 | 3300025925 | Bacteria | 7024 |
| 320 | Ga0207650_10116431 | 3300025925 | Bacteria | 2075 |
| 321 | Ga0207650_10158796 | 3300025925 | Bacteria | 1790 |
| 322 | Ga0207650_10418263 | 3300025925 | Bacteria | 1112 |
| 323 | Ga0207650_11122695 | 3300025925 | Unclassified | 669 |
| 324 | Ga0207659_10017910 | 3300025926 | Bacteria | 4635 |
| 325 | Ga0207659_10270408 | 3300025926 | Bacteria | 1386 |
| 326 | Ga0207659_10288695 | 3300025926 | Bacteria | 1343 |
| 327 | Ga0207700_10225793 | 3300025928 | Bacteria | 1590 |
| 328 | Ga0207664_10014541 | 3300025929 | Bacteria | 5689 |
| 329 | Ga0207644_10003385 | 3300025931 | Bacteria | 10291 |
| 330 | Ga0207644_10008821 | 3300025931 | Bacteria | 6602 |
| 331 | Ga0207644_10010334 | 3300025931 | Bacteria | 6152 |
| 332 | Ga0207644_10035899 | 3300025931 | Bacteria | 3477 |
| 333 | Ga0207644_10195282 | 3300025931 | Bacteria | 1593 |
| 334 | Ga0207644_10870984 | 3300025931 | Bacteria | 754 |
| 335 | Ga0207644_10886707 | 3300025931 | Unclassified | 747 |
| 336 | Ga0207690_10395326 | 3300025932 | Bacteria | 1101 |
| 337 | Ga0207690_11159762 | 3300025932 | Bacteria | 645 |
| 338 | Ga0207706_10012753 | 3300025933 | Bacteria | 7649 |
| 339 | Ga0207706_10013346 | 3300025933 | Bacteria | 7473 |
| 340 | Ga0207706_10014810 | 3300025933 | Bacteria | 7059 |
| 341 | Ga0207706_10054519 | 3300025933 | Bacteria | 3528 |
| 342 | Ga0207706_10063865 | 3300025933 | Bacteria | 3241 |
| 343 | Ga0207706_10151755 | 3300025933 | Bacteria | 2038 |
| 344 | Ga0207706_10159766 | 3300025933 | Bacteria | 1981 |
| 345 | Ga0207706_10168301 | 3300025933 | Bacteria | 1926 |
| 346 | Ga0207706_10173180 | 3300025933 | Bacteria | 1896 |
| 347 | Ga0207706_10640331 | 3300025933 | Bacteria | 911 |
| 348 | Ga0207709_10078991 | 3300025935 | Bacteria | 2114 |
| 349 | Ga0207670_11325090 | 3300025936 | Bacteria | 611 |
| 350 | Ga0207669_10001445 | 3300025937 | Bacteria | 10126 |
| 351 | Ga0207669_10002943 | 3300025937 | Bacteria | 7314 |
| 352 | Ga0207669_10054673 | 3300025937 | Bacteria | 2413 |
| 353 | Ga0207669_10068710 | 3300025937 | Bacteria | 2214 |
| 354 | Ga0207669_10700272 | 3300025937 | Bacteria | 832 |
| 355 | Ga0207669_11039744 | 3300025937 | Bacteria | 689 |
| 356 | Ga0207704_10080568 | 3300025938 | Bacteria | 2102 |
| 357 | Ga0207704_10182730 | 3300025938 | Bacteria | 1517 |
| 358 | Ga0207704_10431792 | 3300025938 | Bacteria | 1047 |
| 359 | Ga0207704_11827183 | 3300025938 | Bacteria | 522 |
| 360 | Ga0207665_10067243 | 3300025939 | Bacteria | 2440 |
| 361 | Ga0207691_10014156 | 3300025940 | Bacteria | 7610 |
| 362 | Ga0207691_10036651 | 3300025940 | Bacteria | 4544 |
| 363 | Ga0207691_10037007 | 3300025940 | Bacteria | 4521 |
| 364 | Ga0207691_10040923 | 3300025940 | Bacteria | 4281 |
| 365 | Ga0207691_10110674 | 3300025940 | Bacteria | 2443 |
| 366 | Ga0207691_10232054 | 3300025940 | Bacteria | 1598 |
| 367 | Ga0207691_11271062 | 3300025940 | Bacteria | 608 |
| 368 | Ga0207711_10000477 | 3300025941 | Bacteria | 41350 |
| 369 | Ga0207711_10313226 | 3300025941 | Bacteria | 1449 |
| 370 | Ga0207711_10481600 | 3300025941 | Bacteria | 1156 |
| 371 | Ga0207711_10605931 | 3300025941 | Unclassified | 1022 |
| 372 | Ga0207711_10617808 | 3300025941 | Bacteria | 1011 |
| 373 | Ga0207689_10011903 | 3300025942 | Bacteria | 7455 |
| 374 | Ga0207689_11650635 | 3300025942 | Bacteria | 532 |
| 375 | Ga0207679_10003633 | 3300025945 | Bacteria | 9563 |
| 376 | Ga0207679_10288787 | 3300025945 | Bacteria | 1409 |
| 377 | Ga0207679_10490492 | 3300025945 | Bacteria | 1095 |
| 378 | Ga0207679_10778977 | 3300025945 | Unclassified | 871 |
| 379 | Ga0207667_10275260 | 3300025949 | Bacteria | 1721 |
| 380 | Ga0207651_10002537 | 3300025960 | Bacteria | 8721 |
| 381 | Ga0207651_10005197 | 3300025960 | Bacteria | 6651 |
| 382 | Ga0207651_10179734 | 3300025960 | Bacteria | 1677 |
| 383 | Ga0207651_10198597 | 3300025960 | Bacteria | 1605 |
| 384 | Ga0207651_10238760 | 3300025960 | Bacteria | 1480 |
| 385 | Ga0207651_10542575 | 3300025960 | Bacteria | 1010 |
| 386 | Ga0207651_11275413 | 3300025960 | Bacteria | 660 |
| 387 | Ga0207712_10049509 | 3300025961 | Bacteria | 2928 |
| 388 | Ga0207668_10132167 | 3300025972 | Bacteria | 1907 |
| 389 | Ga0207668_10296603 | 3300025972 | Bacteria | 1332 |
| 390 | Ga0207668_10351146 | 3300025972 | Bacteria | 1233 |
| 391 | Ga0207668_10485749 | 3300025972 | Bacteria | 1060 |
| 392 | Ga0207640_10171286 | 3300025981 | Bacteria | 1618 |
| 393 | Ga0207640_10234371 | 3300025981 | Bacteria | 1414 |
| 394 | Ga0207640_10372380 | 3300025981 | Bacteria | 1155 |
| 395 | Ga0207658_10002851 | 3300025986 | Bacteria | 12384 |
| 396 | Ga0207658_10577310 | 3300025986 | Bacteria | 1008 |
| 397 | Ga0207658_10973080 | 3300025986 | Unclassified | 774 |
| 398 | Ga0207677_10000754 | 3300026023 | Bacteria | 18643 |
| 399 | Ga0207677_10034342 | 3300026023 | Bacteria | 3283 |
| 400 | Ga0207677_10289851 | 3300026023 | Bacteria | 1348 |
| 401 | Ga0207703_10001631 | 3300026035 | Bacteria | 20220 |
| 402 | Ga0207703_10453604 | 3300026035 | Bacteria | 1198 |
| 403 | Ga0207703_10636159 | 3300026035 | Bacteria | 1011 |
| 404 | Ga0207703_10686792 | 3300026035 | Bacteria | 973 |
| 405 | Ga0207639_10135661 | 3300026041 | Bacteria | 2043 |
| 406 | Ga0207639_10828272 | 3300026041 | Bacteria | 863 |
| 407 | Ga0207678_10044057 | 3300026067 | Bacteria | 3861 |
| 408 | Ga0207678_10057412 | 3300026067 | Bacteria | 3349 |
| 409 | Ga0207678_10455621 | 3300026067 | Bacteria | 1112 |
| 410 | Ga0207678_10555444 | 3300026067 | Bacteria | 1004 |
| 411 | Ga0207678_10894298 | 3300026067 | Bacteria | 785 |
| 412 | Ga0207678_11172677 | 3300026067 | Bacteria | 680 |
| 413 | Ga0207678_11314729 | 3300026067 | Bacteria | 640 |
| 414 | Ga0207702_10527602 | 3300026078 | Bacteria | 1153 |
| 415 | Ga0207702_10731468 | 3300026078 | Bacteria | 976 |
| 416 | Ga0207641_11035884 | 3300026088 | Bacteria | 818 |
| 417 | Ga0207648_10001859 | 3300026089 | Bacteria | 23056 |
| 418 | Ga0207648_10053715 | 3300026089 | Bacteria | 3521 |
| 419 | Ga0207648_10135408 | 3300026089 | Bacteria | 2170 |
| 420 | Ga0207648_10196011 | 3300026089 | Bacteria | 1791 |
| 421 | Ga0207648_10473577 | 3300026089 | Bacteria | 1143 |
| 422 | Ga0207676_10139109 | 3300026095 | Bacteria | 2076 |
| 423 | Ga0207676_11055490 | 3300026095 | Bacteria | 802 |
| 424 | Ga0207674_10046179 | 3300026116 | Bacteria | 4474 |
| 425 | Ga0207674_10266708 | 3300026116 | Bacteria | 1660 |
| 426 | Ga0207674_11559980 | 3300026116 | Bacteria | 629 |
| 427 | Ga0207675_100092389 | 3300026118 | Bacteria | 2846 |
| 428 | Ga0207683_10004242 | 3300026121 | Bacteria | 12371 |
| 429 | Ga0207683_10019589 | 3300026121 | Bacteria | 5780 |
| 430 | Ga0207683_10070658 | 3300026121 | Bacteria | 3085 |
| 431 | Ga0207683_10111254 | 3300026121 | Bacteria | 2452 |
| 432 | Ga0207683_10254736 | 3300026121 | Bacteria | 1602 |
| 433 | Ga0207698_10152912 | 3300026142 | Bacteria | 2006 |
| 434 | Ga0207698_10319626 | 3300026142 | Bacteria | 1453 |
| 435 | Ga0207698_10924706 | 3300026142 | Bacteria | 880 |
| 436 | Ga0207698_11504024 | 3300026142 | Bacteria | 688 |
| 437 | Ga0209974_10219430 | 3300027876 | Bacteria | 707 |
| 438 | Ga0268266_10000135 | 3300028379 | Bacteria | 141959 |
| 439 | Ga0268266_10021484 | 3300028379 | Bacteria | 5497 |
| 440 | Ga0268266_10071905 | 3300028379 | Bacteria | 2998 |
| 441 | Ga0268266_10523554 | 3300028379 | Bacteria | 1134 |
| 442 | Ga0268266_11631157 | 3300028379 | Bacteria | 620 |
| 443 | Ga0268265_10035410 | 3300028380 | Bacteria | 3647 |
| 444 | Ga0268264_11189478 | 3300028381 | Bacteria | 772 |
| 445 | Ga0307408_101580369 | 3300031548 | Bacteria | 622 |
| 446 | Ga0307405_10165004 | 3300031731 | Bacteria | 1573 |
| 447 | Ga0307405_10746717 | 3300031731 | Bacteria | 815 |
| 448 | Ga0307413_10006937 | 3300031824 | Bacteria | 5215 |
| 449 | Ga0307413_10314168 | 3300031824 | Bacteria | 1194 |
| 450 | Ga0307413_10446501 | 3300031824 | Bacteria | 1025 |
