F469176
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 612 | 312 | 1224 | 249 |
Family's Representative Sequence
| Representative Sequence | 3300046460|Ga0495638_0000267|Ga0495638_0000267_27838_28698 |
| Length | 286 |
| Sequence | MRFHNGSIEVWNYGGTSDGIGRLHPVSLHRGRTLFQEHGMKQLVAFDLDGTLAESKQPLREPMGDALADLLGVAHVAVISGGDWPQFEKQVASRLPARADLTRLWLMPTTGTKLYRYDGAWSAVYAELFDDAQKQAIFAAFDESLKATGFVPEQTWGERIEDRGSQITFSALGQQAPLDAKEHWDPDFAKRKVIQVDLRKRLPGLSINMGGATSIDITREGVDKAYGLKKLRDASGIELDAMMFIGDAIFPGGNDYPAKELGLDTVRVRDPEETLSVIAAIVACQK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 4 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 5 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 6 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 7 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 8 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 9 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 10 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 11 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 12 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 13 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 14 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 15 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 16 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 17 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 18 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 19 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 20 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 22 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 27 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 29 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 40 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 42 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 46 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 48 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 49 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 50 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 51 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 52 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 53 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 54 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 55 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 56 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 57 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 58 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 59 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 60 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 61 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 62 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 63 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 65 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 66 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 67 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009978 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG | Metagenome | Rhizosphere |
| 78 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 91 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 94 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 95 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 96 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 98 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 100 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 102 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 153 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 154 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 155 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 156 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 157 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 158 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 159 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 160 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 161 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 162 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 163 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 164 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 165 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 166 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 167 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 168 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 169 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 170 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 171 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 172 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 173 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 174 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 175 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 176 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 177 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 178 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 179 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 180 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 181 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 215 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 216 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 217 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 218 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 219 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 220 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 221 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 222 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 223 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 224 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 225 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 226 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 227 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 228 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 229 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 230 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 231 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 233 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 234 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 240 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 241 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 242 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 243 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 244 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 246 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 247 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 248 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 249 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 250 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 251 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 252 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 253 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 254 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 255 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 257 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 258 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 259 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 260 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 261 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 262 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 263 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 264 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 265 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 266 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 267 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 268 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 269 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 270 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 271 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 272 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 273 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 274 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 275 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 276 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 277 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 278 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 279 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 280 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 281 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 282 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 283 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 284 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 285 | 2510917021 | Novosphingobium sp. AP12 | Isolate | Rhizosphere |