| 451 | Ga0307410_10002666 | 3300031852 | Bacteria | 8698 |
| 452 | Ga0307410_10022258 | 3300031852 | Bacteria | 3914 |
| 453 | Ga0307410_10377937 | 3300031852 | Bacteria | 1139 |
| 454 | Ga0307406_10190009 | 3300031901 | Bacteria | 1502 |
| 455 | Ga0307406_10322179 | 3300031901 | Bacteria | 1196 |
| 456 | Ga0307406_10839010 | 3300031901 | Bacteria | 778 |
| 457 | Ga0307407_10015490 | 3300031903 | Bacteria | 3771 |
| 458 | Ga0307407_11193320 | 3300031903 | Bacteria | 594 |
| 459 | Ga0307412_10163270 | 3300031911 | Bacteria | 1658 |
| 460 | Ga0307412_10178992 | 3300031911 | Bacteria | 1593 |
| 461 | Ga0307409_100015545 | 3300031995 | Bacteria | 4999 |
| 462 | Ga0307409_100046540 | 3300031995 | Bacteria | 3284 |
| 463 | Ga0307409_100182855 | 3300031995 | Bacteria | 1858 |
| 464 | Ga0307409_101090035 | 3300031995 | Bacteria | 819 |
| 465 | Ga0307416_100060446 | 3300032002 | Bacteria | 3086 |
| 466 | Ga0307416_102197828 | 3300032002 | Bacteria | 653 |
| 467 | Ga0307414_10018828 | 3300032004 | Bacteria | 4263 |
| 468 | Ga0307414_10055326 | 3300032004 | Bacteria | 2778 |
| 469 | Ga0307414_10075339 | 3300032004 | Bacteria | 2448 |
| 470 | Ga0307414_10243639 | 3300032004 | Bacteria | 1490 |
| 471 | Ga0307411_10003373 | 3300032005 | Bacteria | 7396 |
| 472 | Ga0307411_10329234 | 3300032005 | Bacteria | 1237 |
| 473 | Ga0307411_10335570 | 3300032005 | Bacteria | 1226 |
| 474 | Ga0307411_10410073 | 3300032005 | Bacteria | 1122 |
| 475 | Ga0307415_100279487 | 3300032126 | Bacteria | 1372 |
| 476 | Ga0307415_100828919 | 3300032126 | Bacteria | 847 |
| 477 | Ga0307415_101178782 | 3300032126 | Bacteria | 721 |
| 478 | Ga0373930_0038094 | 3300034816 | Bacteria | 1015 |
| 479 | Ga0373952_0173571 | 3300035092 | Bacteria | 618 |
| 480 | Ga0373936_0127178 | 3300035113 | Bacteria | 1093 |
| 481 | Ga0373960_0037345 | 3300035121 | Bacteria | 1388 |
| 482 | Ga0373960_0324493 | 3300035121 | Unclassified | 578 |
| 483 | Ga0373943_0984343 | 3300035170 | Unclassified | 505 |
| 484 | Ga0373946_0701247 | 3300035171 | Bacteria | 529 |
| 485 | Ga0373955_0201570 | 3300035172 | Bacteria | 1185 |
| 486 | Ga0373942_0107855 | 3300035207 | Bacteria | 858 |
| 487 | Ga0373931_0644315 | 3300035691 | Bacteria | 696 |
| 488 | Ga0373935_0015642 | 3300035692 | Bacteria | 4588 |
| 489 | Ga0373937_0518293 | 3300036401 | Bacteria | 1133 |
| 490 | Ga0395899_0000326 | 3300037312 | Bacteria | 60434 |
| 491 | Ga0395899_0001275 | 3300037312 | Bacteria | 21915 |
| 492 | Ga0395899_0073981 | 3300037312 | Bacteria | 2490 |
| 493 | Ga0395899_0132990 | 3300037312 | Bacteria | 1775 |
| 494 | Ga0395899_0224751 | 3300037312 | Bacteria | 1299 |
| 495 | Ga0395900_0000466 | 3300037418 | Bacteria | 58174 |
| 496 | Ga0395900_0002846 | 3300037418 | Bacteria | 18877 |
| 497 | Ga0395900_0008634 | 3300037418 | Bacteria | 10470 |
| 498 | Ga0395900_0033455 | 3300037418 | Bacteria | 5290 |
| 499 | Ga0395900_0217866 | 3300037418 | Bacteria | 1925 |
| 500 | Ga0395900_0459460 | 3300037418 | Bacteria | 1228 |
| 501 | Ga0395900_1287039 | 3300037418 | Bacteria | 645 |
| 502 | Ga0395898_0000721 | 3300037466 | Bacteria | 58174 |
| 503 | Ga0395898_0005406 | 3300037466 | Bacteria | 13804 |
| 504 | Ga0395898_0013995 | 3300037466 | Bacteria | 8244 |
| 505 | Ga0395898_0058025 | 3300037466 | Bacteria | 3770 |
| 506 | Ga0395898_0262795 | 3300037466 | Bacteria | 1646 |
| 507 | Ga0395898_0302261 | 3300037466 | Bacteria | 1526 |
| 508 | Ga0395898_0498372 | 3300037466 | Bacteria | 1158 |
| 509 | Ga0395905_0000439 | 3300037471 | Bacteria | 58163 |
| 510 | Ga0395905_0000980 | 3300037471 | Bacteria | 36613 |
| 511 | Ga0395905_0001011 | 3300037471 | Bacteria | 35880 |
| 512 | Ga0395905_0006701 | 3300037471 | Bacteria | 11533 |
| 513 | Ga0395905_0010322 | 3300037471 | Bacteria | 9088 |
| 514 | Ga0395905_0033814 | 3300037471 | Bacteria | 4802 |
| 515 | Ga0395905_0034438 | 3300037471 | Bacteria | 4755 |
| 516 | Ga0395905_0219748 | 3300037471 | Bacteria | 1778 |
| 517 | Ga0395905_0510412 | 3300037471 | Bacteria | 1102 |
| 518 | Ga0395905_1380796 | 3300037471 | Unclassified | 608 |
| 519 | Ga0395905_1488181 | 3300037471 | Bacteria | 581 |
| 520 | Ga0395901_0003914 | 3300038443 | Bacteria | 14983 |
| 521 | Ga0395901_0049362 | 3300038443 | Bacteria | 4372 |
| 522 | Ga0395901_0442902 | 3300038443 | Bacteria | 1329 |
| 523 | Ga0395901_0601514 | 3300038443 | Bacteria | 1109 |
| 524 | Ga0395901_0713309 | 3300038443 | Unclassified | 999 |
| 525 | Ga0395901_0953432 | 3300038443 | Bacteria | 836 |
| 526 | Ga0395901_1794036 | 3300038443 | Bacteria | 563 |
| 527 | Ga0436365_1373897 | 3300039437 | Bacteria | 564 |
| 528 | Ga0439445_0010632 | 3300042004 | Bacteria | 2181 |
| 529 | Ga0450920_080495 | 3300042122 | Bacteria | 667 |
| 530 | Ga0466972_0578659 | 3300044658 | Unclassified | 530 |
| 531 | Ga0466965_0428610 | 3300044683 | Bacteria | 734 |
| 532 | Ga0466966_0050949 | 3300044684 | Bacteria | 2633 |
| 533 | Ga0466966_0168285 | 3300044684 | Bacteria | 1332 |
| 534 | Ga0466966_0192057 | 3300044684 | Bacteria | 1237 |
| 535 | Ga0466961_0297146 | 3300044693 | Bacteria | 987 |
| 536 | Ga0466963_0855416 | 3300044694 | Bacteria | 641 |
| 537 | Ga0466970_0110391 | 3300044765 | Bacteria | 1502 |
| 538 | Ga0466960_0024584 | 3300044901 | Bacteria | 2719 |
| 539 | Ga0466960_0706046 | 3300044901 | Unclassified | 605 |
| 540 | Ga0466959_0161778 | 3300045049 | Bacteria | 1574 |
| 541 | Ga0466959_0566681 | 3300045049 | Bacteria | 765 |
| 542 | Ga0466967_0686648 | 3300045976 | Bacteria | 1013 |
| 543 | Ga0466967_1684389 | 3300045976 | Bacteria | 631 |
| 544 | Ga0495585_0553835 | 3300046492 | Unclassified | 543 |
| 545 | Ga0495606_0547735 | 3300046507 | Bacteria | 576 |
| 546 | Ga0495610_0237637 | 3300046512 | Bacteria | 728 |
| 547 | Ga0495616_0358354 | 3300046513 | Bacteria | 606 |
| 548 | Ga0495663_0017360 | 3300046525 | Bacteria | 2042 |
| 549 | Ga0495663_0059207 | 3300046525 | Bacteria | 1201 |
| 550 | Ga0495663_0072052 | 3300046525 | Bacteria | 1101 |
| 551 | Ga0495663_0134030 | 3300046525 | Bacteria | 837 |
| 552 | Ga0495663_0270677 | 3300046525 | Bacteria | 607 |
| 553 | Ga0495642_0047455 | 3300046528 | Bacteria | 1759 |
| 554 | Ga0495642_0206987 | 3300046528 | Bacteria | 856 |
| 555 | Ga0495598_0054313 | 3300046537 | Bacteria | 1216 |
| 556 | Ga0495598_0083931 | 3300046537 | Bacteria | 1027 |
| 557 | Ga0495621_0000115 | 3300046539 | Bacteria | 16944 |
| 558 | Ga0495621_0005159 | 3300046539 | Bacteria | 3734 |
| 559 | Ga0495621_0027519 | 3300046539 | Bacteria | 1926 |
| 560 | Ga0495633_0014696 | 3300046558 | Bacteria | 4083 |
| 561 | Ga0495633_0357828 | 3300046558 | Unclassified | 661 |
| 562 | Ga0495668_0010268 | 3300046616 | Bacteria | 5681 |
| 563 | Ga0495668_0210632 | 3300046616 | Bacteria | 1064 |
| 564 | Ga0495625_0355765 | 3300046660 | Bacteria | 924 |
| 565 | Ga0495659_0096416 | 3300046664 | Bacteria | 1141 |
| 566 | Ga0495659_0181350 | 3300046664 | Bacteria | 857 |
| 567 | Ga0495669_0000296 | 3300046684 | Bacteria | 27684 |
| 568 | Ga0495669_0004307 | 3300046684 | Bacteria | 5872 |
| 569 | Ga0495669_0008286 | 3300046684 | Bacteria | 4365 |
| 570 | Ga0495669_0043683 | 3300046684 | Bacteria | 1996 |
| 571 | Ga0495669_0048417 | 3300046684 | Bacteria | 1901 |
| 572 | Ga0495669_0051755 | 3300046684 | Bacteria | 1844 |
| 573 | Ga0495669_0061779 | 3300046684 | Bacteria | 1696 |
| 574 | Ga0495669_0306755 | 3300046684 | Bacteria | 765 |
| 575 | Ga0495670_0000250 | 3300046691 | Bacteria | 24933 |
| 576 | Ga0495670_0033031 | 3300046691 | Bacteria | 2574 |
| 577 | Ga0495660_0331592 | 3300046810 | Bacteria | 681 |
| 578 | Ga0495677_0004644 | 3300047445 | Bacteria | 5242 |
| 579 | Ga0495677_0023608 | 3300047445 | Bacteria | 2232 |
| 580 | Ga0495677_0032573 | 3300047445 | Bacteria | 1898 |
| 581 | Ga0495677_0080975 | 3300047445 | Bacteria | 1217 |
| 582 | Ga0495685_048812 | 3300047447 | Bacteria | 1439 |