| 286 | 2512564014 | Sphingobium sp. AP49 | Isolate | Rhizosphere |
| 287 | 2582581305 | Rhizorhabdus wittichii YR128 | Isolate | Rhizosphere |
| 288 | 2599185354 | Sphingomonas sp. NFR15 | Isolate | Rhizoplane |
| 289 | 2643221541 | Sphingomonas sp. Root50 | Isolate | Unclassified |
| 290 | 2643221560 | Sphingopyxis sp. Root1497 | Isolate | Unclassified |
| 291 | 2643221563 | Sphingopyxis sp. Root154 | Isolate | Unclassified |
| 292 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 293 | 2643221608 | Sphingopyxis sp. Root214 | Isolate | Unclassified |
| 294 | 2643221671 | Sphingomonas sp. Root1294 | Isolate | Unclassified |
| 295 | 2808606401 | Sphingobium sp. AEW010 | Isolate | Rhizosphere |
| 296 | 2808606404 | Sphingobium sp. AEW013 | Isolate | Rhizosphere |
| 297 | 2808606405 | Sphingobium sp. AEW001 | Isolate | Rhizosphere |
| 298 | 2818991438 | Novosphingobium barchaimii 1192 | Isolate | Unclassified |
| 299 | 2830075706 | Sphingomonas jinjuensis DSM 21457 | Isolate | Rhizosphere |
| 300 | 2852653556 | Sphingopyxis sp. JAI108 | Isolate | Rhizosphere |
| 301 | 2852680915 | Sphingopyxis sp. JAI128 | Isolate | Rhizosphere |
| 302 | 2909042592 | Labrys sp. LIt4 | Isolate | Nodule |
| 303 | 2928027323 | Sphingomonas sp. 1185 | Isolate | Unclassified |
| 304 | 2928968154 | Sphingomonas trueperi 1075 | Isolate | Unclassified |
| 305 | 2946787523 | Sphingomonas faeni W4I17 | Isolate | Rhizosphere |
| 306 | 2984555340 | Sphingomonas sp. SORGH_AS789 | Isolate | Aerial Root |
| 307 | 2984564862 | Sphingomonas sp. SORGH_AS870 | Isolate | Aerial Root |
| 308 | 2990265787 | Sphingomonas sp. SORGH_AS802 | Isolate | Aerial Root |
| 309 | 2993356040 | Sphingomonas sp. SORGH_AS742 | Isolate | Aerial Root |
| 310 | 2993693658 | Sphingomonas sp. SORGH_AS438 | Isolate | Aerial Root |
| 311 | 8054302542 | Novosphingobium kaempferiae Sx8-5 | Isolate | Rhizosphere |
| 312 | 8057101203 | Sphingomonas lycopersici MMSM20 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.77 |
| Metatranscriptomes | 0 |
| Isolates | 5.23 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.82 |
| Bulb | 0 |
| Endosphere | 23.53 |
| Nodule | 0.16 |
| Rhizoplane | 2.45 |
| Rhizosphere | 60.46 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.16 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495638_0000267 | 3300046460 | Bacteria | 70470 |
| 2 | SwRhRL2b_contig_2866031 | 2162886007 | Bacteria | 47061 |
| 3 | SwRhRL2b_contig_860484 | 2162886007 | Bacteria | 1628 |
| 4 | JGI24736J21556_1008730 | 3300001904 | Bacteria | 1681 |
| 5 | JGI24741J21665_1007135 | 3300001915 | Bacteria | 2188 |
| 6 | JGI24740J21852_10042393 | 3300001979 | Bacteria | 1364 |
| 7 | JGI24739J22299_10000601 | 3300001989 | Bacteria | 12967 |
| 8 | JGI24739J22299_10002449 | 3300001989 | Bacteria | 7159 |
| 9 | JGI24739J22299_10004424 | 3300001989 | Bacteria | 5384 |
| 10 | JGI24737J22298_10000720 | 3300001990 | Bacteria | 11643 |
| 11 | JGI24737J22298_10071114 | 3300001990 | Bacteria | 1039 |
| 12 | JGI24735J21928_10001166 | 3300002067 | Bacteria | 9407 |
| 13 | JGI24735J21928_10008108 | 3300002067 | Bacteria | 3407 |
| 14 | JGI24735J21928_10027700 | 3300002067 | Bacteria | 1697 |
| 15 | JGI24735J21928_10034178 | 3300002067 | Bacteria | 1500 |
| 16 | JGI24738J21930_10000330 | 3300002075 | Bacteria | 13051 |
| 17 | JGI24738J21930_10000338 | 3300002075 | Bacteria | 12810 |
| 18 | JGI24738J21930_10000440 | 3300002075 | Bacteria | 11750 |
| 19 | JGI24738J21930_10010342 | 3300002075 | Bacteria | 2078 |
| 20 | JGI24744J21845_10004368 | 3300002077 | Bacteria | 2921 |
| 21 | JGI24751J29686_10001912 | 3300002459 | Bacteria | 4252 |
| 22 | JGI25157J39369_1018117 | 3300002741 | Bacteria | 851 |
| 23 | JGI25150J39212_1000020 | 3300002774 | Bacteria | 134928 |
| 24 | JGI25165J46597_1000073 | 3300003214 | Bacteria | 192140 |
| 25 | JGI25165J46597_1000188 | 3300003214 | Bacteria | 92329 |
| 26 | JGI25153J46596_10000017 | 3300003215 | Bacteria | 274325 |
| 27 | rootL2_10165951 | 3300003322 | Bacteria | 1372 |
| 28 | Ga0055542_1004389 | 3300003762 | Bacteria | 3446 |
| 29 | Ga0055536_1000713 | 3300003781 | Bacteria | 22261 |
| 30 | Ga0055536_1011158 | 3300003781 | Bacteria | 3484 |
| 31 | Ga0055530_10005655 | 3300003791 | Bacteria | 5854 |
| 32 | Ga0055530_10008737 | 3300003791 | Bacteria | 4006 |
| 33 | Ga0055530_10044614 | 3300003791 | Bacteria | 1062 |
| 34 | Ga0055531_10003646 | 3300003794 | Bacteria | 9711 |
| 35 | Ga0055531_10022471 | 3300003794 | Bacteria | 2402 |
| 36 | Ga0055531_10045466 | 3300003794 | Bacteria | 1218 |
| 37 | Ga0055531_10046828 | 3300003794 | Bacteria | 1184 |
| 38 | Ga0065165_1004847 | 3300005262 | Bacteria | 7999 |
| 39 | Ga0065704_10000192 | 3300005289 | Bacteria | 216848 |
| 40 | Ga0065704_10006257 | 3300005289 | Bacteria | 2774 |
| 41 | Ga0065704_10111589 | 3300005289 | Bacteria | 1950 |
| 42 | Ga0065707_10101327 | 3300005295 | Bacteria | 2872 |
| 43 | Ga0070658_10033853 | 3300005327 | Bacteria | 4111 |
| 44 | Ga0070658_10041598 | 3300005327 | Bacteria | 3708 |
| 45 | Ga0070658_10358454 | 3300005327 | Bacteria | 1249 |
| 46 | Ga0070658_10528373 | 3300005327 | Bacteria | 1020 |
| 47 | Ga0070676_10002175 | 3300005328 | Bacteria | 9989 |
| 48 | Ga0068869_100000848 | 3300005334 | Bacteria | 17540 |
| 49 | Ga0070666_10040596 | 3300005335 | Bacteria | 3106 |
| 50 | Ga0068868_100000154 | 3300005338 | Bacteria | 44616 |
| 51 | Ga0068868_100147581 | 3300005338 | Bacteria | 1935 |
| 52 | Ga0070660_100000544 | 3300005339 | Bacteria | 25288 |
| 53 | Ga0070660_100174061 | 3300005339 | Bacteria | 1740 |
| 54 | Ga0070660_100211179 | 3300005339 | Bacteria | 1576 |
| 55 | Ga0070660_100409501 | 3300005339 | Bacteria | 1122 |
| 56 | Ga0070660_100438185 | 3300005339 | Bacteria | 1083 |
| 57 | Ga0070661_100092363 | 3300005344 | Bacteria | 2242 |
| 58 | Ga0070668_100615823 | 3300005347 | Bacteria | 951 |
| 59 | Ga0070673_100000023 | 3300005364 | Bacteria | 91936 |
| 60 | Ga0070659_100059344 | 3300005366 | Bacteria | 3021 |
| 61 | Ga0070659_100059457 | 3300005366 | Bacteria | 3018 |
| 62 | Ga0070659_100066008 | 3300005366 | Bacteria | 2867 |
| 63 | Ga0070659_100075161 | 3300005366 | Bacteria | 2692 |
| 64 | Ga0070659_100663842 | 3300005366 | Bacteria | 899 |
| 65 | Ga0070667_100001100 | 3300005367 | Bacteria | 24778 |
| 66 | Ga0070663_100001998 | 3300005455 | Bacteria | 11388 |
| 67 | Ga0070678_100054021 | 3300005456 | Bacteria | 2924 |
| 68 | Ga0070662_100002062 | 3300005457 | Bacteria | 12318 |
| 69 | Ga0070662_100081846 | 3300005457 | Bacteria | 2406 |
| 70 | Ga0070662_100131072 | 3300005457 | Bacteria | 1933 |
| 71 | Ga0070681_10094688 | 3300005458 | Bacteria | 2935 |
| 72 | Ga0068867_100000007 | 3300005459 | Bacteria | 148726 |
| 73 | Ga0070684_100180891 | 3300005535 | Bacteria | 1917 |
| 74 | Ga0068853_100023296 | 3300005539 | Bacteria | 5181 |
| 75 | Ga0068853_100025947 | 3300005539 | Bacteria | 4918 |
| 76 | Ga0068853_100069304 | 3300005539 | Bacteria | 3068 |
| 77 | Ga0070672_100042427 | 3300005543 | Bacteria | 3503 |
| 78 | Ga0070693_100281806 | 3300005547 | Bacteria | 1113 |
| 79 | Ga0070665_100004652 | 3300005548 | Bacteria | 14330 |
| 80 | Ga0068855_100000029 | 3300005563 | Bacteria | 171278 |
| 81 | Ga0068855_100001148 | 3300005563 | Bacteria | 32786 |
| 82 | Ga0068855_100191725 | 3300005563 | Bacteria | 2305 |
| 83 | Ga0068855_100449801 | 3300005563 | Bacteria | 1406 |
| 84 | Ga0070664_100424026 | 3300005564 | Bacteria | 1219 |
| 85 | Ga0068857_100055573 | 3300005577 | Bacteria | 3513 |
| 86 | Ga0068854_100000027 | 3300005578 | Bacteria | 117836 |
| 87 | Ga0068854_100066764 | 3300005578 | Bacteria | 2619 |
| 88 | Ga0068854_100154085 | 3300005578 | Bacteria | 1774 |
| 89 | Ga0068854_100218332 | 3300005578 | Bacteria | 1507 |
| 90 | Ga0068856_100004098 | 3300005614 | Bacteria | 14566 |
| 91 | Ga0068852_100004278 | 3300005616 | Bacteria | 10072 |
| 92 | Ga0068852_100006260 | 3300005616 | Bacteria | 8587 |
| 93 | Ga0068852_100025178 | 3300005616 | Bacteria | 4818 |
| 94 | Ga0068852_100129866 | 3300005616 | Bacteria | 2319 |
| 95 | Ga0068852_100182937 | 3300005616 | Bacteria | 1972 |
| 96 | Ga0068864_100002125 | 3300005618 | Bacteria | 16383 |
| 97 | Ga0068866_10012667 | 3300005718 | Bacteria | 3680 |
| 98 | Ga0068858_100000228 | 3300005842 | Bacteria | 60736 |
| 99 | Ga0068858_100001700 | 3300005842 | Bacteria | 22479 |
| 100 | Ga0068860_100286162 | 3300005843 | Bacteria | 1612 |
| 101 | Ga0075365_10178714 | 3300006038 | Bacteria | 1483 |
| 102 | Ga0075368_10000055 | 3300006042 | Bacteria | 27866 |
| 103 | Ga0075368_10000168 | 3300006042 | Bacteria | 17741 |
| 104 | Ga0075368_10000967 | 3300006042 | Bacteria | 8953 |