| 583 | Ga0495685_122198 | 3300047447 | Bacteria | 854 |
| 584 | Ga0495685_223976 | 3300047447 | Bacteria | 600 |
| 585 | Ga0495681_0275901 | 3300047470 | Bacteria | 657 |
| 586 | Ga0496100_0214369 | 3300048903 | Bacteria | 1410 |
| 587 | Ga0496101_0411016 | 3300048904 | Bacteria | 1066 |
| 588 | Ga0496101_0790514 | 3300048904 | Bacteria | 748 |
| 589 | Ga0496102_0109143 | 3300048905 | Bacteria | 2578 |
| 590 | Ga0496103_0064459 | 3300048906 | Bacteria | 2284 |
| 591 | Ga0496106_0676516 | 3300048909 | Bacteria | 823 |
| 592 | Ga0496106_0885568 | 3300048909 | Bacteria | 705 |
| 593 | Ga0496106_0912379 | 3300048909 | Bacteria | 693 |
| 594 | Ga0496107_0032339 | 3300048910 | Bacteria | 3739 |
| 595 | Ga0496107_0046938 | 3300048910 | Bacteria | 3109 |
| 596 | Ga0496107_0189725 | 3300048910 | Bacteria | 1527 |
| 597 | Ga0496107_0437216 | 3300048910 | Bacteria | 972 |
| 598 | Ga0496108_1169173 | 3300048911 | Bacteria | 652 |
| 599 | Ga0496108_1627656 | 3300048911 | Bacteria | 534 |
| 600 | Ga0496109_0548705 | 3300048912 | Bacteria | 1090 |
| 601 | Ga0496109_2060170 | 3300048912 | Bacteria | 502 |
| 602 | Ga0496112_0203820 | 3300048915 | Bacteria | 1936 |
| 603 | Ga0496112_0529018 | 3300048915 | Bacteria | 1113 |
| 604 | Ga0496112_0579957 | 3300048915 | Bacteria | 1054 |
| 605 | Ga0496112_0738108 | 3300048915 | Bacteria | 911 |
| 606 | Ga0496112_1558280 | 3300048915 | Bacteria | 574 |
| 607 | Ga0496113_0110992 | 3300048916 | Bacteria | 2135 |
| 608 | Ga0496114_0199265 | 3300048917 | Bacteria | 1753 |
| 609 | Ga0496115_0000524 | 3300048918 | Bacteria | 29765 |
| 610 | Ga0501069_0394348 | 3300049585 | Bacteria | 819 |
| 611 | nmdc:mga08y16_302721_c1 | 3300050511 | Bacteria | 1648 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300011119 | Ga0105246_11612930 | Ga0105246_116129301 | 83 |
| 2 | 3300005367 | Ga0070667_100158894 | Ga0070667_1001588942 | 92 |
| 3 | 3300005455 | Ga0070663_100523626 | Ga0070663_1005236262 | 92 |
| 4 | 3300005530 | Ga0070679_100260474 | Ga0070679_1002604742 | 92 |
| 5 | 3300005563 | Ga0068855_100301795 | Ga0068855_1003017952 | 92 |
| 6 | 3300005564 | Ga0070664_101318425 | Ga0070664_1013184252 | 92 |
| 7 | 3300005614 | Ga0068856_101632160 | Ga0068856_1016321601 | 92 |
| 8 | 3300005834 | Ga0068851_10235407 | Ga0068851_102354072 | 92 |
| 9 | 3300009174 | Ga0105241_10858818 | Ga0105241_108588181 | 92 |
| 10 | 3300013297 | Ga0157378_10649683 | Ga0157378_106496832 | 92 |
| 11 | 3300014968 | Ga0157379_11155812 | Ga0157379_111558122 | 92 |
| 12 | 3300025321 | Ga0207656_10113165 | Ga0207656_101131652 | 92 |
| 13 | 3300025904 | Ga0207647_10240985 | Ga0207647_102409852 | 92 |
| 14 | 3300025920 | Ga0207649_10316366 | Ga0207649_103163662 | 92 |
| 15 | 3300025942 | Ga0207689_11650635 | Ga0207689_116506351 | 92 |
| 16 | 3300025945 | Ga0207679_10778977 | Ga0207679_107789772 | 92 |
| 17 | 3300025960 | Ga0207651_11275413 | Ga0207651_112754132 | 92 |
| 18 | 3300025986 | Ga0207658_10973080 | Ga0207658_109730802 | 92 |
| 19 | 3300026067 | Ga0207678_10044057 | Ga0207678_100440572 | 92 |
| 20 | 3300026078 | Ga0207702_10731468 | Ga0207702_107314682 | 92 |
| 21 | 3300026089 | Ga0207648_10053715 | Ga0207648_100537152 | 92 |
| 22 | 3300026116 | Ga0207674_10046179 | Ga0207674_100461793 | 92 |
| 23 | 3300014326 | Ga0157380_10002629 | Ga0157380_100026299 | 94 |
| 24 | 3300044684 | Ga0466966_0168285 | Ga0466966_0168285_734_1066 | 94 |
| 25 | 3300001991 | JGI24743J22301_10022914 | JGI24743J22301_100229141 | 95 |
| 26 | 3300005338 | Ga0068868_100194703 | Ga0068868_1001947032 | 95 |
| 27 | 3300005339 | Ga0070660_100924526 | Ga0070660_1009245261 | 95 |
| 28 | 3300005340 | Ga0070689_100720949 | Ga0070689_1007209492 | 95 |
| 29 | 3300005347 | Ga0070668_100158391 | Ga0070668_1001583912 | 95 |
| 30 | 3300005353 | Ga0070669_100425131 | Ga0070669_1004251312 | 95 |
| 31 | 3300005354 | Ga0070675_100008719 | Ga0070675_1000087194 | 95 |
| 32 | 3300005364 | Ga0070673_100005256 | Ga0070673_1000052565 | 95 |
| 33 | 3300005456 | Ga0070678_100244232 | Ga0070678_1002442322 | 95 |
| 34 | 3300005459 | Ga0068867_100557920 | Ga0068867_1005579202 | 95 |
| 35 | 3300005466 | Ga0070685_10057449 | Ga0070685_100574492 | 95 |
| 36 | 3300005548 | Ga0070665_100007119 | Ga0070665_1000071195 | 95 |
| 37 | 3300005718 | Ga0068866_10967316 | Ga0068866_109673162 | 95 |
| 38 | 3300005842 | Ga0068858_100774053 | Ga0068858_1007740532 | 95 |
| 39 | 3300009177 | Ga0105248_10471314 | Ga0105248_104713142 | 95 |
| 40 | 3300013306 | Ga0163162_10023779 | Ga0163162_100237793 | 95 |
| 41 | 3300013308 | Ga0157375_10034637 | Ga0157375_100346372 | 95 |
| 42 | 3300014745 | Ga0157377_10203105 | Ga0157377_102031052 | 95 |
| 43 | 3300025315 | Ga0207697_10032044 | Ga0207697_100320442 | 95 |
| 44 | 3300025899 | Ga0207642_10769531 | Ga0207642_107695312 | 95 |
| 45 | 3300025923 | Ga0207681_10546157 | Ga0207681_105461572 | 95 |
| 46 | 3300025926 | Ga0207659_10017910 | Ga0207659_100179105 | 95 |
| 47 | 3300025933 | Ga0207706_10013346 | Ga0207706_100133464 | 95 |
| 48 | 3300025936 | Ga0207670_11325090 | Ga0207670_113250901 | 95 |
| 49 | 3300025937 | Ga0207669_10054673 | Ga0207669_100546732 | 95 |
| 50 | 3300025938 | Ga0207704_11827183 | Ga0207704_118271831 | 95 |
| 51 | 3300025941 | Ga0207711_10617808 | Ga0207711_106178081 | 95 |
| 52 | 3300025960 | Ga0207651_10002537 | Ga0207651_100025374 | 95 |
| 53 | 3300025972 | Ga0207668_10132167 | Ga0207668_101321672 | 95 |
| 54 | 3300026023 | Ga0207677_10289851 | Ga0207677_102898512 | 95 |
| 55 | 3300026035 | Ga0207703_10453604 | Ga0207703_104536042 | 95 |
| 56 | 3300026089 | Ga0207648_10473577 | Ga0207648_104735772 | 95 |
| 57 | 3300026121 | Ga0207683_10111254 | Ga0207683_101112542 | 95 |
| 58 | 3300028379 | Ga0268266_10021484 | Ga0268266_100214842 | 95 |
| 59 | 3300025901 | Ga0207688_10586927 | Ga0207688_105869272 | 96 |
| 60 | 3300046528 | Ga0495642_0206987 | Ga0495642_0206987_243_581 | 96 |
| 61 | 3300001989 | JGI24739J22299_10069223 | JGI24739J22299_100692232 | 97 |
| 62 | 3300005355 | Ga0070671_100325247 | Ga0070671_1003252472 | 97 |
| 63 | 3300005543 | Ga0070672_100053151 | Ga0070672_1000531512 | 97 |
| 64 | 3300005548 | Ga0070665_100001803 | Ga0070665_1000018038 | 97 |
| 65 | 3300009177 | Ga0105248_10222758 | Ga0105248_102227583 | 97 |
| 66 | 3300013297 | Ga0157378_10203835 | Ga0157378_102038352 | 97 |
| 67 | 3300025931 | Ga0207644_10008821 | Ga0207644_100088216 | 97 |
| 68 | 3300025940 | Ga0207691_10110674 | Ga0207691_101106743 | 97 |
| 69 | 3300028379 | Ga0268266_10000135 | Ga0268266_1000013591 | 97 |
| 70 | 3300031852 | Ga0307410_10022258 | Ga0307410_100222582 | 97 |
| 71 | 3300031995 | Ga0307409_101090035 | Ga0307409_1010900352 | 97 |
| 72 | 3300032004 | Ga0307414_10055326 | Ga0307414_100553262 | 97 |
| 73 | 3300032005 | Ga0307411_10335570 | Ga0307411_103355702 | 97 |
| 74 | 3300049585 | Ga0501069_0394348 | Ga0501069_0394348_393_689 | 97 |
| 75 | 3300005327 | Ga0070658_10647320 | Ga0070658_106473202 | 98 |
| 76 | 3300005344 | Ga0070661_100593362 | Ga0070661_1005933621 | 98 |
| 77 | 3300005355 | Ga0070671_100011993 | Ga0070671_1000119932 | 98 |
| 78 | 3300005458 | Ga0070681_11720576 | Ga0070681_117205761 | 98 |
| 79 | 3300006237 | Ga0097621_100226512 | Ga0097621_1002265121 | 98 |
| 80 | 3300013296 | Ga0157374_10132729 | Ga0157374_101327292 | 98 |
| 81 | 3300025928 | Ga0207700_10225793 | Ga0207700_102257932 | 98 |
| 82 | 3300025931 | Ga0207644_10010334 | Ga0207644_100103342 | 98 |
| 83 | 3300026035 | Ga0207703_10686792 | Ga0207703_106867922 | 98 |
| 84 | 3300034816 | Ga0373930_0038094 | Ga0373930_0038094_293_589 | 98 |
| 85 | 3300035092 | Ga0373952_0173571 | Ga0373952_0173571_40_336 | 98 |
| 86 | 3300035121 | Ga0373960_0037345 | Ga0373960_0037345_345_641 | 98 |
| 87 | 3300035172 | Ga0373955_0201570 | Ga0373955_0201570_718_1014 | 98 |
| 88 | 3300035207 | Ga0373942_0107855 | Ga0373942_0107855_265_561 | 98 |
| 89 | 3300035691 | Ga0373931_0644315 | Ga0373931_0644315_265_561 | 98 |
| 90 | 3300039437 | Ga0436365_1373897 | Ga0436365_1373897_219_515 | 98 |
| 91 | 3300046616 | Ga0495668_0210632 | Ga0495668_0210632_362_658 | 98 |
| 92 | 3300046684 | Ga0495669_0051755 | Ga0495669_0051755_558_854 | 98 |
| 93 | 3300048903 | Ga0496100_0214369 | Ga0496100_0214369_236_532 | 98 |
| 94 | 3300048904 | Ga0496101_0411016 | Ga0496101_0411016_574_870 | 98 |
| 95 | 3300048909 | Ga0496106_0912379 | Ga0496106_0912379_86_382 | 98 |
| 96 | 3300048910 | Ga0496107_0189725 | Ga0496107_0189725_987_1283 | 98 |
| 97 | 3300048911 | Ga0496108_1627656 | Ga0496108_1627656_114_413 | 98 |
| 98 | 3300048915 | Ga0496112_0529018 | Ga0496112_0529018_387_683 | 98 |
| 99 | 3300048917 | Ga0496114_0199265 | Ga0496114_0199265_1083_1379 | 98 |
| 100 | 3300048918 | Ga0496115_0000524 | Ga0496115_0000524_20697_20993 | 98 |
| 101 | 3300001989 | JGI24739J22299_10231706 | JGI24739J22299_102317061 | 99 |
| 102 | 3300005327 | Ga0070658_10353556 | Ga0070658_103535562 | 99 |
| 103 | 3300005331 | Ga0070670_100006971 | Ga0070670_1000069712 | 99 |
| 104 | 3300005339 | Ga0070660_100219006 | Ga0070660_1002190062 | 99 |
| 105 | 3300005344 | Ga0070661_100308309 | Ga0070661_1003083092 | 99 |
| 106 | 3300005353 | Ga0070669_101858625 | Ga0070669_1018586252 | 99 |
| 107 | 3300005355 | Ga0070671_100004423 | Ga0070671_1000044235 | 99 |
| 108 | 3300005356 | Ga0070674_100008578 | Ga0070674_1000085784 | 99 |
| 109 | 3300005356 | Ga0070674_100072517 | Ga0070674_1000725173 | 99 |
| 110 | 3300005356 | Ga0070674_100644555 | Ga0070674_1006445552 | 99 |
| 111 | 3300005356 | Ga0070674_101789408 | Ga0070674_1017894081 | 99 |
| 112 | 3300005364 | Ga0070673_100242477 | Ga0070673_1002424772 | 99 |
| 113 | 3300005366 | Ga0070659_101651667 | Ga0070659_1016516671 | 99 |
| 114 | 3300005366 | Ga0070659_102036443 | Ga0070659_1020364431 | 99 |
| 115 | 3300005367 | Ga0070667_100996340 | Ga0070667_1009963401 | 99 |
| 116 | 3300005434 | Ga0070709_11323065 | Ga0070709_113230651 | 99 |
| 117 | 3300005435 | Ga0070714_100242662 | Ga0070714_1002426622 | 99 |
| 118 | 3300005436 | Ga0070713_100005305 | Ga0070713_1000053052 | 99 |
| 119 | 3300005455 | Ga0070663_100569729 | Ga0070663_1005697292 | 99 |
| 120 | 3300005455 | Ga0070663_100627184 | Ga0070663_1006271841 | 99 |
| 121 | 3300005456 | Ga0070678_100000602 | Ga0070678_10000060212 | 99 |
| 122 | 3300005456 | Ga0070678_100667663 | Ga0070678_1006676632 | 99 |
| 123 | 3300005457 | Ga0070662_100018380 | Ga0070662_1000183804 | 99 |
| 124 | 3300005457 | Ga0070662_100140838 | Ga0070662_1001408382 | 99 |
| 125 | 3300005539 | Ga0068853_101047968 | Ga0068853_1010479681 | 99 |
| 126 | 3300005543 | Ga0070672_100044717 | Ga0070672_1000447172 | 99 |
| 127 | 3300005543 | Ga0070672_100570590 | Ga0070672_1005705902 | 99 |
| 128 | 3300005548 | Ga0070665_100006577 | Ga0070665_1000065775 | 99 |
| 129 | 3300005548 | Ga0070665_101199440 | Ga0070665_1011994401 | 99 |
| 130 | 3300005564 | Ga0070664_100001684 | Ga0070664_1000016844 | 99 |
| 131 | 3300005577 | Ga0068857_100511610 | Ga0068857_1005116102 | 99 |
| 132 | 3300005616 | Ga0068852_100378126 | Ga0068852_1003781262 | 99 |
| 133 | 3300005618 | Ga0068864_101214357 | Ga0068864_1012143572 | 99 |
| 134 | 3300005843 | Ga0068860_101758853 | Ga0068860_1017588531 | 99 |
| 135 | 3300006173 | Ga0070716_100015834 | Ga0070716_1000158344 | 99 |
| 136 | 3300006175 | Ga0070712_100080287 | Ga0070712_1000802872 | 99 |
| 137 | 3300006237 | Ga0097621_100766079 | Ga0097621_1007660791 | 99 |
| 138 | 3300009177 | Ga0105248_10984870 | Ga0105248_109848701 | 99 |
| 139 | 3300012512 | Ga0157327_1015862 | Ga0157327_10158621 | 99 |
| 140 | 3300013306 | Ga0163162_10245240 | Ga0163162_102452402 | 99 |
| 141 | 3300013307 | Ga0157372_11206751 | Ga0157372_112067512 | 99 |
| 142 | 3300014326 | Ga0157380_10901205 | Ga0157380_109012051 | 99 |
| 143 | 3300014968 | Ga0157379_11738170 | Ga0157379_117381701 | 99 |
| 144 | 3300017792 | Ga0163161_10465660 | Ga0163161_104656601 | 99 |
| 145 | 3300025893 | Ga0207682_10453950 | Ga0207682_104539502 | 99 |
| 146 | 3300025903 | Ga0207680_10117593 | Ga0207680_101175932 | 99 |
| 147 | 3300025906 | Ga0207699_10014882 | Ga0207699_100148822 | 99 |
| 148 | 3300025907 | Ga0207645_10287023 | Ga0207645_102870232 | 99 |
| 149 | 3300025909 | Ga0207705_10536356 | Ga0207705_105363562 | 99 |
| 150 | 3300025915 | Ga0207693_10113023 | Ga0207693_101130232 | 99 |
| 151 | 3300025919 | Ga0207657_10766734 | Ga0207657_107667342 | 99 |
| 152 | 3300025919 | Ga0207657_11235779 | Ga0207657_112357791 | 99 |
| 153 | 3300025920 | Ga0207649_10085199 | Ga0207649_100851992 | 99 |
| 154 | 3300025925 | Ga0207650_10008461 | Ga0207650_100084612 | 99 |
| 155 | 3300025926 | Ga0207659_10288695 | Ga0207659_102886952 | 99 |
| 156 | 3300025929 | Ga0207664_10014541 | Ga0207664_100145411 | 99 |
| 157 | 3300025931 | Ga0207644_10003385 | Ga0207644_100033855 | 99 |
| 158 | 3300025931 | Ga0207644_10870984 | Ga0207644_108709842 | 99 |
| 159 | 3300025932 | Ga0207690_11159762 | Ga0207690_111597622 | 99 |
| 160 | 3300025933 | Ga0207706_10054519 | Ga0207706_100545192 | 99 |
| 161 | 3300025933 | Ga0207706_10151755 | Ga0207706_101517552 | 99 |
| 162 | 3300025933 | Ga0207706_10168301 | Ga0207706_101683012 | 99 |
| 163 | 3300025937 | Ga0207669_10068710 | Ga0207669_100687102 | 99 |
| 164 | 3300025937 | Ga0207669_10700272 | Ga0207669_107002721 | 99 |
| 165 | 3300025937 | Ga0207669_11039744 | Ga0207669_110397441 | 99 |
| 166 | 3300025939 | Ga0207665_10067243 | Ga0207665_100672433 | 99 |
| 167 | 3300025940 | Ga0207691_10036651 | Ga0207691_100366512 | 99 |
| 168 | 3300025940 | Ga0207691_10037007 | Ga0207691_100370074 | 99 |
| 169 | 3300025941 | Ga0207711_10481600 | Ga0207711_104816001 | 99 |
| 170 | 3300025945 | Ga0207679_10288787 | Ga0207679_102887872 | 99 |
| 171 | 3300025960 | Ga0207651_10179734 | Ga0207651_101797342 | 99 |
| 172 | 3300025981 | Ga0207640_10234371 | Ga0207640_102343712 | 99 |
| 173 | 3300026041 | Ga0207639_10828272 | Ga0207639_108282722 | 99 |
| 174 | 3300026067 | Ga0207678_10555444 | Ga0207678_105554441 | 99 |
| 175 | 3300026067 | Ga0207678_10894298 | Ga0207678_108942981 | 99 |
| 176 | 3300026095 | Ga0207676_11055490 | Ga0207676_110554902 | 99 |
| 177 | 3300026116 | Ga0207674_11559980 | Ga0207674_115599802 | 99 |
| 178 | 3300026121 | Ga0207683_10004242 | Ga0207683_100042422 | 99 |
| 179 | 3300026121 | Ga0207683_10070658 | Ga0207683_100706582 | 99 |
| 180 | 3300026142 | Ga0207698_10319626 | Ga0207698_103196262 | 99 |
| 181 | 3300026142 | Ga0207698_11504024 | Ga0207698_115040242 | 99 |
| 182 | 3300028379 | Ga0268266_10071905 | Ga0268266_100719052 | 99 |
| 183 | 3300028379 | Ga0268266_11631157 | Ga0268266_116311571 | 99 |
| 184 | 3300028381 | Ga0268264_11189478 | Ga0268264_111894782 | 99 |
| 185 | 3300035170 | Ga0373943_0984343 | Ga0373943_0984343_17_361 | 99 |
| 186 | 3300036401 | Ga0373937_0518293 | Ga0373937_0518293_334_678 | 99 |
| 187 | 3300037418 | Ga0395900_0459460 | Ga0395900_0459460_597_896 | 99 |
| 188 | 3300037418 | Ga0395900_1287039 | Ga0395900_1287039_37_336 | 99 |
| 189 | 3300037466 | Ga0395898_0302261 | Ga0395898_0302261_879_1178 | 99 |
| 190 | 3300037471 | Ga0395905_0000980 | Ga0395905_0000980_18756_19055 | 99 |
| 191 | 3300037471 | Ga0395905_0010322 | Ga0395905_0010322_8644_8943 | 99 |
| 192 | 3300038443 | Ga0395901_0601514 | Ga0395901_0601514_637_936 | 99 |
| 193 | 3300044658 | Ga0466972_0578659 | Ga0466972_0578659_88_387 | 99 |
| 194 | 3300044683 | Ga0466965_0428610 | Ga0466965_0428610_97_396 | 99 |
| 195 | 3300044901 | Ga0466960_0024584 | Ga0466960_0024584_383_682 | 99 |
| 196 | 3300046492 | Ga0495585_0553835 | Ga0495585_0553835_142_486 | 99 |
| 197 | 3300046507 | Ga0495606_0547735 | Ga0495606_0547735_89_391 | 99 |
| 198 | 3300046512 | Ga0495610_0237637 | Ga0495610_0237637_411_713 | 99 |
| 199 | 3300046513 | Ga0495616_0358354 | Ga0495616_0358354_261_563 | 99 |
| 200 | 3300046525 | Ga0495663_0072052 | Ga0495663_0072052_221_565 | 99 |