| 105 | Ga0075368_10032193 | 3300006042 | Bacteria | 2035 |
| 106 | Ga0075363_100006130 | 3300006048 | Bacteria | 5429 |
| 107 | Ga0075363_100017846 | 3300006048 | Bacteria | 3527 |
| 108 | Ga0075363_100096373 | 3300006048 | Bacteria | 1633 |
| 109 | Ga0075364_10206394 | 3300006051 | Bacteria | 1332 |
| 110 | Ga0075362_10002811 | 3300006177 | Bacteria | 5939 |
| 111 | Ga0075362_10034881 | 3300006177 | Bacteria | 2195 |
| 112 | Ga0075367_10000109 | 3300006178 | Bacteria | 23429 |
| 113 | Ga0075367_10000289 | 3300006178 | Bacteria | 17620 |
| 114 | Ga0075367_10006417 | 3300006178 | Bacteria | 5939 |
| 115 | Ga0075367_10049680 | 3300006178 | Bacteria | 2473 |
| 116 | Ga0075369_10095090 | 3300006186 | Bacteria | 1332 |
| 117 | Ga0075369_10155901 | 3300006186 | Bacteria | 1045 |
| 118 | Ga0075366_10037690 | 3300006195 | Bacteria | 2855 |
| 119 | Ga0075366_10076800 | 3300006195 | Bacteria | 1993 |
| 120 | Ga0075366_10143533 | 3300006195 | Bacteria | 1444 |
| 121 | Ga0097621_100002061 | 3300006237 | Bacteria | 13748 |
| 122 | Ga0075370_10000257 | 3300006353 | Bacteria | 18995 |
| 123 | Ga0075370_10026515 | 3300006353 | Bacteria | 3211 |
| 124 | Ga0075370_10050753 | 3300006353 | Bacteria | 2353 |
| 125 | Ga0075370_10085395 | 3300006353 | Bacteria | 1817 |
| 126 | Ga0075370_10125899 | 3300006353 | Bacteria | 1493 |
| 127 | Ga0068871_100002074 | 3300006358 | Bacteria | 13555 |
| 128 | Ga0068865_100000010 | 3300006881 | Bacteria | 159548 |
| 129 | Ga0105240_10013748 | 3300009093 | Bacteria | 11095 |
| 130 | Ga0105240_10017476 | 3300009093 | Bacteria | 9666 |
| 131 | Ga0105240_10070818 | 3300009093 | Bacteria | 4313 |
| 132 | Ga0105240_10304868 | 3300009093 | Bacteria | 1821 |
| 133 | Ga0105245_10002089 | 3300009098 | Bacteria | 18117 |
| 134 | Ga0105245_10009485 | 3300009098 | Bacteria | 8488 |
| 135 | Ga0114129_10149346 | 3300009147 | Bacteria | 3198 |
| 136 | Ga0105243_10000950 | 3300009148 | Bacteria | 27049 |
| 137 | Ga0105243_10056170 | 3300009148 | Bacteria | 3129 |
| 138 | Ga0105243_10294328 | 3300009148 | Bacteria | 1468 |
| 139 | Ga0105243_10715950 | 3300009148 | Bacteria | 977 |
| 140 | Ga0105241_10045550 | 3300009174 | Bacteria | 3328 |
| 141 | Ga0105241_10415116 | 3300009174 | Bacteria | 1183 |
| 142 | Ga0105242_10000210 | 3300009176 | Bacteria | 45627 |
| 143 | Ga0105248_10010320 | 3300009177 | Bacteria | 10279 |
| 144 | Ga0105248_10017254 | 3300009177 | Bacteria | 7955 |
| 145 | Ga0105237_10010097 | 3300009545 | Bacteria | 10069 |
| 146 | Ga0105237_10051294 | 3300009545 | Bacteria | 4144 |
| 147 | Ga0105237_10458234 | 3300009545 | Bacteria | 1281 |
| 148 | Ga0105237_10585404 | 3300009545 | Bacteria | 1123 |
| 149 | Ga0105238_10027777 | 3300009551 | Bacteria | 5766 |
| 150 | Ga0105238_10226524 | 3300009551 | Bacteria | 1846 |
| 151 | Ga0105238_10473056 | 3300009551 | Bacteria | 1252 |
| 152 | Ga0105249_10017303 | 3300009553 | Bacteria | 6400 |
| 153 | Ga0105148_100253 | 3300009978 | Bacteria | 7295 |
| 154 | Ga0105239_10000025 | 3300010375 | Bacteria | 254049 |
| 155 | Ga0105239_10004123 | 3300010375 | Bacteria | 17464 |
| 156 | Ga0105239_10031481 | 3300010375 | Bacteria | 5833 |
| 157 | Ga0105239_10046782 | 3300010375 | Bacteria | 4741 |
| 158 | Ga0105246_10000472 | 3300011119 | Bacteria | 21681 |
| 159 | Ga0157373_10047916 | 3300013100 | Bacteria | 3047 |
| 160 | Ga0157373_10084627 | 3300013100 | Bacteria | 2235 |
| 161 | Ga0157373_10264350 | 3300013100 | Bacteria | 1218 |
| 162 | Ga0157371_10211638 | 3300013102 | Bacteria | 1391 |
| 163 | Ga0157370_10000203 | 3300013104 | Bacteria | 75249 |
| 164 | Ga0157370_10074058 | 3300013104 | Bacteria | 3212 |
| 165 | Ga0157369_10057364 | 3300013105 | Bacteria | 4202 |
| 166 | Ga0157369_10203149 | 3300013105 | Bacteria | 2079 |
| 167 | Ga0157369_10511326 | 3300013105 | Bacteria | 1242 |
| 168 | Ga0157374_10000830 | 3300013296 | Bacteria | 27049 |
| 169 | Ga0157374_10045139 | 3300013296 | Bacteria | 4078 |
| 170 | Ga0157374_10071508 | 3300013296 | Bacteria | 3271 |
| 171 | Ga0157374_10103118 | 3300013296 | Bacteria | 2737 |
| 172 | Ga0157378_10001477 | 3300013297 | Bacteria | 21228 |
| 173 | Ga0157378_10084028 | 3300013297 | Bacteria | 2882 |
| 174 | Ga0157378_10166335 | 3300013297 | Bacteria | 2066 |
| 175 | Ga0163162_10001078 | 3300013306 | Bacteria | 25383 |
| 176 | Ga0163162_10446220 | 3300013306 | Bacteria | 1426 |
| 177 | Ga0157372_10010036 | 3300013307 | Bacteria | 10070 |
| 178 | Ga0157372_10058023 | 3300013307 | Bacteria | 4327 |
| 179 | Ga0157372_10179976 | 3300013307 | Bacteria | 2447 |
| 180 | Ga0157372_10339814 | 3300013307 | Bacteria | 1749 |
| 181 | Ga0157375_10002120 | 3300013308 | Bacteria | 17145 |
| 182 | Ga0157376_10000047 | 3300014969 | Bacteria | 107974 |
| 183 | Ga0183363_1002 | 3300015690 | Bacteria | 425040 |
| 184 | Ga0163161_10013007 | 3300017792 | Bacteria | 5783 |
| 185 | Ga0207427_101974 | 3300025231 | Bacteria | 6255 |
| 186 | Ga0207425_1000022 | 3300025245 | Bacteria | 355305 |
| 187 | Ga0209646_1021491 | 3300025246 | Bacteria | 926 |
| 188 | Ga0209026_1002441 | 3300025250 | Bacteria | 6982 |
| 189 | Ga0209026_1004353 | 3300025250 | Bacteria | 4235 |
| 190 | Ga0209148_1000061 | 3300025254 | Bacteria | 349575 |
| 191 | Ga0209148_1001013 | 3300025254 | Bacteria | 17719 |
| 192 | Ga0209129_1000286 | 3300025258 | Bacteria | 48191 |
| 193 | Ga0209233_1000120 | 3300025261 | Bacteria | 233311 |
| 194 | Ga0209233_1000142 | 3300025261 | Bacteria | 192193 |
| 195 | Ga0209565_1007352 | 3300025263 | Bacteria | 2981 |
| 196 | Ga0209455_1000692 | 3300025272 | Bacteria | 19864 |
| 197 | Ga0209675_1000126 | 3300025291 | Bacteria | 104792 |
| 198 | Ga0209676_1000566 | 3300025292 | Bacteria | 55814 |
| 199 | Ga0209676_1008708 | 3300025292 | Bacteria | 4479 |
| 200 | Ga0209676_1009141 | 3300025292 | Bacteria | 4313 |
| 201 | Ga0209676_1026483 | 3300025292 | Bacteria | 1840 |
| 202 | Ga0209025_1001464 | 3300025294 | Bacteria | 30863 |
| 203 | Ga0209025_1019511 | 3300025294 | Bacteria | 3766 |
| 204 | Ga0209025_1075443 | 3300025294 | Bacteria | 1173 |
| 205 | Ga0209758_1000004 | 3300025297 | Bacteria | 1375322 |
| 206 | Ga0209050_1000001 | 3300025298 | Bacteria | 3563507 |
| 207 | Ga0209050_1000047 | 3300025298 | Bacteria | 380561 |
| 208 | Ga0209050_1000127 | 3300025298 | Bacteria | 187951 |
| 209 | Ga0209051_1000246 | 3300025303 | Bacteria | 91170 |
| 210 | Ga0209257_1000517 | 3300025304 | Bacteria | 67082 |
| 211 | Ga0209257_1002394 | 3300025304 | Bacteria | 18771 |
| 212 | Ga0209257_1002888 | 3300025304 | Bacteria | 15965 |
| 213 | Ga0209257_1010863 | 3300025304 | Bacteria | 4507 |
| 214 | Ga0209257_1030916 | 3300025304 | Bacteria | 1720 |
| 215 | Ga0207697_10086321 | 3300025315 | Bacteria | 1326 |
| 216 | Ga0207656_10059287 | 3300025321 | Bacteria | 1675 |
| 217 | Ga0207642_10007810 | 3300025899 | Bacteria | 3631 |
| 218 | Ga0207688_10080907 | 3300025901 | Bacteria | 1855 |
| 219 | Ga0207680_10022733 | 3300025903 | Bacteria | 3414 |
| 220 | Ga0207647_10000270 | 3300025904 | Bacteria | 42605 |
| 221 | Ga0207647_10016335 | 3300025904 | Bacteria | 5068 |
| 222 | Ga0207647_10017291 | 3300025904 | Bacteria | 4902 |
| 223 | Ga0207647_10051484 | 3300025904 | Bacteria | 2545 |
| 224 | Ga0207647_10054292 | 3300025904 | Bacteria | 2466 |
| 225 | Ga0207647_10065747 | 3300025904 | Bacteria | 2200 |
| 226 | Ga0207645_10029542 | 3300025907 | Bacteria | 3533 |
| 227 | Ga0207705_10000316 | 3300025909 | Bacteria | 44059 |
| 228 | Ga0207705_10000963 | 3300025909 | Bacteria | 23546 |
| 229 | Ga0207705_10009514 | 3300025909 | Bacteria | 7072 |
| 230 | Ga0207705_10369159 | 3300025909 | Bacteria | 1107 |
| 231 | Ga0207705_10525168 | 3300025909 | Bacteria | 920 |
| 232 | Ga0207654_10342347 | 3300025911 | Bacteria | 1027 |
| 233 | Ga0207695_10008358 | 3300025913 | Bacteria | 12966 |
| 234 | Ga0207695_10041776 | 3300025913 | Bacteria | 4905 |
| 235 | Ga0207695_10057479 | 3300025913 | Bacteria | 4040 |
| 236 | Ga0207671_10002163 | 3300025914 | Bacteria | 21356 |
| 237 | Ga0207671_10098859 | 3300025914 | Bacteria | 2208 |
| 238 | Ga0207671_10107147 | 3300025914 | Bacteria | 2122 |
| 239 | Ga0207657_10003918 | 3300025919 | Bacteria | 15794 |
| 240 | Ga0207657_10049263 | 3300025919 | Bacteria | 3673 |
| 241 | Ga0207657_10057737 | 3300025919 | Bacteria | 3343 |
| 242 | Ga0207649_10067641 | 3300025920 | Bacteria | 2269 |
| 243 | Ga0207681_10047485 | 3300025923 | Bacteria | 2893 |
| 244 | Ga0207694_10217153 | 3300025924 | Bacteria | 1559 |
| 245 | Ga0207650_10203060 | 3300025925 | Bacteria | 1589 |
| 246 | Ga0207687_10006744 | 3300025927 | Bacteria | 7566 |
| 247 | Ga0207687_10027727 | 3300025927 | Bacteria | 3802 |
| 248 | Ga0207644_10224943 | 3300025931 | Bacteria | 1489 |
| 249 | Ga0207690_10077238 | 3300025932 | Bacteria | 2314 |
| 250 | Ga0207690_10123350 | 3300025932 | Bacteria | 1885 |