| 201 | 3300046525 | Ga0495663_0134030 | Ga0495663_0134030_356_658 | 99 |
| 202 | 3300046528 | Ga0495642_0047455 | Ga0495642_0047455_45_389 | 99 |
| 203 | 3300046539 | Ga0495621_0000115 | Ga0495621_0000115_4140_4484 | 99 |
| 204 | 3300046558 | Ga0495633_0014696 | Ga0495633_0014696_2943_3287 | 99 |
| 205 | 3300046616 | Ga0495668_0010268 | Ga0495668_0010268_666_968 | 99 |
| 206 | 3300046660 | Ga0495625_0355765 | Ga0495625_0355765_422_724 | 99 |
| 207 | 3300046664 | Ga0495659_0181350 | Ga0495659_0181350_45_389 | 99 |
| 208 | 3300046684 | Ga0495669_0000296 | Ga0495669_0000296_19171_19473 | 99 |
| 209 | 3300046684 | Ga0495669_0004307 | Ga0495669_0004307_285_629 | 99 |
| 210 | 3300046684 | Ga0495669_0008286 | Ga0495669_0008286_1995_2297 | 99 |
| 211 | 3300046684 | Ga0495669_0061779 | Ga0495669_0061779_199_501 | 99 |
| 212 | 3300046684 | Ga0495669_0306755 | Ga0495669_0306755_261_563 | 99 |
| 213 | 3300046691 | Ga0495670_0000250 | Ga0495670_0000250_16824_17168 | 99 |
| 214 | 3300046810 | Ga0495660_0331592 | Ga0495660_0331592_313_615 | 99 |
| 215 | 3300047445 | Ga0495677_0023608 | Ga0495677_0023608_1215_1517 | 99 |
| 216 | 3300047445 | Ga0495677_0080975 | Ga0495677_0080975_550_852 | 99 |
| 217 | 3300047447 | Ga0495685_048812 | Ga0495685_048812_585_887 | 99 |
| 218 | 3300047447 | Ga0495685_223976 | Ga0495685_223976_41_343 | 99 |
| 219 | 3300047470 | Ga0495681_0275901 | Ga0495681_0275901_321_623 | 99 |
| 220 | 3300048904 | Ga0496101_0790514 | Ga0496101_0790514_339_638 | 99 |
| 221 | 3300048909 | Ga0496106_0885568 | Ga0496106_0885568_147_482 | 99 |
| 222 | 3300048911 | Ga0496108_1169173 | Ga0496108_1169173_120_419 | 99 |
| 223 | 3300048915 | Ga0496112_0579957 | Ga0496112_0579957_634_933 | 99 |
| 224 | 3300005338 | Ga0068868_100529423 | Ga0068868_1005294232 | 100 |
| 225 | 3300005355 | Ga0070671_100250483 | Ga0070671_1002504832 | 100 |
| 226 | 3300005458 | Ga0070681_11017424 | Ga0070681_110174242 | 100 |
| 227 | 3300013100 | Ga0157373_10613265 | Ga0157373_106132651 | 100 |
| 228 | 3300013102 | Ga0157371_10077636 | Ga0157371_100776361 | 100 |
| 229 | 3300025907 | Ga0207645_10085947 | Ga0207645_100859472 | 100 |
| 230 | 3300025912 | Ga0207707_10329609 | Ga0207707_103296092 | 100 |
| 231 | 3300025918 | Ga0207662_10254612 | Ga0207662_102546122 | 100 |
| 232 | 3300025919 | Ga0207657_10012888 | Ga0207657_100128885 | 100 |
| 233 | 3300025933 | Ga0207706_10063865 | Ga0207706_100638653 | 100 |
| 234 | 3300025935 | Ga0207709_10078991 | Ga0207709_100789912 | 100 |
| 235 | 3300005458 | Ga0070681_11849206 | Ga0070681_118492062 | 103 |
| 236 | 3300031903 | Ga0307407_11193320 | Ga0307407_111933202 | 104 |
| 237 | 3300035171 | Ga0373946_0701247 | Ga0373946_0701247_83_403 | 104 |
| 238 | 3300035692 | Ga0373935_0015642 | Ga0373935_0015642_3471_3791 | 104 |
| 239 | 3300005344 | Ga0070661_101187281 | Ga0070661_1011872811 | 105 |
| 240 | 3300005356 | Ga0070674_100588871 | Ga0070674_1005888712 | 105 |
| 241 | 3300005455 | Ga0070663_101553377 | Ga0070663_1015533771 | 105 |
| 242 | 3300005539 | Ga0068853_102472204 | Ga0068853_1024722041 | 105 |
| 243 | 3300014326 | Ga0157380_10003020 | Ga0157380_100030204 | 105 |
| 244 | 3300025920 | Ga0207649_10591926 | Ga0207649_105919262 | 105 |
| 245 | 3300026067 | Ga0207678_11314729 | Ga0207678_113147291 | 105 |
| 246 | 3300031824 | Ga0307413_10314168 | Ga0307413_103141682 | 105 |
| 247 | 3300031901 | Ga0307406_10322179 | Ga0307406_103221793 | 105 |
| 248 | 3300031911 | Ga0307412_10163270 | Ga0307412_101632702 | 105 |
| 249 | 3300032005 | Ga0307411_10329234 | Ga0307411_103292342 | 105 |
| 250 | 3300032126 | Ga0307415_100828919 | Ga0307415_1008289191 | 105 |
| 251 | 3300044684 | Ga0466966_0050949 | Ga0466966_0050949_2115_2489 | 105 |
| 252 | 3300044694 | Ga0466963_0855416 | Ga0466963_0855416_41_373 | 105 |
| 253 | 3300044765 | Ga0466970_0110391 | Ga0466970_0110391_1054_1428 | 105 |
| 254 | 3300044901 | Ga0466960_0706046 | Ga0466960_0706046_104_478 | 105 |
| 255 | 3300045049 | Ga0466959_0566681 | Ga0466959_0566681_12_386 | 105 |
| 256 | 3300005328 | Ga0070676_11403008 | Ga0070676_114030081 | 106 |
| 257 | 3300005331 | Ga0070670_100317338 | Ga0070670_1003173382 | 106 |
| 258 | 3300005344 | Ga0070661_100507572 | Ga0070661_1005075722 | 106 |
| 259 | 3300005440 | Ga0070705_100279137 | Ga0070705_1002791372 | 106 |
| 260 | 3300005543 | Ga0070672_101747331 | Ga0070672_1017473311 | 106 |
| 261 | 3300009094 | Ga0111539_11393386 | Ga0111539_113933862 | 106 |
| 262 | 3300025923 | Ga0207681_10473624 | Ga0207681_104736242 | 106 |
| 263 | 3300025933 | Ga0207706_10640331 | Ga0207706_106403312 | 106 |
| 264 | 3300025940 | Ga0207691_11271062 | Ga0207691_112710622 | 106 |
| 265 | 3300025945 | Ga0207679_10490492 | Ga0207679_104904922 | 106 |
| 266 | 3300031731 | Ga0307405_10746717 | Ga0307405_107467171 | 106 |
| 267 | 3300031995 | Ga0307409_100182855 | Ga0307409_1001828552 | 106 |
| 268 | 3300032004 | Ga0307414_10243639 | Ga0307414_102436393 | 106 |
| 269 | 3300042004 | Ga0439445_0010632 | Ga0439445_0010632_1374_1721 | 106 |
| 270 | 3300045976 | Ga0466967_1684389 | Ga0466967_1684389_273_608 | 106 |
| 271 | 3300002076 | JGI24749J21850_1010626 | JGI24749J21850_10106262 | 107 |
| 272 | 3300002459 | JGI24751J29686_10042277 | JGI24751J29686_100422772 | 107 |
| 273 | 3300005289 | Ga0065704_10454699 | Ga0065704_104546991 | 107 |
| 274 | 3300005290 | Ga0065712_10108055 | Ga0065712_101080553 | 107 |
| 275 | 3300005293 | Ga0065715_10089593 | Ga0065715_100895937 | 107 |
| 276 | 3300005328 | Ga0070676_10006525 | Ga0070676_100065254 | 107 |
| 277 | 3300005331 | Ga0070670_100003270 | Ga0070670_1000032703 | 107 |
| 278 | 3300005331 | Ga0070670_100061428 | Ga0070670_1000614282 | 107 |
| 279 | 3300005333 | Ga0070677_10000264 | Ga0070677_100002647 | 107 |
| 280 | 3300005335 | Ga0070666_10255873 | Ga0070666_102558731 | 107 |
| 281 | 3300005347 | Ga0070668_100015963 | Ga0070668_1000159633 | 107 |
| 282 | 3300005347 | Ga0070668_100043914 | Ga0070668_1000439142 | 107 |
| 283 | 3300005347 | Ga0070668_100107854 | Ga0070668_1001078542 | 107 |
| 284 | 3300005353 | Ga0070669_100002852 | Ga0070669_1000028523 | 107 |
| 285 | 3300005354 | Ga0070675_100002675 | Ga0070675_1000026752 | 107 |
| 286 | 3300005355 | Ga0070671_100005509 | Ga0070671_1000055098 | 107 |
| 287 | 3300005356 | Ga0070674_100012341 | Ga0070674_1000123413 | 107 |
| 288 | 3300005366 | Ga0070659_100150388 | Ga0070659_1001503882 | 107 |
| 289 | 3300005367 | Ga0070667_100032790 | Ga0070667_1000327902 | 107 |
| 290 | 3300005441 | Ga0070700_100035491 | Ga0070700_1000354912 | 107 |
| 291 | 3300005445 | Ga0070708_101204951 | Ga0070708_1012049512 | 107 |
| 292 | 3300005456 | Ga0070678_100013160 | Ga0070678_1000131604 | 107 |
| 293 | 3300005457 | Ga0070662_100001864 | Ga0070662_10000186411 | 107 |
| 294 | 3300005459 | Ga0068867_100017993 | Ga0068867_1000179934 | 107 |
| 295 | 3300005539 | Ga0068853_100478539 | Ga0068853_1004785391 | 107 |
| 296 | 3300005539 | Ga0068853_100670147 | Ga0068853_1006701472 | 107 |
| 297 | 3300005544 | Ga0070686_100084071 | Ga0070686_1000840713 | 107 |
| 298 | 3300005577 | Ga0068857_102053567 | Ga0068857_1020535671 | 107 |
| 299 | 3300005618 | Ga0068864_100106295 | Ga0068864_1001062952 | 107 |
| 300 | 3300005840 | Ga0068870_10121895 | Ga0068870_101218952 | 107 |
| 301 | 3300005843 | Ga0068860_100372856 | Ga0068860_1003728562 | 107 |
| 302 | 3300006881 | Ga0068865_100724093 | Ga0068865_1007240931 | 107 |
| 303 | 3300009094 | Ga0111539_10271562 | Ga0111539_102715623 | 107 |
| 304 | 3300009147 | Ga0114129_13227386 | Ga0114129_132273861 | 107 |
| 305 | 3300009148 | Ga0105243_10184064 | Ga0105243_101840641 | 107 |
| 306 | 3300009177 | Ga0105248_11612731 | Ga0105248_116127312 | 107 |
| 307 | 3300009553 | Ga0105249_10013720 | Ga0105249_100137202 | 107 |
| 308 | 3300013306 | Ga0163162_10363427 | Ga0163162_103634272 | 107 |
| 309 | 3300013308 | Ga0157375_10372678 | Ga0157375_103726782 | 107 |
| 310 | 3300013308 | Ga0157375_11840263 | Ga0157375_118402631 | 107 |
| 311 | 3300014325 | Ga0163163_10169084 | Ga0163163_101690842 | 107 |
| 312 | 3300014325 | Ga0163163_10647233 | Ga0163163_106472332 | 107 |
| 313 | 3300014745 | Ga0157377_10051990 | Ga0157377_100519902 | 107 |
| 314 | 3300017792 | Ga0163161_10061724 | Ga0163161_100617242 | 107 |
| 315 | 3300025271 | Ga0207666_1007291 | Ga0207666_10072913 | 107 |
| 316 | 3300025903 | Ga0207680_10235933 | Ga0207680_102359332 | 107 |
| 317 | 3300025908 | Ga0207643_10168649 | Ga0207643_101686492 | 107 |
| 318 | 3300025923 | Ga0207681_10069297 | Ga0207681_100692972 | 107 |
| 319 | 3300025925 | Ga0207650_10002198 | Ga0207650_1000219810 | 107 |
| 320 | 3300025941 | Ga0207711_10605931 | Ga0207711_106059311 | 107 |
| 321 | 3300025961 | Ga0207712_10049509 | Ga0207712_100495092 | 107 |
| 322 | 3300025972 | Ga0207668_10296603 | Ga0207668_102966032 | 107 |
| 323 | 3300025972 | Ga0207668_10485749 | Ga0207668_104857492 | 107 |
| 324 | 3300026095 | Ga0207676_10139109 | Ga0207676_101391092 | 107 |
| 325 | 3300027876 | Ga0209974_10219430 | Ga0209974_102194301 | 107 |
| 326 | 3300028380 | Ga0268265_10035410 | Ga0268265_100354102 | 107 |
| 327 | 3300031548 | Ga0307408_101580369 | Ga0307408_1015803691 | 107 |
| 328 | 3300031731 | Ga0307405_10165004 | Ga0307405_101650042 | 107 |
| 329 | 3300031824 | Ga0307413_10006937 | Ga0307413_100069374 | 107 |
| 330 | 3300031824 | Ga0307413_10446501 | Ga0307413_104465012 | 107 |
| 331 | 3300031852 | Ga0307410_10002666 | Ga0307410_100026666 | 107 |
| 332 | 3300031852 | Ga0307410_10377937 | Ga0307410_103779372 | 107 |
| 333 | 3300031901 | Ga0307406_10190009 | Ga0307406_101900092 | 107 |
| 334 | 3300031901 | Ga0307406_10839010 | Ga0307406_108390101 | 107 |
| 335 | 3300031903 | Ga0307407_10015490 | Ga0307407_100154902 | 107 |
| 336 | 3300031911 | Ga0307412_10178992 | Ga0307412_101789922 | 107 |
| 337 | 3300031995 | Ga0307409_100015545 | Ga0307409_1000155454 | 107 |
| 338 | 3300031995 | Ga0307409_100046540 | Ga0307409_1000465402 | 107 |
| 339 | 3300032002 | Ga0307416_100060446 | Ga0307416_1000604463 | 107 |
| 340 | 3300032002 | Ga0307416_102197828 | Ga0307416_1021978281 | 107 |
| 341 | 3300032004 | Ga0307414_10018828 | Ga0307414_100188284 | 107 |
| 342 | 3300032004 | Ga0307414_10075339 | Ga0307414_100753392 | 107 |
| 343 | 3300032005 | Ga0307411_10003373 | Ga0307411_100033734 | 107 |
| 344 | 3300032005 | Ga0307411_10410073 | Ga0307411_104100732 | 107 |
| 345 | 3300032126 | Ga0307415_100279487 | Ga0307415_1002794872 | 107 |
| 346 | 3300032126 | Ga0307415_101178782 | Ga0307415_1011787822 | 107 |
| 347 | 3300042122 | Ga0450920_080495 | Ga0450920_080495_221_592 | 107 |
| 348 | 3300044684 | Ga0466966_0192057 | Ga0466966_0192057_20_397 | 107 |
| 349 | 3300044693 | Ga0466961_0297146 | Ga0466961_0297146_459_836 | 107 |
| 350 | 3300045049 | Ga0466959_0161778 | Ga0466959_0161778_212_589 | 107 |
| 351 | 3300046525 | Ga0495663_0059207 | Ga0495663_0059207_63_437 | 107 |
| 352 | 3300046537 | Ga0495598_0054313 | Ga0495598_0054313_116_490 | 107 |
| 353 | 3300046537 | Ga0495598_0083931 | Ga0495598_0083931_12_386 | 107 |
| 354 | 3300046539 | Ga0495621_0005159 | Ga0495621_0005159_1905_2279 | 107 |
| 355 | 3300046558 | Ga0495633_0357828 | Ga0495633_0357828_240_614 | 107 |
| 356 | 3300046664 | Ga0495659_0096416 | Ga0495659_0096416_485_919 | 107 |
| 357 | 3300046691 | Ga0495670_0033031 | Ga0495670_0033031_670_1044 | 107 |
| 358 | 3300047445 | Ga0495677_0032573 | Ga0495677_0032573_1132_1506 | 107 |
| 359 | 3300047447 | Ga0495685_122198 | Ga0495685_122198_469_843 | 107 |
| 360 | 3300050511 | nmdc:mga08y16_302721_c1 | nmdc:mga08y16_302721_c1_1263_1637 | 107 |
| 361 | 3300005337 | Ga0070682_100397808 | Ga0070682_1003978081 | 108 |
| 362 | 3300005617 | Ga0068859_102793319 | Ga0068859_1027933191 | 108 |
| 363 | 3300006931 | Ga0097620_102794693 | Ga0097620_1027946931 | 108 |
| 364 | 3300025960 | Ga0207651_10238760 | Ga0207651_102387602 | 108 |
| 365 | 3300026035 | Ga0207703_10636159 | Ga0207703_106361592 | 108 |
| 366 | 3300037471 | Ga0395905_1380796 | Ga0395905_1380796_222_575 | 108 |
| 367 | 3300037471 | Ga0395905_1488181 | Ga0395905_1488181_91_435 | 108 |
| 368 | 3300046525 | Ga0495663_0017360 | Ga0495663_0017360_492_824 | 108 |
| 369 | 3300046684 | Ga0495669_0048417 | Ga0495669_0048417_1277_1609 | 108 |
| 370 | 3300047445 | Ga0495677_0004644 | Ga0495677_0004644_1919_2251 | 108 |
| 371 | 3300048912 | Ga0496109_0548705 | Ga0496109_0548705_250_585 | 108 |
| 372 | 3300005331 | Ga0070670_101738976 | Ga0070670_1017389761 | 109 |
| 373 | 3300005344 | Ga0070661_100358963 | Ga0070661_1003589632 | 109 |
| 374 | 3300005355 | Ga0070671_100117733 | Ga0070671_1001177332 | 109 |
| 375 | 3300005457 | Ga0070662_100369213 | Ga0070662_1003692132 | 109 |
| 376 | 3300005564 | Ga0070664_100008505 | Ga0070664_1000085051 | 109 |
| 377 | 3300005564 | Ga0070664_100147992 | Ga0070664_1001479922 | 109 |
| 378 | 3300009093 | Ga0105240_10138338 | Ga0105240_101383382 | 109 |
| 379 | 3300009174 | Ga0105241_10364886 | Ga0105241_103648862 | 109 |
| 380 | 3300009177 | Ga0105248_10775096 | Ga0105248_107750961 | 109 |
| 381 | 3300009545 | Ga0105237_10070432 | Ga0105237_100704322 | 109 |
| 382 | 3300013100 | Ga0157373_10076392 | Ga0157373_100763922 | 109 |
| 383 | 3300013102 | Ga0157371_10136912 | Ga0157371_101369122 | 109 |
| 384 | 3300013104 | Ga0157370_10116555 | Ga0157370_101165552 | 109 |
| 385 | 3300013105 | Ga0157369_10146616 | Ga0157369_101466162 | 109 |
| 386 | 3300013307 | Ga0157372_10036663 | Ga0157372_100366633 | 109 |
| 387 | 3300025903 | Ga0207680_10332274 | Ga0207680_103322742 | 109 |
| 388 | 3300025920 | Ga0207649_10059495 | Ga0207649_100594952 | 109 |
| 389 | 3300025925 | Ga0207650_10158796 | Ga0207650_101587962 | 109 |
| 390 | 3300025931 | Ga0207644_10035899 | Ga0207644_100358993 | 109 |
| 391 | 3300025933 | Ga0207706_10159766 | Ga0207706_101597662 | 109 |
| 392 | 3300025945 | Ga0207679_10003633 | Ga0207679_100036333 | 109 |
| 393 | 3300026067 | Ga0207678_11172677 | Ga0207678_111726772 | 109 |
| 394 | 3300037312 | Ga0395899_0224751 | Ga0395899_0224751_848_1204 | 109 |
| 395 | 3300037466 | Ga0395898_0013995 | Ga0395898_0013995_4506_4841 | 109 |
| 396 | 3300037471 | Ga0395905_0034438 | Ga0395905_0034438_2358_2693 | 109 |
| 397 | 3300038443 | Ga0395901_1794036 | Ga0395901_1794036_124_483 | 109 |
| 398 | 3300046525 | Ga0495663_0270677 | Ga0495663_0270677_31_399 | 109 |
| 399 | 3300046684 | Ga0495669_0043683 | Ga0495669_0043683_939_1307 | 109 |
| 400 | 3300048910 | Ga0496107_0437216 | Ga0496107_0437216_588_926 | 109 |
| 401 | 3300048912 | Ga0496109_2060170 | Ga0496109_2060170_19_387 | 109 |
| 402 | 3300002067 | JGI24735J21928_10001196 | JGI24735J21928_100011966 | 110 |
| 403 | 3300005327 | Ga0070658_10026219 | Ga0070658_100262194 | 110 |
| 404 | 3300005327 | Ga0070658_11485526 | Ga0070658_114855261 | 110 |
| 405 | 3300005333 | Ga0070677_10589312 | Ga0070677_105893121 | 110 |
| 406 | 3300005355 | Ga0070671_100239968 | Ga0070671_1002399682 | 110 |
| 407 | 3300005456 | Ga0070678_100025487 | Ga0070678_1000254872 | 110 |
| 408 | 3300005457 | Ga0070662_100166087 | Ga0070662_1001660872 | 110 |
| 409 | 3300005459 | Ga0068867_100424471 | Ga0068867_1004244712 | 110 |
| 410 | 3300005543 | Ga0070672_100276411 | Ga0070672_1002764112 | 110 |
| 411 | 3300006237 | Ga0097621_102390137 | Ga0097621_1023901371 | 110 |
| 412 | 3300006358 | Ga0068871_100851097 | Ga0068871_1008510973 | 110 |
| 413 | 3300006881 | Ga0068865_100202401 | Ga0068865_1002024012 | 110 |
| 414 | 3300009177 | Ga0105248_10482141 | Ga0105248_104821412 | 110 |
| 415 | 3300013306 | Ga0163162_10271101 | Ga0163162_102711012 | 110 |
| 416 | 3300017792 | Ga0163161_10076067 | Ga0163161_100760672 | 110 |
| 417 | 3300025925 | Ga0207650_11122695 | Ga0207650_111226952 | 110 |
| 418 | 3300025931 | Ga0207644_10886707 | Ga0207644_108867072 | 110 |
| 419 | 3300025933 | Ga0207706_10012753 | Ga0207706_100127532 | 110 |