| 251 | Ga0207690_10207593 | 3300025932 | Bacteria | 1491 |
| 252 | Ga0207690_10227985 | 3300025932 | Bacteria | 1429 |
| 253 | Ga0207690_10430273 | 3300025932 | Bacteria | 1057 |
| 254 | Ga0207706_10004159 | 3300025933 | Bacteria | 13640 |
| 255 | Ga0207706_10019782 | 3300025933 | Bacteria | 6053 |
| 256 | Ga0207706_10103379 | 3300025933 | Bacteria | 2506 |
| 257 | Ga0207709_10000050 | 3300025935 | Bacteria | 234391 |
| 258 | Ga0207704_10000020 | 3300025938 | Bacteria | 148847 |
| 259 | Ga0207711_10005221 | 3300025941 | Bacteria | 11005 |
| 260 | Ga0207711_10056418 | 3300025941 | Bacteria | 3376 |
| 261 | Ga0207689_10001541 | 3300025942 | Bacteria | 21894 |
| 262 | Ga0207661_10055536 | 3300025944 | Bacteria | 3177 |
| 263 | Ga0207667_10000035 | 3300025949 | Bacteria | 301056 |
| 264 | Ga0207667_10004932 | 3300025949 | Bacteria | 16295 |
| 265 | Ga0207667_10075657 | 3300025949 | Bacteria | 3495 |
| 266 | Ga0207667_10131103 | 3300025949 | Bacteria | 2582 |
| 267 | Ga0207667_10697721 | 3300025949 | Bacteria | 1018 |
| 268 | Ga0207651_10000005 | 3300025960 | Bacteria | 246132 |
| 269 | Ga0207712_10097162 | 3300025961 | Bacteria | 2182 |
| 270 | Ga0207668_10273471 | 3300025972 | Bacteria | 1382 |
| 271 | Ga0207640_10000145 | 3300025981 | Bacteria | 51603 |
| 272 | Ga0207640_10056590 | 3300025981 | Bacteria | 2575 |
| 273 | Ga0207640_10059222 | 3300025981 | Bacteria | 2527 |
| 274 | Ga0207640_10332653 | 3300025981 | Bacteria | 1214 |
| 275 | Ga0207658_10000571 | 3300025986 | Bacteria | 33340 |
| 276 | Ga0207677_10000373 | 3300026023 | Bacteria | 31103 |
| 277 | Ga0207703_10000976 | 3300026035 | Bacteria | 27501 |
| 278 | Ga0207703_10004598 | 3300026035 | Bacteria | 11293 |
| 279 | Ga0207639_10002511 | 3300026041 | Bacteria | 12308 |
| 280 | Ga0207639_10007809 | 3300026041 | Bacteria | 7304 |
| 281 | Ga0207639_10332655 | 3300026041 | Bacteria | 1352 |
| 282 | Ga0207678_10005889 | 3300026067 | Bacteria | 10929 |
| 283 | Ga0207678_10249930 | 3300026067 | Bacteria | 1518 |
| 284 | Ga0207678_10320657 | 3300026067 | Bacteria | 1333 |
| 285 | Ga0207702_10003711 | 3300026078 | Bacteria | 13808 |
| 286 | Ga0207702_10012620 | 3300026078 | Bacteria | 7034 |
| 287 | Ga0207702_10037699 | 3300026078 | Bacteria | 4047 |
| 288 | Ga0207702_10245821 | 3300026078 | Bacteria | 1678 |
| 289 | Ga0207648_10000017 | 3300026089 | Bacteria | 148699 |
| 290 | Ga0207676_10000190 | 3300026095 | Bacteria | 53850 |
| 291 | Ga0207676_10348384 | 3300026095 | Bacteria | 1369 |
| 292 | Ga0207674_10015748 | 3300026116 | Bacteria | 8294 |
| 293 | Ga0207674_10022819 | 3300026116 | Bacteria | 6715 |
| 294 | Ga0207674_10776312 | 3300026116 | Bacteria | 925 |
| 295 | Ga0207674_10892142 | 3300026116 | Bacteria | 857 |
| 296 | Ga0207683_10029414 | 3300026121 | Bacteria | 4757 |
| 297 | Ga0207698_10000712 | 3300026142 | Bacteria | 19239 |
| 298 | Ga0207698_10036634 | 3300026142 | Bacteria | 3603 |
| 299 | Ga0207698_10036776 | 3300026142 | Bacteria | 3598 |
| 300 | Ga0207698_10038607 | 3300026142 | Bacteria | 3530 |
| 301 | Ga0207698_10713009 | 3300026142 | Bacteria | 999 |
| 302 | Ga0209813_10000048 | 3300027866 | Bacteria | 48973 |
| 303 | Ga0209813_10000191 | 3300027866 | Bacteria | 19193 |
| 304 | Ga0209813_10000220 | 3300027866 | Bacteria | 17618 |
| 305 | Ga0268266_10889770 | 3300028379 | Bacteria | 861 |
| 306 | Ga0268264_10245060 | 3300028381 | Bacteria | 1662 |
| 307 | Ga0307517_10026027 | 3300028786 | Bacteria | 7113 |
| 308 | Ga0307513_10061622 | 3300031456 | Bacteria | 3971 |
| 309 | Ga0307513_10256515 | 3300031456 | Bacteria | 1541 |
| 310 | Ga0307508_10004238 | 3300031616 | Bacteria | 14080 |
| 311 | Ga0307510_10191540 | 3300033180 | Bacteria | 1592 |
| 312 | Ga0373946_0289600 | 3300035171 | Bacteria | 807 |
| 313 | Ga0395899_0002116 | 3300037312 | Bacteria | 16321 |
| 314 | Ga0395899_0317704 | 3300037312 | Bacteria | 1050 |
| 315 | Ga0395900_0260720 | 3300037418 | Bacteria | 1731 |
| 316 | Ga0395905_0497526 | 3300037471 | Bacteria | 1119 |
| 317 | Ga0436364_1389735 | 3300037853 | Bacteria | 3606 |
| 318 | Ga0395901_0245370 | 3300038443 | Bacteria | 1867 |
| 319 | Ga0436365_1211005 | 3300039437 | Bacteria | 1323 |
| 320 | Ga0436363_0389907 | 3300039450 | Bacteria | 1756 |
| 321 | Ga0451802_0044966 | 3300041460 | Bacteria | 2341 |
| 322 | Ga0451806_660356 | 3300041462 | Bacteria | 3795 |
| 323 | Ga0451804_0756293 | 3300041463 | Bacteria | 1937 |
| 324 | Ga0451807_2284404 | 3300041486 | Bacteria | 1071 |
| 325 | Ga0451853_1879690 | 3300041512 | Bacteria | 3625 |
| 326 | Ga0439448_0002573 | 3300042005 | Bacteria | 4944 |
| 327 | Ga0439448_0003494 | 3300042005 | Bacteria | 4352 |
| 328 | Ga0439448_0027604 | 3300042005 | Bacteria | 1790 |
| 329 | Ga0439448_0038338 | 3300042005 | Bacteria | 1542 |
| 330 | Ga0439455_0000252 | 3300042012 | Bacteria | 6482 |
| 331 | Ga0439455_0000304 | 3300042012 | Bacteria | 6168 |
| 332 | Ga0439455_0054729 | 3300042012 | Bacteria | 1048 |
| 333 | Ga0439458_0000255 | 3300042157 | Bacteria | 12956 |
| 334 | Ga0439458_0000305 | 3300042157 | Bacteria | 12201 |
| 335 | Ga0439458_0026115 | 3300042157 | Bacteria | 1372 |
| 336 | Ga0466972_0274254 | 3300044658 | Bacteria | 788 |
| 337 | Ga0466966_0019647 | 3300044684 | Bacteria | 4445 |
| 338 | Ga0466963_0008961 | 3300044694 | Bacteria | 6006 |
| 339 | Ga0466964_0012394 | 3300044706 | Bacteria | 3226 |
| 340 | Ga0466964_0018224 | 3300044706 | Bacteria | 2692 |
| 341 | Ga0466971_0000834 | 3300044719 | Bacteria | 12515 |
| 342 | Ga0466968_0054687 | 3300044735 | Bacteria | 1711 |
| 343 | Ga0466970_0012023 | 3300044765 | Bacteria | 4420 |
| 344 | Ga0466957_0274396 | 3300044842 | Bacteria | 1127 |
| 345 | Ga0466960_0014885 | 3300044901 | Bacteria | 3342 |
| 346 | Ga0495627_000582 | 3300046453 | Bacteria | 29200 |
| 347 | Ga0495629_0157525 | 3300046459 | Bacteria | 1578 |
| 348 | Ga0495638_0080909 | 3300046460 | Bacteria | 1973 |
| 349 | Ga0495638_0144399 | 3300046460 | Bacteria | 1386 |
| 350 | Ga0495638_0156654 | 3300046460 | Bacteria | 1317 |
| 351 | Ga0495650_0001090 | 3300046471 | Bacteria | 29761 |
| 352 | Ga0495650_0049328 | 3300046471 | Bacteria | 1749 |
| 353 | Ga0495605_0069453 | 3300046474 | Bacteria | 1668 |
| 354 | Ga0495584_0014651 | 3300046491 | Bacteria | 3995 |
| 355 | Ga0495596_0000196 | 3300046500 | Bacteria | 41923 |
| 356 | Ga0495596_0000537 | 3300046500 | Bacteria | 23841 |
| 357 | Ga0495607_0016964 | 3300046501 | Bacteria | 4688 |
| 358 | Ga0495607_0047613 | 3300046501 | Bacteria | 2511 |
| 359 | Ga0495583_0000030 | 3300046506 | Bacteria | 254970 |
| 360 | Ga0495583_0000252 | 3300046506 | Bacteria | 88617 |
| 361 | Ga0495606_0044223 | 3300046507 | Bacteria | 2964 |
| 362 | Ga0495606_0116794 | 3300046507 | Bacteria | 1602 |
| 363 | Ga0495610_0000081 | 3300046512 | Bacteria | 113513 |
| 364 | Ga0495610_0001175 | 3300046512 | Bacteria | 23733 |
| 365 | Ga0495610_0003890 | 3300046512 | Bacteria | 11329 |
| 366 | Ga0495610_0027251 | 3300046512 | Bacteria | 3039 |
| 367 | Ga0495610_0047804 | 3300046512 | Bacteria | 2103 |
| 368 | Ga0495620_0013539 | 3300046515 | Bacteria | 4173 |
| 369 | Ga0495632_0000007 | 3300046519 | Bacteria | 343246 |
| 370 | Ga0495632_0000306 | 3300046519 | Bacteria | 47401 |
| 371 | Ga0495632_0027007 | 3300046519 | Bacteria | 3013 |
| 372 | Ga0495637_0000569 | 3300046520 | Bacteria | 26380 |
| 373 | Ga0495637_0033327 | 3300046520 | Bacteria | 2263 |
| 374 | Ga0495637_0077167 | 3300046520 | Bacteria | 1334 |
| 375 | Ga0495643_0000042 | 3300046522 | Bacteria | 229665 |
| 376 | Ga0495643_0000304 | 3300046522 | Bacteria | 68483 |
| 377 | Ga0495643_0007419 | 3300046522 | Bacteria | 7074 |
| 378 | Ga0495643_0021213 | 3300046522 | Bacteria | 3731 |
| 379 | Ga0495648_0037584 | 3300046524 | Bacteria | 3109 |
| 380 | Ga0495663_0000005 | 3300046525 | Bacteria | 342265 |
| 381 | Ga0495663_0018295 | 3300046525 | Bacteria | 1995 |
| 382 | Ga0495654_0034814 | 3300046530 | Bacteria | 2539 |
| 383 | Ga0495654_0043751 | 3300046530 | Bacteria | 2218 |
| 384 | Ga0495609_0007089 | 3300046538 | Bacteria | 5641 |
| 385 | Ga0495622_0006810 | 3300046557 | Bacteria | 5304 |
| 386 | Ga0495633_0000491 | 3300046558 | Bacteria | 39973 |
| 387 | Ga0495633_0001879 | 3300046558 | Bacteria | 15338 |
| 388 | Ga0495668_0000001 | 3300046616 | Bacteria | 1013420 |
| 389 | Ga0495611_0098653 | 3300046648 | Bacteria | 1355 |
| 390 | Ga0495611_0256250 | 3300046648 | Bacteria | 810 |
| 391 | Ga0495625_0000671 | 3300046660 | Bacteria | 48757 |
| 392 | Ga0495625_0002401 | 3300046660 | Bacteria | 20305 |
| 393 | Ga0495625_0035771 | 3300046660 | Bacteria | 3657 |
| 394 | Ga0495625_0050839 | 3300046660 | Bacteria | 2972 |
| 395 | Ga0495625_0057335 | 3300046660 | Bacteria | 2770 |
| 396 | Ga0495625_0063243 | 3300046660 | Bacteria | 2614 |
| 397 | Ga0495625_0085854 | 3300046660 | Bacteria | 2184 |
| 398 | Ga0495661_0033156 | 3300046665 | Bacteria | 3259 |
| 399 | Ga0495670_0013380 | 3300046691 | Bacteria | 4036 |
| 400 | Ga0495670_0028819 | 3300046691 | Bacteria | 2753 |
| 401 | Ga0495670_0243820 | 3300046691 | Bacteria | 957 |
| 402 | Ga0495671_0000011 | 3300046692 | Bacteria | 365582 |
| 403 | Ga0495671_0000126 | 3300046692 | Bacteria | 68483 |
| 404 | Ga0495671_0042256 | 3300046692 | Bacteria | 2292 |
| 405 | Ga0495671_0115065 | 3300046692 | Bacteria | 1313 |
| 406 | Ga0495671_0123561 | 3300046692 | Bacteria | 1262 |
| 407 | Ga0495676_0203871 | 3300047321 | Bacteria | 1373 |
| 408 | Ga0495677_0034004 | 3300047445 | Bacteria | 1859 |
| 409 | Ga0495673_0000013 | 3300047469 | Bacteria | 612902 |
| 410 | Ga0495681_0000517 | 3300047470 | Bacteria | 29470 |
| 411 | Ga0495681_0002422 | 3300047470 | Bacteria | 13333 |
| 412 | Ga0495681_0041330 | 3300047470 | Bacteria | 2239 |
| 413 | Ga0495686_0000063 | 3300047472 | Bacteria | 228575 |
| 414 | Ga0495686_0000082 | 3300047472 | Bacteria | 200115 |
| 415 | Ga0495686_0000401 | 3300047472 | Bacteria | 68555 |
| 416 | Ga0495686_0000661 | 3300047472 | Bacteria | 46810 |
| 417 | Ga0495686_0009632 | 3300047472 | Bacteria | 6938 |
| 418 | Ga0495686_0020603 | 3300047472 | Bacteria | 4395 |
| 419 | Ga0495686_0027175 | 3300047472 | Bacteria | 3738 |
| 420 | Ga0495686_0082333 | 3300047472 | Bacteria | 1964 |
| 421 | Ga0495686_0104101 | 3300047472 | Bacteria | 1709 |
| 422 | Ga0495615_0000020 | 3300048090 | Bacteria | 53202 |
| 423 | Ga0495626_0000298 | 3300048091 | Bacteria | 53039 |
| 424 | Ga0496102_0197094 | 3300048905 | Unclassified | 1898 |
| 425 | Ga0496102_0586199 | 3300048905 | Bacteria | 1038 |
| 426 | Ga0496103_0348167 | 3300048906 | Bacteria | 953 |
| 427 | Ga0496110_0050768 | 3300048913 | Bacteria | 3643 |
| 428 | Ga0496110_0609108 | 3300048913 | Bacteria | 990 |
| 429 | Ga0496111_0033642 | 3300048914 | Bacteria | 3657 |
| 430 | Ga0496111_0107898 | 3300048914 | Bacteria | 2050 |
| 431 | Ga0496111_0413687 | 3300048914 | Bacteria | 996 |
| 432 | Ga0496113_0092142 | 3300048916 | Bacteria | 2337 |
| 433 | Ga0496115_0000285 | 3300048918 | Bacteria | 43764 |
| 434 | Ga0496116_0000035 | 3300048919 | Bacteria | 402424 |
| 435 | Ga0496116_0047806 | 3300048919 | Bacteria | 2877 |
| 436 | Ga0496117_0011402 | 3300048920 | Bacteria | 7961 |
| 437 | Ga0496117_0043351 | 3300048920 | Bacteria | 3272 |
| 438 | Ga0496117_0047825 | 3300048920 | Bacteria | 3063 |
| 439 | Ga0496117_0057221 | 3300048920 | Bacteria | 2710 |
| 440 | Ga0496117_0119468 | 3300048920 | Bacteria | 1622 |
| 441 | Ga0496118_0015807 | 3300048921 | Bacteria | 6962 |
| 442 | Ga0496118_0030413 | 3300048921 | Bacteria | 4507 |
| 443 | Ga0496118_0035164 | 3300048921 | Bacteria | 4074 |
| 444 | Ga0496118_0036903 | 3300048921 | Bacteria | 3943 |
| 445 | Ga0496118_0139977 | 3300048921 | Bacteria | 1536 |
| 446 | Ga0496119_0033280 | 3300048922 | Bacteria | 3421 |
| 447 | Ga0496119_0052623 | 3300048922 | Bacteria | 2493 |
| 448 | Ga0496120_0102515 | 3300048923 | Bacteria | 1509 |
| 449 | Ga0496121_0000105 | 3300048924 | Bacteria | 191437 |
| 450 | Ga0496121_0000579 | 3300048924 | Bacteria | 68757 |
| 451 | Ga0496121_0000671 | 3300048924 | Bacteria | 63867 |
| 452 | Ga0496121_0002960 | 3300048924 | Bacteria | 24756 |
| 453 | Ga0496121_0002979 | 3300048924 | Bacteria | 24637 |
| 454 | Ga0496121_0003092 | 3300048924 | Bacteria | 24067 |
| 455 | Ga0496121_0003231 | 3300048924 | Bacteria | 23434 |
| 456 | Ga0496121_0030578 | 3300048924 | Bacteria | 4943 |
| 457 | Ga0496122_0005685 | 3300048925 | Bacteria | 14721 |
| 458 | Ga0496122_0018901 | 3300048925 | Bacteria | 6329 |
| 459 | Ga0496122_0026933 | 3300048925 | Bacteria | 4935 |
| 460 | Ga0496123_0000159 | 3300048926 | Bacteria | 136014 |
| 461 | Ga0496123_0002459 | 3300048926 | Bacteria | 22941 |
| 462 | Ga0496123_0003542 | 3300048926 | Bacteria | 17370 |
| 463 | Ga0496123_0003707 | 3300048926 | Bacteria | 16803 |
| 464 | Ga0496124_0002365 | 3300048927 | Bacteria | 24886 |
| 465 | Ga0496124_0005911 | 3300048927 | Bacteria | 13541 |
| 466 | Ga0496124_0015727 | 3300048927 | Bacteria | 7234 |
| 467 | Ga0496124_0030523 | 3300048927 | Bacteria | 4783 |
| 468 | Ga0496124_0038486 | 3300048927 | Bacteria | 4153 |
| 469 | Ga0496124_0046585 | 3300048927 | Bacteria | 3712 |
| 470 | Ga0496124_0067837 | 3300048927 | Bacteria | 2966 |
| 471 | Ga0496124_0090965 | 3300048927 | Bacteria | 2487 |
| 472 | Ga0496124_0155365 | 3300048927 | Bacteria | 1790 |
| 473 | Ga0496124_0235082 | 3300048927 | Bacteria | 1367 |
| 474 | Ga0496124_0262178 | 3300048927 | Bacteria | 1271 |
| 475 | Ga0496125_0012910 | 3300048928 | Bacteria | 8247 |
| 476 | Ga0496125_0031437 | 3300048928 | Bacteria | 4731 |
| 477 | Ga0496125_0040553 | 3300048928 | Bacteria | 3992 |
| 478 | Ga0496125_0121127 | 3300048928 | Bacteria | 1866 |
| 479 | Ga0496125_0215487 | 3300048928 | Bacteria | 1242 |
| 480 | Ga0496126_0000077 | 3300048929 | Bacteria | 231592 |
| 481 | Ga0496126_0001878 | 3300048929 | Bacteria | 30558 |
| 482 | Ga0496126_0014533 | 3300048929 | Bacteria | 7953 |
| 483 | Ga0496126_0058122 | 3300048929 | Bacteria | 3487 |
| 484 | Ga0496126_0112148 | 3300048929 | Bacteria | 2375 |
| 485 | Ga0496126_0196016 | 3300048929 | Bacteria | 1708 |
| 486 | Ga0496126_0320266 | 3300048929 | Bacteria | 1275 |
| 487 | Ga0495682_0125592 | 3300049460 | Bacteria | 918 |
| 488 | Ga0501033_0000215 | 3300049570 | Bacteria | 55477 |
| 489 | Ga0501036_0095571 | 3300049572 | Bacteria | 2512 |
| 490 | Ga0501037_0145969 | 3300049573 | Bacteria | 1692 |
| 491 | Ga0501038_0106928 | 3300049574 | Bacteria | 2321 |
| 492 | Ga0501043_0072900 | 3300049579 | Bacteria | 2697 |
| 493 | Ga0501047_0001117 | 3300049581 | Bacteria | 26643 |
| 494 | Ga0501047_0009954 | 3300049581 | Bacteria | 8991 |
| 495 | Ga0501073_0212203 | 3300049589 | Bacteria | 1338 |
| 496 | Ga0501211_001344 | 3300049658 | Bacteria | 2623 |
| 497 | Ga0501223_000064 | 3300049663 | Bacteria | 34167 |
| 498 | Ga0501235_001360 | 3300049669 | Bacteria | 5179 |
| 499 | Ga0501225_0000063 | 3300049705 | Bacteria | 34813 |
| 500 | Ga0501245_005207 | 3300049708 | Bacteria | 1799 |
| 501 | Ga0501044_0000160 | 3300049823 | Bacteria | 83543 |
| 502 | Ga0501044_0079519 | 3300049823 | Bacteria | 3322 |
| 503 | Ga0501044_0256729 | 3300049823 | Bacteria | 1687 |
| 504 | nmdc:mga03683_10661_c1 | 3300050489 | Bacteria | 3302 |
| 505 | nmdc:mga03683_16551_c1 | 3300050489 | Bacteria | 2772 |
| 506 | nmdc:mga03683_927_c1 | 3300050489 | Bacteria | 8482 |
| 507 | nmdc:mga03n38_30348_c1 | 3300050490 | Bacteria | 2272 |
| 508 | nmdc:mga03n38_82620_c1 | 3300050490 | Bacteria | 1513 |
| 509 | nmdc:mga00v17_11965_c1 | 3300050491 | Bacteria | 4776 |
| 510 | nmdc:mga00v17_1563_c1 | 3300050491 | Bacteria | 11955 |
| 511 | nmdc:mga00v17_3583_c1 | 3300050491 | Bacteria | 8021 |
| 512 | nmdc:mga0yw44_158276_c1 | 3300050492 | Bacteria | 1482 |
| 513 | nmdc:mga0yw44_330966_c1 | 3300050492 | Bacteria | 1024 |
| 514 | nmdc:mga0k408_149619_c1 | 3300050493 | Bacteria | 1390 |
| 515 | nmdc:mga0k408_3784_c1 | 3300050493 | Bacteria | 8022 |
| 516 | nmdc:mga0k408_39900_c2 | 3300050493 | Bacteria | 2077 |
| 517 | nmdc:mga06z11_117_c1 | 3300050494 | Bacteria | 32760 |
| 518 | nmdc:mga06z11_295_c1 | 3300050494 | Bacteria | 19152 |
| 519 | nmdc:mga04h51_162_c1 | 3300050495 | Bacteria | 19154 |
| 520 | nmdc:mga04h51_178_c1 | 3300050495 | Bacteria | 17872 |
| 521 | nmdc:mga04h51_29230_c1 | 3300050495 | Bacteria | 1725 |
| 522 | nmdc:mga04h51_656_c1 | 3300050495 | Bacteria | 8066 |
| 523 | nmdc:mga07m45_21157_c1 | 3300050496 | Bacteria | 3539 |
| 524 | nmdc:mga07m45_22_c1 | 3300050496 | Bacteria | 117399 |
| 525 | nmdc:mga07m45_40998_c1 | 3300050496 | Bacteria | 2592 |
| 526 | nmdc:mga07m45_70616_c1 | 3300050496 | Bacteria | 1383 |
| 527 | nmdc:mga07m45_9859_c1 | 3300050496 | Bacteria | 4968 |
| 528 | nmdc:mga05p37_127775_c1 | 3300050507 | Bacteria | 3120 |
| 529 | nmdc:mga0sz30_144328_c1 | 3300050516 | Bacteria | 1052 |
| 530 | nmdc:mga0sz30_48389_c1 | 3300050516 | Bacteria | 1799 |
| 531 | nmdc:mga0sz30_714_c2 | 3300050516 | Bacteria | 2578 |
| 532 | Ga0495619_0384861 | 3300053085 | Bacteria | 969 |
| 533 | Ga0500643_000385 | 3300053087 | Bacteria | 34308 |
| 534 | Ga0500643_002094 | 3300053087 | Bacteria | 10622 |
| 535 | Ga0500647_0066437 | 3300053091 | Bacteria | 1734 |
| 536 | Ga0500651_0345311 | 3300053093 | Bacteria | 845 |
| 537 | Ga0500641_0061888 | 3300053096 | Bacteria | 1560 |
| 538 | Ga0500555_000163 | 3300053103 | Bacteria | 31013 |
| 539 | Ga0500592_001641 | 3300053116 | Bacteria | 3633 |
| 540 | Ga0500594_0009144 | 3300053118 | Bacteria | 2276 |
| 541 | Ga0500597_019103 | 3300053120 | Bacteria | 2670 |
| 542 | Ga0500607_000065 | 3300053121 | Bacteria | 74437 |
| 543 | Ga0500607_000386 | 3300053121 | Bacteria | 42198 |
| 544 | Ga0500614_016829 | 3300053123 | Bacteria | 1646 |
| 545 | Ga0500618_013410 | 3300053125 | Bacteria | 2117 |
| 546 | Ga0500618_031599 | 3300053125 | Bacteria | 1241 |
| 547 | Ga0500642_0000574 | 3300053130 | Bacteria | 11074 |
| 548 | Ga0500655_000165 | 3300053133 | Bacteria | 16205 |
| 549 | Ga0500658_0007915 | 3300053134 | Bacteria | 3927 |
| 550 | Ga0500559_0000668 | 3300053136 | Bacteria | 22938 |
| 551 | Ga0500559_0012091 | 3300053136 | Bacteria | 3676 |
| 552 | Ga0500559_0013370 | 3300053136 | Bacteria | 3477 |
| 553 | Ga0500559_0059748 | 3300053136 | Bacteria | 1698 |
| 554 | Ga0500568_0026023 | 3300053139 | Bacteria | 2460 |
| 555 | Ga0500577_0012472 | 3300053142 | Bacteria | 2571 |
| 556 | Ga0500577_0120786 | 3300053142 | Bacteria | 1090 |
| 557 | Ga0500577_0132164 | 3300053142 | Bacteria | 1047 |
| 558 | Ga0500590_000953 | 3300053148 | Bacteria | 11128 |
| 559 | Ga0500616_0010849 | 3300053153 | Bacteria | 5431 |
| 560 | Ga0500616_0035196 | 3300053153 | Bacteria | 2724 |
| 561 | Ga0500616_0041068 | 3300053153 | Bacteria | 2484 |
| 562 | Ga0500616_0129036 | 3300053153 | Bacteria | 1197 |
| 563 | Ga0500616_0152766 | 3300053153 | Eukaryota | 1067 |
| 564 | Ga0500622_0002328 | 3300053156 | Bacteria | 13870 |
| 565 | Ga0500622_0034813 | 3300053156 | Bacteria | 2637 |
| 566 | Ga0500622_0132477 | 3300053156 | Bacteria | 1197 |
| 567 | Ga0500624_000012 | 3300053157 | Bacteria | 165895 |
| 568 | Ga0500624_000020 | 3300053157 | Bacteria | 118392 |
| 569 | Ga0500624_000061 | 3300053157 | Bacteria | 66422 |
| 570 | Ga0500627_0000013 | 3300053158 | Bacteria | 136204 |
| 571 | Ga0500639_096613 | 3300053163 | Bacteria | 1462 |
| 572 | Ga0500636_0001685 | 3300053177 | Bacteria | 12100 |
| 573 | Ga0500636_0041154 | 3300053177 | Bacteria | 2733 |
| 574 | Ga0500637_0000022 | 3300053178 | Bacteria | 61494 |
| 575 | Ga0500637_0006428 | 3300053178 | Bacteria | 5788 |
| 576 | Ga0500570_053881 | 3300053724 | Bacteria | 2000 |
| 577 | Ga0500645_020731 | 3300053730 | Bacteria | 2034 |
| 578 | Ga0500645_037940 | 3300053730 | Bacteria | 1430 |
| 579 | Ga0500661_004899 | 3300055283 | Bacteria | 2504 |
| 580 | Ga0466962_0011448 | 3300061719 | Bacteria | 4270 |
| 581 | 2511128233 | 2510917021 | Bacteria | 5705459 |
| 582 | 2512645509 | 2512564014 | Bacteria | 4639632 |
| 583 | 2585262113 | 2582581305 | Bacteria | 4895574 |
| 584 | 2585262301 | 2582581305 | Bacteria | 4895574 |
| 585 | 2600200538 | 2599185354 | Bacteria | 4398675 |
| 586 | 2643731408 | 2643221541 | Bacteria | 5498788 |
| 587 | 2643822632 | 2643221560 | Bacteria | 4801179 |
| 588 | 2643822876 | 2643221560 | Bacteria | 4801179 |
| 589 | 2643833855 | 2643221563 | Bacteria | 4726935 |
| 590 | 2644042264 | 2643221606 | Bacteria | 5588032 |
| 591 | 2644054781 | 2643221608 | Bacteria | 4724829 |
| 592 | 2644394094 | 2643221671 | Bacteria | 5496681 |
| 593 | 2809064602 | 2808606401 | Bacteria | 4586670 |
| 594 | 2809080487 | 2808606404 | Bacteria | 4652788 |
| 595 | 2809084851 | 2808606405 | Bacteria | 4586632 |
| 596 | 2819552183 | 2818991438 | Bacteria | 5793701 |
| 597 | 2830076898 | 2830075706 | Bacteria | 3855215 |
| 598 | 2852653561 | 2852653556 | Bacteria | 4050083 |
| 599 | 2852656830 | 2852653556 | Bacteria | 4050083 |
| 600 | 2852683846 | 2852680915 | Bacteria | 4100189 |
| 601 | 2852683925 | 2852680915 | Bacteria | 4100189 |
| 602 | 2909047266 | 2909042592 | Bacteria | 6499737 |
| 603 | 2928030365 | 2928027323 | Bacteria | 4382488 |
| 604 | 2928971819 | 2928968154 | Bacteria | 4633371 |
| 605 | 2946789654 | 2946787523 | Bacteria | 4366789 |
| 606 | 2984555766 | 2984555340 | Bacteria | 4247089 |
| 607 | 2984566124 | 2984564862 | Bacteria | 4339992 |
| 608 | 2990268660 | 2990265787 | Bacteria | 3943888 |
| 609 | 2993357136 | 2993356040 | Bacteria | 4247105 |
| 610 | 2993694634 | 2993693658 | Bacteria | 4040749 |
| 611 | 8054303857 | 8054302542 | Bacteria | 5698134 |
| 612 | 8057101691 | 8057101203 | Bacteria | 5034064 |
| 613 | Ga0495638_0000267 | |||
| 614 | SwRhRL2b_contig_2866031 | |||
| 615 | SwRhRL2b_contig_860484 | |||
| 616 | JGI24736J21556_1008730 | |||
| 617 | JGI24741J21665_1007135 | |||
| 618 | JGI24740J21852_10042393 | |||
| 619 | JGI24739J22299_10000601 | |||
| 620 | JGI24739J22299_10002449 | |||
| 621 | JGI24739J22299_10004424 | |||
| 622 | JGI24737J22298_10000720 | |||
| 623 | JGI24737J22298_10071114 | |||
| 624 | JGI24735J21928_10001166 | |||
| 625 | JGI24735J21928_10008108 | |||
| 626 | JGI24735J21928_10027700 | |||
| 627 | JGI24735J21928_10034178 | |||
| 628 | JGI24738J21930_10000330 | |||
| 629 | JGI24738J21930_10000338 | |||
| 630 | JGI24738J21930_10000440 | |||
| 631 | JGI24738J21930_10010342 | |||
| 632 | JGI24744J21845_10004368 | |||
| 633 | JGI24751J29686_10001912 | |||
| 634 | JGI25157J39369_1018117 | |||
| 635 | JGI25150J39212_1000020 | |||
| 636 | JGI25165J46597_1000073 | |||
| 637 | JGI25165J46597_1000188 | |||
| 638 | JGI25153J46596_10000017 | |||
| 639 | rootL2_10165951 | |||
| 640 | Ga0055542_1004389 | |||
| 641 | Ga0055536_1000713 | |||
| 642 | Ga0055536_1011158 | |||
| 643 | Ga0055530_10005655 | |||
| 644 | Ga0055530_10008737 | |||
| 645 | Ga0055530_10044614 | |||
| 646 | Ga0055531_10003646 | |||
| 647 | Ga0055531_10022471 | |||
| 648 | Ga0055531_10045466 | |||
| 649 | Ga0055531_10046828 | |||
| 650 | Ga0065165_1004847 | |||
| 651 | Ga0065704_10000192 | |||
| 652 | Ga0065704_10006257 | |||
| 653 | Ga0065704_10111589 | |||
| 654 | Ga0065707_10101327 | |||
| 655 | Ga0070658_10033853 | |||
| 656 | Ga0070658_10041598 | |||
| 657 | Ga0070658_10358454 | |||
| 658 | Ga0070658_10528373 | |||
| 659 | Ga0070676_10002175 | |||
| 660 | Ga0068869_100000848 | |||
| 661 | Ga0070666_10040596 | |||
| 662 | Ga0068868_100000154 | |||
| 663 | Ga0068868_100147581 | |||
| 664 | Ga0070660_100000544 | |||
| 665 | Ga0070660_100174061 | |||
| 666 | Ga0070660_100211179 | |||
| 667 | Ga0070660_100409501 | |||
| 668 | Ga0070660_100438185 | |||
| 669 | Ga0070661_100092363 | |||
| 670 | Ga0070668_100615823 | |||
| 671 | Ga0070673_100000023 | |||
| 672 | Ga0070659_100059344 | |||
| 673 | Ga0070659_100059457 | |||
| 674 | Ga0070659_100066008 | |||
| 675 | Ga0070659_100075161 | |||
| 676 | Ga0070659_100663842 | |||
| 677 | Ga0070667_100001100 | |||
| 678 | Ga0070663_100001998 | |||
| 679 | Ga0070678_100054021 | |||
| 680 | Ga0070662_100002062 | |||
| 681 | Ga0070662_100081846 | |||
| 682 | Ga0070662_100131072 | |||
| 683 | Ga0070681_10094688 | |||
| 684 | Ga0068867_100000007 | |||
| 685 | Ga0070684_100180891 | |||
| 686 | Ga0068853_100023296 | |||
| 687 | Ga0068853_100025947 | |||
| 688 | Ga0068853_100069304 | |||
| 689 | Ga0070672_100042427 | |||
| 690 | Ga0070693_100281806 | |||
| 691 | Ga0070665_100004652 | |||
| 692 | Ga0068855_100000029 | |||
| 693 | Ga0068855_100001148 | |||
| 694 | Ga0068855_100191725 | |||
| 695 | Ga0068855_100449801 | |||
| 696 | Ga0070664_100424026 | |||
| 697 | Ga0068857_100055573 | |||
| 698 | Ga0068854_100000027 | |||
| 699 | Ga0068854_100066764 | |||
| 700 | Ga0068854_100154085 | |||
| 701 | Ga0068854_100218332 | |||
| 702 | Ga0068856_100004098 | |||
| 703 | Ga0068852_100004278 | |||
| 704 | Ga0068852_100006260 | |||
| 705 | Ga0068852_100025178 | |||
| 706 | Ga0068852_100129866 | |||
| 707 | Ga0068852_100182937 | |||
| 708 | Ga0068864_100002125 | |||
| 709 | Ga0068866_10012667 | |||
| 710 | Ga0068858_100000228 | |||
| 711 | Ga0068858_100001700 | |||
| 712 | Ga0068860_100286162 | |||
| 713 | Ga0075365_10178714 | |||
| 714 | Ga0075368_10000055 | |||
| 715 | Ga0075368_10000168 | |||
| 716 | Ga0075368_10000967 | |||
| 717 | Ga0075368_10032193 | |||
| 718 | Ga0075363_100006130 | |||
| 719 | Ga0075363_100017846 | |||
| 720 | Ga0075363_100096373 | |||
| 721 | Ga0075364_10206394 | |||
| 722 | Ga0075362_10002811 | |||
| 723 | Ga0075362_10034881 | |||
| 724 | Ga0075367_10000109 | |||
| 725 | Ga0075367_10000289 | |||
| 726 | Ga0075367_10006417 | |||
| 727 | Ga0075367_10049680 | |||
| 728 | Ga0075369_10095090 | |||
| 729 | Ga0075369_10155901 | |||
| 730 | Ga0075366_10037690 | |||
| 731 | Ga0075366_10076800 | |||
| 732 | Ga0075366_10143533 | |||
| 733 | Ga0097621_100002061 | |||
| 734 | Ga0075370_10000257 | |||
| 735 | Ga0075370_10026515 | |||
| 736 | Ga0075370_10050753 | |||
| 737 | Ga0075370_10085395 | |||
| 738 | Ga0075370_10125899 | |||
| 739 | Ga0068871_100002074 | |||
| 740 | Ga0068865_100000010 | |||
| 741 | Ga0105240_10013748 | |||
| 742 | Ga0105240_10017476 | |||
| 743 | Ga0105240_10070818 | |||
| 744 | Ga0105240_10304868 | |||
| 745 | Ga0105245_10002089 | |||
| 746 | Ga0105245_10009485 | |||
| 747 | Ga0114129_10149346 | |||
| 748 | Ga0105243_10000950 | |||
| 749 | Ga0105243_10056170 | |||
| 750 | Ga0105243_10294328 | |||
| 751 | Ga0105243_10715950 | |||
| 752 | Ga0105241_10045550 | |||
| 753 | Ga0105241_10415116 | |||
| 754 | Ga0105242_10000210 | |||
| 755 | Ga0105248_10010320 | |||
| 756 | Ga0105248_10017254 | |||
| 757 | Ga0105237_10010097 | |||
| 758 | Ga0105237_10051294 | |||
| 759 | Ga0105237_10458234 | |||
| 760 | Ga0105237_10585404 | |||
| 761 | Ga0105238_10027777 | |||
| 762 | Ga0105238_10226524 | |||
| 763 | Ga0105238_10473056 | |||
| 764 | Ga0105249_10017303 | |||
| 765 | Ga0105148_100253 | |||
| 766 | Ga0105239_10000025 | |||
| 767 | Ga0105239_10004123 | |||
| 768 | Ga0105239_10031481 | |||
| 769 | Ga0105239_10046782 | |||
| 770 | Ga0105246_10000472 | |||
| 771 | Ga0157373_10047916 | |||
| 772 | Ga0157373_10084627 | |||
| 773 | Ga0157373_10264350 | |||
| 774 | Ga0157371_10211638 | |||
| 775 | Ga0157370_10000203 | |||
| 776 | Ga0157370_10074058 | |||
| 777 | Ga0157369_10057364 | |||
| 778 | Ga0157369_10203149 | |||
| 779 | Ga0157369_10511326 | |||
| 780 | Ga0157374_10000830 | |||
| 781 | Ga0157374_10045139 | |||
| 782 | Ga0157374_10071508 | |||
| 783 | Ga0157374_10103118 | |||
| 784 | Ga0157378_10001477 | |||
| 785 | Ga0157378_10084028 | |||
| 786 | Ga0157378_10166335 | |||
| 787 | Ga0163162_10001078 | |||
| 788 | Ga0163162_10446220 | |||
| 789 | Ga0157372_10010036 | |||
| 790 | Ga0157372_10058023 | |||
| 791 | Ga0157372_10179976 | |||
| 792 | Ga0157372_10339814 | |||
| 793 | Ga0157375_10002120 | |||
| 794 | Ga0157376_10000047 | |||
| 795 | Ga0183363_1002 | |||
| 796 | Ga0163161_10013007 | |||
| 797 | Ga0207427_101974 | |||
| 798 | Ga0207425_1000022 | |||
| 799 | Ga0209646_1021491 | |||
| 800 | Ga0209026_1002441 | |||
| 801 | Ga0209026_1004353 | |||
| 802 | Ga0209148_1000061 | |||
| 803 | Ga0209148_1001013 | |||
| 804 | Ga0209129_1000286 | |||
| 805 | Ga0209233_1000120 | |||
| 806 | Ga0209233_1000142 | |||
| 807 | Ga0209565_1007352 | |||
| 808 | Ga0209455_1000692 | |||
| 809 | Ga0209675_1000126 | |||
| 810 | Ga0209676_1000566 | |||
| 811 | Ga0209676_1008708 | |||
| 812 | Ga0209676_1009141 | |||
| 813 | Ga0209676_1026483 | |||
| 814 | Ga0209025_1001464 | |||
| 815 | Ga0209025_1019511 | |||
| 816 | Ga0209025_1075443 | |||
| 817 | Ga0209758_1000004 | |||
| 818 | Ga0209050_1000001 | |||
| 819 | Ga0209050_1000047 | |||
| 820 | Ga0209050_1000127 | |||
| 821 | Ga0209051_1000246 | |||
| 822 | Ga0209257_1000517 | |||
| 823 | Ga0209257_1002394 | |||
| 824 | Ga0209257_1002888 | |||
| 825 | Ga0209257_1010863 | |||
| 826 | Ga0209257_1030916 | |||
| 827 | Ga0207697_10086321 | |||
| 828 | Ga0207656_10059287 | |||
| 829 | Ga0207642_10007810 | |||
| 830 | Ga0207688_10080907 | |||
| 831 | Ga0207680_10022733 | |||
| 832 | Ga0207647_10000270 | |||
| 833 | Ga0207647_10016335 | |||
| 834 | Ga0207647_10017291 | |||
| 835 | Ga0207647_10051484 | |||
| 836 | Ga0207647_10054292 | |||
| 837 | Ga0207647_10065747 | |||
| 838 | Ga0207645_10029542 | |||
| 839 | Ga0207705_10000316 | |||
| 840 | Ga0207705_10000963 | |||
| 841 | Ga0207705_10009514 | |||
| 842 | Ga0207705_10369159 | |||
| 843 | Ga0207705_10525168 | |||
| 844 | Ga0207654_10342347 | |||
| 845 | Ga0207695_10008358 | |||
| 846 | Ga0207695_10041776 | |||
| 847 | Ga0207695_10057479 | |||
| 848 | Ga0207671_10002163 | |||
| 849 | Ga0207671_10098859 | |||
| 850 | Ga0207671_10107147 | |||
| 851 | Ga0207657_10003918 | |||
| 852 | Ga0207657_10049263 | |||
| 853 | Ga0207657_10057737 | |||
| 854 | Ga0207649_10067641 | |||
| 855 | Ga0207681_10047485 | |||
| 856 | Ga0207694_10217153 | |||
| 857 | Ga0207650_10203060 | |||
| 858 | Ga0207687_10006744 | |||
| 859 | Ga0207687_10027727 | |||
| 860 | Ga0207644_10224943 | |||
| 861 | Ga0207690_10077238 | |||
| 862 | Ga0207690_10123350 | |||
| 863 | Ga0207690_10207593 | |||
| 864 | Ga0207690_10227985 | |||
| 865 | Ga0207690_10430273 | |||
| 866 | Ga0207706_10004159 | |||
| 867 | Ga0207706_10019782 | |||
| 868 | Ga0207706_10103379 | |||
| 869 | Ga0207709_10000050 | |||
| 870 | Ga0207704_10000020 | |||
| 871 | Ga0207711_10005221 | |||
| 872 | Ga0207711_10056418 | |||
| 873 | Ga0207689_10001541 | |||
| 874 | Ga0207661_10055536 | |||
| 875 | Ga0207667_10000035 | |||
| 876 | Ga0207667_10004932 | |||
| 877 | Ga0207667_10075657 | |||
| 878 | Ga0207667_10131103 | |||
| 879 | Ga0207667_10697721 | |||
| 880 | Ga0207651_10000005 | |||
| 881 | Ga0207712_10097162 | |||
| 882 | Ga0207668_10273471 | |||
| 883 | Ga0207640_10000145 | |||
| 884 | Ga0207640_10056590 | |||
| 885 | Ga0207640_10059222 | |||
| 886 | Ga0207640_10332653 | |||
| 887 | Ga0207658_10000571 | |||
| 888 | Ga0207677_10000373 | |||
| 889 | Ga0207703_10000976 | |||
| 890 | Ga0207703_10004598 | |||
| 891 | Ga0207639_10002511 | |||
| 892 | Ga0207639_10007809 | |||
| 893 | Ga0207639_10332655 | |||
| 894 | Ga0207678_10005889 | |||
| 895 | Ga0207678_10249930 | |||
| 896 | Ga0207678_10320657 | |||
| 897 | Ga0207702_10003711 | |||
| 898 | Ga0207702_10012620 | |||
| 899 | Ga0207702_10037699 | |||
| 900 | Ga0207702_10245821 | |||
| 901 | Ga0207648_10000017 | |||
| 902 | Ga0207676_10000190 | |||
| 903 | Ga0207676_10348384 | |||
| 904 | Ga0207674_10015748 | |||
| 905 | Ga0207674_10022819 | |||
| 906 | Ga0207674_10776312 | |||
| 907 | Ga0207674_10892142 | |||
| 908 | Ga0207683_10029414 | |||
| 909 | Ga0207698_10000712 | |||
| 910 | Ga0207698_10036634 | |||
| 911 | Ga0207698_10036776 | |||
| 912 | Ga0207698_10038607 | |||
| 913 | Ga0207698_10713009 | |||
| 914 | Ga0209813_10000048 | |||
| 915 | Ga0209813_10000191 | |||
| 916 | Ga0209813_10000220 | |||
| 917 | Ga0268266_10889770 | |||
| 918 | Ga0268264_10245060 | |||
| 919 | Ga0307517_10026027 | |||
| 920 | Ga0307513_10061622 | |||
| 921 | Ga0307513_10256515 | |||
| 922 | Ga0307508_10004238 | |||
| 923 | Ga0307510_10191540 | |||
| 924 | Ga0373946_0289600 | |||
| 925 | Ga0395899_0002116 | |||
| 926 | Ga0395899_0317704 | |||
| 927 | Ga0395900_0260720 | |||
| 928 | Ga0395905_0497526 | |||
| 929 | Ga0436364_1389735 | |||
| 930 | Ga0395901_0245370 | |||
| 931 | Ga0436365_1211005 | |||
| 932 | Ga0436363_0389907 | |||
| 933 | Ga0451802_0044966 | |||
| 934 | Ga0451806_660356 | |||
| 935 | Ga0451804_0756293 | |||
| 936 | Ga0451807_2284404 | |||
| 937 | Ga0451853_1879690 | |||
| 938 | Ga0439448_0002573 | |||
| 939 | Ga0439448_0003494 | |||
| 940 | Ga0439448_0027604 | |||
| 941 | Ga0439448_0038338 | |||
| 942 | Ga0439455_0000252 | |||
| 943 | Ga0439455_0000304 | |||
| 944 | Ga0439455_0054729 | |||
| 945 | Ga0439458_0000255 | |||
| 946 | Ga0439458_0000305 | |||
| 947 | Ga0439458_0026115 | |||
| 948 | Ga0466972_0274254 | |||
| 949 | Ga0466966_0019647 | |||
| 950 | Ga0466963_0008961 | |||
| 951 | Ga0466964_0012394 | |||
| 952 | Ga0466964_0018224 | |||
| 953 | Ga0466971_0000834 | |||
| 954 | Ga0466968_0054687 | |||
| 955 | Ga0466970_0012023 | |||
| 956 | Ga0466957_0274396 | |||
| 957 | Ga0466960_0014885 | |||
| 958 | Ga0495627_000582 | |||
| 959 | Ga0495629_0157525 | |||
| 960 | Ga0495638_0080909 | |||
| 961 | Ga0495638_0144399 | |||
| 962 | Ga0495638_0156654 | |||
| 963 | Ga0495650_0001090 | |||
| 964 | Ga0495650_0049328 | |||
| 965 | Ga0495605_0069453 | |||
| 966 | Ga0495584_0014651 | |||
| 967 | Ga0495596_0000196 | |||
| 968 | Ga0495596_0000537 | |||
| 969 | Ga0495607_0016964 | |||
| 970 | Ga0495607_0047613 | |||
| 971 | Ga0495583_0000030 | |||
| 972 | Ga0495583_0000252 | |||
| 973 | Ga0495606_0044223 | |||
| 974 | Ga0495606_0116794 | |||
| 975 | Ga0495610_0000081 | |||
| 976 | Ga0495610_0001175 | |||
| 977 | Ga0495610_0003890 | |||
| 978 | Ga0495610_0027251 | |||
| 979 | Ga0495610_0047804 | |||
| 980 | Ga0495620_0013539 | |||
| 981 | Ga0495632_0000007 | |||
| 982 | Ga0495632_0000306 | |||
| 983 | Ga0495632_0027007 | |||
| 984 | Ga0495637_0000569 | |||
| 985 | Ga0495637_0033327 | |||
| 986 | Ga0495637_0077167 | |||
| 987 | Ga0495643_0000042 | |||
| 988 | Ga0495643_0000304 | |||
| 989 | Ga0495643_0007419 | |||
| 990 | Ga0495643_0021213 | |||
| 991 | Ga0495648_0037584 | |||
| 992 | Ga0495663_0000005 | |||
| 993 | Ga0495663_0018295 | |||
| 994 | Ga0495654_0034814 | |||
| 995 | Ga0495654_0043751 | |||
| 996 | Ga0495609_0007089 | |||
| 997 | Ga0495622_0006810 | |||
| 998 | Ga0495633_0000491 | |||
| 999 | Ga0495633_0001879 | |||
| 1000 | Ga0495668_0000001 | |||
| 1001 | Ga0495611_0098653 | |||
| 1002 | Ga0495611_0256250 | |||
| 1003 | Ga0495625_0000671 | |||
| 1004 | Ga0495625_0002401 | |||
| 1005 | Ga0495625_0035771 | |||
| 1006 | Ga0495625_0050839 | |||
| 1007 | Ga0495625_0057335 | |||
| 1008 | Ga0495625_0063243 | |||
| 1009 | Ga0495625_0085854 | |||
| 1010 | Ga0495661_0033156 | |||
| 1011 | Ga0495670_0013380 | |||
| 1012 | Ga0495670_0028819 | |||
| 1013 | Ga0495670_0243820 | |||
| 1014 | Ga0495671_0000011 | |||
| 1015 | Ga0495671_0000126 | |||
| 1016 | Ga0495671_0042256 | |||
| 1017 | Ga0495671_0115065 | |||
| 1018 | Ga0495671_0123561 | |||
| 1019 | Ga0495676_0203871 | |||
| 1020 | Ga0495677_0034004 | |||
| 1021 | Ga0495673_0000013 | |||
| 1022 | Ga0495681_0000517 | |||
| 1023 | Ga0495681_0002422 | |||
| 1024 | Ga0495681_0041330 | |||
| 1025 | Ga0495686_0000063 | |||
| 1026 | Ga0495686_0000082 | |||
| 1027 | Ga0495686_0000401 | |||
| 1028 | Ga0495686_0000661 | |||
| 1029 | Ga0495686_0009632 | |||
| 1030 | Ga0495686_0020603 | |||
| 1031 | Ga0495686_0027175 | |||
| 1032 | Ga0495686_0082333 | |||
| 1033 | Ga0495686_0104101 | |||
| 1034 | Ga0495615_0000020 | |||
| 1035 | Ga0495626_0000298 | |||
| 1036 | Ga0496102_0197094 | |||
| 1037 | Ga0496102_0586199 | |||
| 1038 | Ga0496103_0348167 | |||
| 1039 | Ga0496110_0050768 | |||
| 1040 | Ga0496110_0609108 | |||
| 1041 | Ga0496111_0033642 | |||
| 1042 | Ga0496111_0107898 | |||
| 1043 | Ga0496111_0413687 | |||
| 1044 | Ga0496113_0092142 | |||
| 1045 | Ga0496115_0000285 | |||
| 1046 | Ga0496116_0000035 | |||
| 1047 | Ga0496116_0047806 | |||
| 1048 | Ga0496117_0011402 | |||
| 1049 | Ga0496117_0043351 | |||
| 1050 | Ga0496117_0047825 | |||
| 1051 | Ga0496117_0057221 | |||
| 1052 | Ga0496117_0119468 | |||
| 1053 | Ga0496118_0015807 | |||
| 1054 | Ga0496118_0030413 | |||
| 1055 | Ga0496118_0035164 | |||
| 1056 | Ga0496118_0036903 | |||
| 1057 | Ga0496118_0139977 | |||
| 1058 | Ga0496119_0033280 | |||
| 1059 | Ga0496119_0052623 | |||
| 1060 | Ga0496120_0102515 | |||
| 1061 | Ga0496121_0000105 | |||
| 1062 | Ga0496121_0000579 | |||
| 1063 | Ga0496121_0000671 | |||
| 1064 | Ga0496121_0002960 | |||
| 1065 | Ga0496121_0002979 | |||
| 1066 | Ga0496121_0003092 | |||
| 1067 | Ga0496121_0003231 | |||
| 1068 | Ga0496121_0030578 | |||
| 1069 | Ga0496122_0005685 | |||
| 1070 | Ga0496122_0018901 | |||
| 1071 | Ga0496122_0026933 | |||
| 1072 | Ga0496123_0000159 | |||
| 1073 | Ga0496123_0002459 | |||
| 1074 | Ga0496123_0003542 | |||
| 1075 | Ga0496123_0003707 | |||
| 1076 | Ga0496124_0002365 | |||
| 1077 | Ga0496124_0005911 | |||
| 1078 | Ga0496124_0015727 | |||
| 1079 | Ga0496124_0030523 | |||
| 1080 | Ga0496124_0038486 | |||
| 1081 | Ga0496124_0046585 | |||
| 1082 | Ga0496124_0067837 | |||
| 1083 | Ga0496124_0090965 | |||
| 1084 | Ga0496124_0155365 | |||
| 1085 | Ga0496124_0235082 | |||
| 1086 | Ga0496124_0262178 | |||
| 1087 | Ga0496125_0012910 | |||
| 1088 | Ga0496125_0031437 | |||
| 1089 | Ga0496125_0040553 | |||
| 1090 | Ga0496125_0121127 | |||
| 1091 | Ga0496125_0215487 | |||
| 1092 | Ga0496126_0000077 | |||
| 1093 | Ga0496126_0001878 | |||
| 1094 | Ga0496126_0014533 | |||
| 1095 | Ga0496126_0058122 | |||
| 1096 | Ga0496126_0112148 | |||
| 1097 | Ga0496126_0196016 | |||
| 1098 | Ga0496126_0320266 | |||
| 1099 | Ga0495682_0125592 | |||
| 1100 | Ga0501033_0000215 | |||
| 1101 | Ga0501036_0095571 | |||
| 1102 | Ga0501037_0145969 | |||
| 1103 | Ga0501038_0106928 | |||
| 1104 | Ga0501043_0072900 | |||
| 1105 | Ga0501047_0001117 | |||
| 1106 | Ga0501047_0009954 | |||
| 1107 | Ga0501073_0212203 | |||
| 1108 | Ga0501211_001344 | |||
| 1109 | Ga0501223_000064 | |||
| 1110 | Ga0501235_001360 | |||
| 1111 | Ga0501225_0000063 | |||
| 1112 | Ga0501245_005207 | |||
| 1113 | Ga0501044_0000160 | |||
| 1114 | Ga0501044_0079519 | |||
| 1115 | Ga0501044_0256729 | |||
| 1116 | nmdc:mga03683_10661_c1 | |||
| 1117 | nmdc:mga03683_16551_c1 | |||
| 1118 | nmdc:mga03683_927_c1 | |||
| 1119 | nmdc:mga03n38_30348_c1 | |||
| 1120 | nmdc:mga03n38_82620_c1 | |||
| 1121 | nmdc:mga00v17_11965_c1 | |||
| 1122 | nmdc:mga00v17_1563_c1 | |||
| 1123 | nmdc:mga00v17_3583_c1 | |||
| 1124 | nmdc:mga0yw44_158276_c1 | |||
| 1125 | nmdc:mga0yw44_330966_c1 | |||
| 1126 | nmdc:mga0k408_149619_c1 | |||
| 1127 | nmdc:mga0k408_3784_c1 | |||
| 1128 | nmdc:mga0k408_39900_c2 | |||
| 1129 | nmdc:mga06z11_117_c1 | |||
| 1130 | nmdc:mga06z11_295_c1 | |||
| 1131 | nmdc:mga04h51_162_c1 | |||
| 1132 | nmdc:mga04h51_178_c1 | |||
| 1133 | nmdc:mga04h51_29230_c1 | |||
| 1134 | nmdc:mga04h51_656_c1 | |||
| 1135 | nmdc:mga07m45_21157_c1 | |||
| 1136 | nmdc:mga07m45_22_c1 | |||
| 1137 | nmdc:mga07m45_40998_c1 | |||
| 1138 | nmdc:mga07m45_70616_c1 | |||
| 1139 | nmdc:mga07m45_9859_c1 | |||
| 1140 | nmdc:mga05p37_127775_c1 | |||
| 1141 | nmdc:mga0sz30_144328_c1 | |||
| 1142 | nmdc:mga0sz30_48389_c1 | |||
| 1143 | nmdc:mga0sz30_714_c2 | |||
| 1144 | Ga0495619_0384861 | |||
| 1145 | Ga0500643_000385 | |||
| 1146 | Ga0500643_002094 | |||
| 1147 | Ga0500647_0066437 | |||
| 1148 | Ga0500651_0345311 | |||
| 1149 | Ga0500641_0061888 | |||
| 1150 | Ga0500555_000163 | |||
| 1151 | Ga0500592_001641 | |||
| 1152 | Ga0500594_0009144 | |||
| 1153 | Ga0500597_019103 | |||
| 1154 | Ga0500607_000065 | |||
| 1155 | Ga0500607_000386 | |||
| 1156 | Ga0500614_016829 | |||
| 1157 | Ga0500618_013410 | |||
| 1158 | Ga0500618_031599 | |||
| 1159 | Ga0500642_0000574 | |||
| 1160 | Ga0500655_000165 | |||
| 1161 | Ga0500658_0007915 | |||
| 1162 | Ga0500559_0000668 | |||
| 1163 | Ga0500559_0012091 | |||
| 1164 | Ga0500559_0013370 | |||
| 1165 | Ga0500559_0059748 | |||
| 1166 | Ga0500568_0026023 | |||
| 1167 | Ga0500577_0012472 | |||
| 1168 | Ga0500577_0120786 | |||
| 1169 | Ga0500577_0132164 | |||
| 1170 | Ga0500590_000953 | |||
| 1171 | Ga0500616_0010849 | |||
| 1172 | Ga0500616_0035196 | |||
| 1173 | Ga0500616_0041068 | |||
| 1174 | Ga0500616_0129036 | |||
| 1175 | Ga0500616_0152766 | |||
| 1176 | Ga0500622_0002328 | |||
| 1177 | Ga0500622_0034813 | |||
| 1178 | Ga0500622_0132477 | |||
| 1179 | Ga0500624_000012 | |||
| 1180 | Ga0500624_000020 | |||
| 1181 | Ga0500624_000061 | |||
| 1182 | Ga0500627_0000013 | |||
| 1183 | Ga0500639_096613 | |||
| 1184 | Ga0500636_0001685 | |||
| 1185 | Ga0500636_0041154 | |||
| 1186 | Ga0500637_0000022 | |||
| 1187 | Ga0500637_0006428 | |||
| 1188 | Ga0500570_053881 | |||
| 1189 | Ga0500645_020731 | |||
| 1190 | Ga0500645_037940 | |||
| 1191 | Ga0500661_004899 | |||
| 1192 | Ga0466962_0011448 | |||
| 1193 | 2511128233 | |||
| 1194 | 2512645509 | |||
| 1195 | 2585262113 | |||
| 1196 | 2585262301 | |||
| 1197 | 2600200538 | |||
| 1198 | 2643731408 | |||
| 1199 | 2643822632 | |||
| 1200 | 2643822876 | |||
| 1201 | 2643833855 | |||
| 1202 | 2644042264 | |||
| 1203 | 2644054781 | |||
| 1204 | 2644394094 | |||
| 1205 | 2809064602 | |||
| 1206 | 2809080487 | |||
| 1207 | 2809084851 | |||
| 1208 | 2819552183 | |||
| 1209 | 2830076898 | |||
| 1210 | 2852653561 | |||
| 1211 | 2852656830 | |||
| 1212 | 2852683846 | |||
| 1213 | 2852683925 | |||
| 1214 | 2909047266 | |||
| 1215 | 2928030365 | |||
| 1216 | 2928971819 | |||
| 1217 | 2946789654 | |||
| 1218 | 2984555766 | |||
| 1219 | 2984566124 | |||
| 1220 | 2990268660 | |||
| 1221 | 2993357136 | |||
| 1222 | 2993694634 | |||
| 1223 | 8054303857 | |||
| 1224 | 8057101691 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4bnd-assembly2.cif.gz_B | structure of an atypical alpha-phosphoglucomutase similar to eukaryotic phosphomannomutases | 0.9199 | 42 | 287 |
| 4bnd-assembly2.cif.gz_A | structure of an atypical alpha-phosphoglucomutase similar to eukaryotic phosphomannomutases | 0.9193 | 42 | 287 |
| 4bnd-assembly2.cif.gz_A | structure of an atypical alpha-phosphoglucomutase similar to eukaryotic phosphomannomutases | 0.8953 | 42 | 287 |
| 4bnd-assembly2.cif.gz_B | structure of an atypical alpha-phosphoglucomutase similar to eukaryotic phosphomannomutases | 0.8925 | 42 | 287 |
| 2no5-assembly1.cif.gz_B | crystal structure analysis of a dehalogenase with intermediate complex | 0.7985 | 228 | 271 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4bndA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.9734 | 42 | 287 | 3.40.50.1000 |
| 4bndA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.949 | 42 | 287 | 3.40.50.1000 |
| 4bndB02 | Alpha Beta;2-Layer Sandwich;Hypothetical Protein, Haloacid Dehalogenase-like Hydrolase; Chain: A; domain 2;Eukaryotic phosphomannomutase, cap domain | 0.928 | 132 | 223 | 3.30.1240.20 |
| 4bndB02 | Alpha Beta;2-Layer Sandwich;Hypothetical Protein, Haloacid Dehalogenase-like Hydrolase; Chain: A; domain 2;Eukaryotic phosphomannomutase, cap domain | 0.8822 | 132 | 223 | 3.30.1240.20 |
| 6cfsA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.8564 | 43 | 284 | 3.40.50.1000 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5N6KS71-F1-model_v4 | Phosphomannomutase (EC 5.4.2.8) | 0.9972 | 42 | 290 |
GO:0004615
GO:0005829 GO:0006013 GO:0006487 GO:0009298 GO:0046872 |
| AF-A0A2A2K688-F1-model_v4 | phosphomannomutase (EC 5.4.2.8) | 0.9951 | 66 | 288 |
GO:0004615
GO:0005737 GO:0009298 GO:0046872 |
| AF-D4D4Z5-F1-model_v4 | phosphomannomutase (EC 5.4.2.8) | 0.9892 | 42 | 288 |
GO:0004615
GO:0005737 GO:0009298 GO:0046872 |
| AF-A0A520IRZ7-F1-model_v4 | HAD family hydrolase | 0.9889 | 42 | 127 |
|
| AF-A0A1J9RXN2-F1-model_v4 | Phosphomannomutase (EC 5.4.2.8) | 0.9828 | 42 | 290 |
GO:0004615
GO:0005829 GO:0006013 GO:0006487 GO:0009298 GO:0046872 |