| 420 | 3300025938 | Ga0207704_10182730 | Ga0207704_101827302 | 110 |
| 421 | 3300025940 | Ga0207691_10014156 | Ga0207691_100141565 | 110 |
| 422 | 3300025941 | Ga0207711_10313226 | Ga0207711_103132262 | 110 |
| 423 | 3300026078 | Ga0207702_10527602 | Ga0207702_105276022 | 110 |
| 424 | 3300026089 | Ga0207648_10196011 | Ga0207648_101960112 | 110 |
| 425 | 3300026121 | Ga0207683_10254736 | Ga0207683_102547362 | 110 |
| 426 | 3300037312 | Ga0395899_0001275 | Ga0395899_0001275_7252_7593 | 110 |
| 427 | 3300037418 | Ga0395900_0008634 | Ga0395900_0008634_2063_2404 | 110 |
| 428 | 3300037466 | Ga0395898_0005406 | Ga0395898_0005406_8474_8815 | 110 |
| 429 | 3300037471 | Ga0395905_0006701 | Ga0395905_0006701_7252_7593 | 110 |
| 430 | 3300037471 | Ga0395905_0033814 | Ga0395905_0033814_3622_3969 | 110 |
| 431 | 3300038443 | Ga0395901_0003914 | Ga0395901_0003914_13613_13954 | 110 |
| 432 | 3300045976 | Ga0466967_0686648 | Ga0466967_0686648_136_477 | 110 |
| 433 | 3300046539 | Ga0495621_0027519 | Ga0495621_0027519_929_1267 | 110 |
| 434 | 3300048910 | Ga0496107_0046938 | Ga0496107_0046938_1812_2156 | 110 |
| 435 | 3300001978 | JGI24747J21853_1032562 | JGI24747J21853_10325622 | 111 |
| 436 | 3300001989 | JGI24739J22299_10002371 | JGI24739J22299_100023715 | 111 |
| 437 | 3300002073 | JGI24745J21846_1002102 | JGI24745J21846_10021022 | 111 |
| 438 | 3300002077 | JGI24744J21845_10000224 | JGI24744J21845_100002246 | 111 |
| 439 | 3300002244 | JGI24742J22300_10012760 | JGI24742J22300_100127602 | 111 |
| 440 | 3300005293 | Ga0065715_10118184 | Ga0065715_101181842 | 111 |
| 441 | 3300005327 | Ga0070658_10031643 | Ga0070658_100316433 | 111 |
| 442 | 3300005328 | Ga0070676_10168198 | Ga0070676_101681982 | 111 |
| 443 | 3300005328 | Ga0070676_10434936 | Ga0070676_104349362 | 111 |
| 444 | 3300005328 | Ga0070676_10561812 | Ga0070676_105618121 | 111 |
| 445 | 3300005330 | Ga0070690_100016936 | Ga0070690_1000169363 | 111 |
| 446 | 3300005330 | Ga0070690_100359591 | Ga0070690_1003595912 | 111 |
| 447 | 3300005331 | Ga0070670_100023497 | Ga0070670_1000234974 | 111 |
| 448 | 3300005333 | Ga0070677_10017816 | Ga0070677_100178162 | 111 |
| 449 | 3300005334 | Ga0068869_100548911 | Ga0068869_1005489111 | 111 |
| 450 | 3300005336 | Ga0070680_101234448 | Ga0070680_1012344481 | 111 |
| 451 | 3300005338 | Ga0068868_100000431 | Ga0068868_10000043113 | 111 |
| 452 | 3300005338 | Ga0068868_100338254 | Ga0068868_1003382542 | 111 |
| 453 | 3300005338 | Ga0068868_101340166 | Ga0068868_1013401661 | 111 |
| 454 | 3300005339 | Ga0070660_100084828 | Ga0070660_1000848282 | 111 |
| 455 | 3300005339 | Ga0070660_100377669 | Ga0070660_1003776692 | 111 |
| 456 | 3300005339 | Ga0070660_100529821 | Ga0070660_1005298211 | 111 |
| 457 | 3300005339 | Ga0070660_101501802 | Ga0070660_1015018021 | 111 |
| 458 | 3300005343 | Ga0070687_100024887 | Ga0070687_1000248872 | 111 |
| 459 | 3300005343 | Ga0070687_100470867 | Ga0070687_1004708671 | 111 |
| 460 | 3300005344 | Ga0070661_100056629 | Ga0070661_1000566292 | 111 |
| 461 | 3300005347 | Ga0070668_100145679 | Ga0070668_1001456793 | 111 |
| 462 | 3300005354 | Ga0070675_100072589 | Ga0070675_1000725892 | 111 |
| 463 | 3300005355 | Ga0070671_100028759 | Ga0070671_1000287592 | 111 |
| 464 | 3300005356 | Ga0070674_100001611 | Ga0070674_1000016115 | 111 |
| 465 | 3300005356 | Ga0070674_100035517 | Ga0070674_1000355173 | 111 |
| 466 | 3300005364 | Ga0070673_100003914 | Ga0070673_1000039147 | 111 |
| 467 | 3300005364 | Ga0070673_100200043 | Ga0070673_1002000432 | 111 |
| 468 | 3300005364 | Ga0070673_100276377 | Ga0070673_1002763772 | 111 |
| 469 | 3300005366 | Ga0070659_100023328 | Ga0070659_1000233284 | 111 |
| 470 | 3300005366 | Ga0070659_100627322 | Ga0070659_1006273222 | 111 |
| 471 | 3300005367 | Ga0070667_100006261 | Ga0070667_1000062615 | 111 |
| 472 | 3300005367 | Ga0070667_100631965 | Ga0070667_1006319652 | 111 |
| 473 | 3300005455 | Ga0070663_100035118 | Ga0070663_1000351183 | 111 |
| 474 | 3300005455 | Ga0070663_100450483 | Ga0070663_1004504832 | 111 |
| 475 | 3300005456 | Ga0070678_100061022 | Ga0070678_1000610222 | 111 |
| 476 | 3300005457 | Ga0070662_100097110 | Ga0070662_1000971102 | 111 |
| 477 | 3300005457 | Ga0070662_100511333 | Ga0070662_1005113332 | 111 |
| 478 | 3300005458 | Ga0070681_10385194 | Ga0070681_103851942 | 111 |
| 479 | 3300005459 | Ga0068867_100121426 | Ga0068867_1001214262 | 111 |
| 480 | 3300005459 | Ga0068867_100217003 | Ga0068867_1002170032 | 111 |
| 481 | 3300005466 | Ga0070685_10190637 | Ga0070685_101906371 | 111 |
| 482 | 3300005530 | Ga0070679_100206905 | Ga0070679_1002069053 | 111 |
| 483 | 3300005539 | Ga0068853_100043354 | Ga0068853_1000433543 | 111 |
| 484 | 3300005543 | Ga0070672_100246880 | Ga0070672_1002468802 | 111 |
| 485 | 3300005543 | Ga0070672_100285088 | Ga0070672_1002850882 | 111 |
| 486 | 3300005544 | Ga0070686_100040593 | Ga0070686_1000405932 | 111 |
| 487 | 3300005548 | Ga0070665_100634851 | Ga0070665_1006348511 | 111 |
| 488 | 3300005563 | Ga0068855_100243640 | Ga0068855_1002436402 | 111 |
| 489 | 3300005564 | Ga0070664_100251248 | Ga0070664_1002512482 | 111 |
| 490 | 3300005564 | Ga0070664_100326213 | Ga0070664_1003262132 | 111 |
| 491 | 3300005578 | Ga0068854_100034418 | Ga0068854_1000344183 | 111 |
| 492 | 3300005578 | Ga0068854_100095867 | Ga0068854_1000958672 | 111 |
| 493 | 3300005615 | Ga0070702_100675225 | Ga0070702_1006752252 | 111 |
| 494 | 3300005616 | Ga0068852_100184408 | Ga0068852_1001844082 | 111 |
| 495 | 3300005616 | Ga0068852_100673195 | Ga0068852_1006731951 | 111 |
| 496 | 3300005617 | Ga0068859_101686042 | Ga0068859_1016860421 | 111 |
| 497 | 3300005618 | Ga0068864_100175966 | Ga0068864_1001759662 | 111 |
| 498 | 3300005718 | Ga0068866_10032299 | Ga0068866_100322993 | 111 |
| 499 | 3300005718 | Ga0068866_10047175 | Ga0068866_100471752 | 111 |
| 500 | 3300005719 | Ga0068861_100626123 | Ga0068861_1006261231 | 111 |
| 501 | 3300005840 | Ga0068870_10129364 | Ga0068870_101293643 | 111 |
| 502 | 3300005842 | Ga0068858_100001327 | Ga0068858_10000132713 | 111 |
| 503 | 3300006358 | Ga0068871_100057898 | Ga0068871_1000578983 | 111 |
| 504 | 3300006881 | Ga0068865_100107869 | Ga0068865_1001078692 | 111 |
| 505 | 3300006881 | Ga0068865_100528952 | Ga0068865_1005289521 | 111 |
| 506 | 3300006931 | Ga0097620_101686536 | Ga0097620_1016865361 | 111 |
| 507 | 3300009098 | Ga0105245_10563377 | Ga0105245_105633772 | 111 |
| 508 | 3300009148 | Ga0105243_10071021 | Ga0105243_100710212 | 111 |
| 509 | 3300009148 | Ga0105243_11021130 | Ga0105243_110211302 | 111 |
| 510 | 3300009174 | Ga0105241_10070560 | Ga0105241_100705602 | 111 |
| 511 | 3300009177 | Ga0105248_10002558 | Ga0105248_1000255813 | 111 |
| 512 | 3300011119 | Ga0105246_11708982 | Ga0105246_117089821 | 111 |
| 513 | 3300013100 | Ga0157373_10063624 | Ga0157373_100636243 | 111 |
| 514 | 3300013296 | Ga0157374_10166455 | Ga0157374_101664553 | 111 |
| 515 | 3300013296 | Ga0157374_10536931 | Ga0157374_105369312 | 111 |
| 516 | 3300013297 | Ga0157378_10070028 | Ga0157378_100700284 | 111 |
| 517 | 3300013297 | Ga0157378_10193915 | Ga0157378_101939151 | 111 |
| 518 | 3300013306 | Ga0163162_10404809 | Ga0163162_104048092 | 111 |
| 519 | 3300013308 | Ga0157375_10123967 | Ga0157375_101239673 | 111 |
| 520 | 3300013308 | Ga0157375_10155256 | Ga0157375_101552562 | 111 |
| 521 | 3300014326 | Ga0157380_11707726 | Ga0157380_117077262 | 111 |
| 522 | 3300014497 | Ga0182008_10062977 | Ga0182008_100629772 | 111 |
| 523 | 3300014745 | Ga0157377_10219518 | Ga0157377_102195182 | 111 |
| 524 | 3300014968 | Ga0157379_10036797 | Ga0157379_100367974 | 111 |
| 525 | 3300014969 | Ga0157376_10895141 | Ga0157376_108951412 | 111 |
| 526 | 3300025315 | Ga0207697_10009439 | Ga0207697_100094394 | 111 |
| 527 | 3300025893 | Ga0207682_10007627 | Ga0207682_100076272 | 111 |
| 528 | 3300025899 | Ga0207642_10261955 | Ga0207642_102619552 | 111 |
| 529 | 3300025899 | Ga0207642_10296139 | Ga0207642_102961391 | 111 |
| 530 | 3300025901 | Ga0207688_10006350 | Ga0207688_100063504 | 111 |
| 531 | 3300025903 | Ga0207680_10000735 | Ga0207680_100007355 | 111 |
| 532 | 3300025904 | Ga0207647_10001187 | Ga0207647_100011875 | 111 |
| 533 | 3300025907 | Ga0207645_10032082 | Ga0207645_100320822 | 111 |
| 534 | 3300025908 | Ga0207643_10213881 | Ga0207643_102138812 | 111 |
| 535 | 3300025909 | Ga0207705_10026507 | Ga0207705_100265073 | 111 |
| 536 | 3300025911 | Ga0207654_10082869 | Ga0207654_100828693 | 111 |
| 537 | 3300025918 | Ga0207662_10029162 | Ga0207662_100291623 | 111 |
| 538 | 3300025919 | Ga0207657_10040777 | Ga0207657_100407773 | 111 |
| 539 | 3300025919 | Ga0207657_10287436 | Ga0207657_102874362 | 111 |
| 540 | 3300025919 | Ga0207657_10666849 | Ga0207657_106668492 | 111 |
| 541 | 3300025920 | Ga0207649_10089338 | Ga0207649_100893382 | 111 |
| 542 | 3300025920 | Ga0207649_10330607 | Ga0207649_103306072 | 111 |
| 543 | 3300025921 | Ga0207652_11325638 | Ga0207652_113256382 | 111 |
| 544 | 3300025925 | Ga0207650_10116431 | Ga0207650_101164311 | 111 |
| 545 | 3300025925 | Ga0207650_10418263 | Ga0207650_104182632 | 111 |
| 546 | 3300025926 | Ga0207659_10270408 | Ga0207659_102704082 | 111 |
| 547 | 3300025931 | Ga0207644_10195282 | Ga0207644_101952821 | 111 |
| 548 | 3300025932 | Ga0207690_10395326 | Ga0207690_103953262 | 111 |
| 549 | 3300025933 | Ga0207706_10014810 | Ga0207706_100148105 | 111 |
| 550 | 3300025933 | Ga0207706_10173180 | Ga0207706_101731803 | 111 |
| 551 | 3300025937 | Ga0207669_10001445 | Ga0207669_100014455 | 111 |
| 552 | 3300025937 | Ga0207669_10002943 | Ga0207669_100029436 | 111 |
| 553 | 3300025938 | Ga0207704_10080568 | Ga0207704_100805681 | 111 |
| 554 | 3300025938 | Ga0207704_10431792 | Ga0207704_104317921 | 111 |
| 555 | 3300025940 | Ga0207691_10040923 | Ga0207691_100409234 | 111 |
| 556 | 3300025940 | Ga0207691_10232054 | Ga0207691_102320542 | 111 |
| 557 | 3300025941 | Ga0207711_10000477 | Ga0207711_1000047725 | 111 |
| 558 | 3300025942 | Ga0207689_10011903 | Ga0207689_100119035 | 111 |
| 559 | 3300025949 | Ga0207667_10275260 | Ga0207667_102752603 | 111 |
| 560 | 3300025960 | Ga0207651_10005197 | Ga0207651_100051972 | 111 |
| 561 | 3300025960 | Ga0207651_10198597 | Ga0207651_101985972 | 111 |
| 562 | 3300025960 | Ga0207651_10542575 | Ga0207651_105425752 | 111 |
| 563 | 3300025972 | Ga0207668_10351146 | Ga0207668_103511461 | 111 |
| 564 | 3300025981 | Ga0207640_10171286 | Ga0207640_101712861 | 111 |
| 565 | 3300025981 | Ga0207640_10372380 | Ga0207640_103723801 | 111 |
| 566 | 3300025986 | Ga0207658_10002851 | Ga0207658_100028515 | 111 |
| 567 | 3300025986 | Ga0207658_10577310 | Ga0207658_105773102 | 111 |
| 568 | 3300026023 | Ga0207677_10000754 | Ga0207677_100007544 | 111 |
| 569 | 3300026023 | Ga0207677_10034342 | Ga0207677_100343422 | 111 |
| 570 | 3300026035 | Ga0207703_10001631 | Ga0207703_1000163110 | 111 |
| 571 | 3300026041 | Ga0207639_10135661 | Ga0207639_101356613 | 111 |
| 572 | 3300026067 | Ga0207678_10057412 | Ga0207678_100574123 | 111 |
| 573 | 3300026067 | Ga0207678_10455621 | Ga0207678_104556212 | 111 |
| 574 | 3300026088 | Ga0207641_11035884 | Ga0207641_110358842 | 111 |
| 575 | 3300026089 | Ga0207648_10001859 | Ga0207648_1000185910 | 111 |
| 576 | 3300026089 | Ga0207648_10135408 | Ga0207648_101354082 | 111 |
| 577 | 3300026116 | Ga0207674_10266708 | Ga0207674_102667082 | 111 |
| 578 | 3300026118 | Ga0207675_100092389 | Ga0207675_1000923893 | 111 |
| 579 | 3300026121 | Ga0207683_10019589 | Ga0207683_100195894 | 111 |
| 580 | 3300026142 | Ga0207698_10152912 | Ga0207698_101529122 | 111 |
| 581 | 3300026142 | Ga0207698_10924706 | Ga0207698_109247062 | 111 |
| 582 | 3300028379 | Ga0268266_10523554 | Ga0268266_105235541 | 111 |
| 583 | 3300035113 | Ga0373936_0127178 | Ga0373936_0127178_175_516 | 111 |
| 584 | 3300035121 | Ga0373960_0324493 | Ga0373960_0324493_129_464 | 111 |
| 585 | 3300037312 | Ga0395899_0000326 | Ga0395899_0000326_47248_47628 | 111 |
| 586 | 3300037312 | Ga0395899_0073981 | Ga0395899_0073981_1956_2291 | 111 |
| 587 | 3300037312 | Ga0395899_0132990 | Ga0395899_0132990_344_679 | 111 |
| 588 | 3300037418 | Ga0395900_0000466 | Ga0395900_0000466_18542_18922 | 111 |
| 589 | 3300037418 | Ga0395900_0002846 | Ga0395900_0002846_14797_15147 | 111 |
| 590 | 3300037418 | Ga0395900_0033455 | Ga0395900_0033455_3866_4201 | 111 |
| 591 | 3300037418 | Ga0395900_0217866 | Ga0395900_0217866_757_1092 | 111 |
| 592 | 3300037466 | Ga0395898_0000721 | Ga0395898_0000721_18542_18922 | 111 |
| 593 | 3300037466 | Ga0395898_0058025 | Ga0395898_0058025_2890_3225 | 111 |
| 594 | 3300037466 | Ga0395898_0262795 | Ga0395898_0262795_948_1283 | 111 |
| 595 | 3300037466 | Ga0395898_0498372 | Ga0395898_0498372_698_1048 | 111 |
| 596 | 3300037471 | Ga0395905_0000439 | Ga0395905_0000439_18542_18922 | 111 |
| 597 | 3300037471 | Ga0395905_0001011 | Ga0395905_0001011_3887_4237 | 111 |
| 598 | 3300037471 | Ga0395905_0219748 | Ga0395905_0219748_1114_1449 | 111 |
| 599 | 3300037471 | Ga0395905_0510412 | Ga0395905_0510412_417_752 | 111 |
| 600 | 3300038443 | Ga0395901_0049362 | Ga0395901_0049362_1807_2142 | 111 |
| 601 | 3300038443 | Ga0395901_0442902 | Ga0395901_0442902_500_880 | 111 |
| 602 | 3300038443 | Ga0395901_0713309 | Ga0395901_0713309_500_880 | 111 |
| 603 | 3300038443 | Ga0395901_0953432 | Ga0395901_0953432_237_572 | 111 |
| 604 | 3300048905 | Ga0496102_0109143 | Ga0496102_0109143_1059_1394 | 111 |
| 605 | 3300048906 | Ga0496103_0064459 | Ga0496103_0064459_1403_1738 | 111 |
| 606 | 3300048909 | Ga0496106_0676516 | Ga0496106_0676516_112_447 | 111 |
| 607 | 3300048910 | Ga0496107_0032339 | Ga0496107_0032339_2021_2356 | 111 |
| 608 | 3300048915 | Ga0496112_0203820 | Ga0496112_0203820_1006_1341 | 111 |
| 609 | 3300048915 | Ga0496112_0738108 | Ga0496112_0738108_106_441 | 111 |
| 610 | 3300048915 | Ga0496112_1558280 | Ga0496112_1558280_72_413 | 111 |
| 611 | 3300048916 | Ga0496113_0110992 | Ga0496113_0110992_70_405 | 111 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3iur-assembly1.cif.gz_A | appep_d266nx+h2h3 opened state | 0.9546 | 75 | 107 |
| 3mun-assembly1.cif.gz_A | appep_pepclose closed state | 0.8907 | 75 | 107 |
| 4hbr-assembly4.cif.gz_D | crystal structure of a putative periplasmic proteins (bacegg_01429) from bacteroides eggerthii dsm 20697 at 2.40 a resolution | 0.8742 | 60 | 105 |
| 2bkl-assembly1.cif.gz_A | structural and mechanistic analysis of two prolyl endopeptidases: role of inter-domain dynamics in catalysis and specificity | 0.8542 | 69 | 107 |
| 4k61-assembly2.cif.gz_B | crystal structure of a duf2874 family protein (bacuni_01296) from bacteroides uniformis atcc 8492 at 1.70 a resolution | 0.8383 | 55 | 105 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q7KRR5_243_283_3.10.620.30 | Alpha Beta;Roll;C8orf32 fold; | 0.8508 | 69 | 97 | 3.10.620.30 |
| 2bklB02 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;Prolyl oligopeptidase, N-terminal domain | 0.8491 | 69 | 107 | 2.130.10.120 |
| af_Q2G105_44_121_3.10.450.40 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.8298 | 54 | 108 | 3.10.450.40 |
| af_P09833_289_351_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.8203 | 71 | 99 | 2.40.50.100 |
| 3u1wA01 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.8062 | 55 | 104 | 3.10.450.360 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A845F8I6-F1-model_v4 | PepSY domain-containing protein | 0.8863 | 55 | 108 |
GO:0016020
|
| AF-A0A2V6BA42-F1-model_v4 | PepSY domain-containing protein | 0.8759 | 60 | 110 |
|
| AF-A0A227HC06-F1-model_v4 | Peptidase S9A N-terminal domain-containing protein | 0.8733 | 70 | 109 |
GO:0004252
|
| AF-A0A102D951-F1-model_v4 | PepSY domain-containing protein | 0.8721 | 34 | 109 |
|
| AF-A0A244D2L1-F1-model_v4 | deleted | 0.8643 | 60 | 105 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar