F469176

General Info

Members Datasets Scaffolds Average Seq Length
612 312 1224 249

Family's Representative Sequence

Representative Sequence 3300046460|Ga0495638_0000267|Ga0495638_0000267_27838_28698
Length 286
Sequence MRFHNGSIEVWNYGGTSDGIGRLHPVSLHRGRTLFQEHGMKQLVAFDLDGTLAESKQPLREPMGDALADLLGVAHVAVISGGDWPQFEKQVASRLPARADLTRLWLMPTTGTKLYRYDGAWSAVYAELFDDAQKQAIFAAFDESLKATGFVPEQTWGERIEDRGSQITFSALGQQAPLDAKEHWDPDFAKRKVIQVDLRKRLPGLSINMGGATSIDITREGVDKAYGLKKLRDASGIELDAMMFIGDAIFPGGNDYPAKELGLDTVRVRDPEETLSVIAAIVACQK

Samples

Sample ID Description Type Environment
1 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
10 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
11 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
12 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
13 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
14 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
15 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
16 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
17 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
18 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
19 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
20 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
23 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
56 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
57 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
93 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
94 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
95 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
96 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
98 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
99 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
104 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
105 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
153 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
154 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
155 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
156 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
157 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
158 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
159 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
160 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
161 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
162 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
163 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
164 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
165 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
166 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
167 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
168 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
169 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
170 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
171 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
172 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
173 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
174 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
175 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
176 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
177 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
178 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
179 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
180 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
181 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
182 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
183 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
184 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
185 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
186 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
187 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
188 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
189 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
190 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
191 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
192 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
193 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
194 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
195 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
196 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
197 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
198 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
199 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
200 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
201 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
202 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
203 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
204 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
205 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
206 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
207 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
208 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
209 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
210 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
211 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
212 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
213 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
214 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
215 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
216 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
217 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
218 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
219 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
220 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
221 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
222 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
223 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
224 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
225 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
226 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
227 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
228 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
229 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
230 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
231 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
232 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
239 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
240 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
241 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
242 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
243 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
244 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
245 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
246 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
247 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
248 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
249 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
250 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
251 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
252 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
253 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
254 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
255 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
256 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
257 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
258 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
259 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
260 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
261 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
262 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
263 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
264 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
265 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
266 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
267 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
268 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
269 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
270 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
271 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
272 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
273 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
274 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
275 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
276 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
277 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
278 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
279 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
280 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
281 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
282 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
283 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
284 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
285 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
286 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
287 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
288 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
289 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
290 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
291 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
292 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
293 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
294 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
295 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
296 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
297 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
298 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
299 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
300 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
301 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
302 2909042592 Labrys sp. LIt4 Isolate Nodule
303 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
304 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
305 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
306 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
307 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
308 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
309 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
310 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
311 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere
312 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.77
Metatranscriptomes 0
Isolates 5.23

Biome Distribution

Category Percentage (%)
Aerial Root 0.82
Bulb 0
Endosphere 23.53
Nodule 0.16
Rhizoplane 2.45
Rhizosphere 60.46
Stem 0
Stem Tuber 0
Unclassified 0.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495638_0000267 3300046460 Bacteria 70470
2 SwRhRL2b_contig_2866031 2162886007 Bacteria 47061
3 SwRhRL2b_contig_860484 2162886007 Bacteria 1628
4 JGI24736J21556_1008730 3300001904 Bacteria 1681
5 JGI24741J21665_1007135 3300001915 Bacteria 2188
6 JGI24740J21852_10042393 3300001979 Bacteria 1364
7 JGI24739J22299_10000601 3300001989 Bacteria 12967
8 JGI24739J22299_10002449 3300001989 Bacteria 7159
9 JGI24739J22299_10004424 3300001989 Bacteria 5384
10 JGI24737J22298_10000720 3300001990 Bacteria 11643
11 JGI24737J22298_10071114 3300001990 Bacteria 1039
12 JGI24735J21928_10001166 3300002067 Bacteria 9407
13 JGI24735J21928_10008108 3300002067 Bacteria 3407
14 JGI24735J21928_10027700 3300002067 Bacteria 1697
15 JGI24735J21928_10034178 3300002067 Bacteria 1500
16 JGI24738J21930_10000330 3300002075 Bacteria 13051
17 JGI24738J21930_10000338 3300002075 Bacteria 12810
18 JGI24738J21930_10000440 3300002075 Bacteria 11750
19 JGI24738J21930_10010342 3300002075 Bacteria 2078
20 JGI24744J21845_10004368 3300002077 Bacteria 2921
21 JGI24751J29686_10001912 3300002459 Bacteria 4252
22 JGI25157J39369_1018117 3300002741 Bacteria 851
23 JGI25150J39212_1000020 3300002774 Bacteria 134928
24 JGI25165J46597_1000073 3300003214 Bacteria 192140
25 JGI25165J46597_1000188 3300003214 Bacteria 92329
26 JGI25153J46596_10000017 3300003215 Bacteria 274325
27 rootL2_10165951 3300003322 Bacteria 1372
28 Ga0055542_1004389 3300003762 Bacteria 3446
29 Ga0055536_1000713 3300003781 Bacteria 22261
30 Ga0055536_1011158 3300003781 Bacteria 3484
31 Ga0055530_10005655 3300003791 Bacteria 5854
32 Ga0055530_10008737 3300003791 Bacteria 4006
33 Ga0055530_10044614 3300003791 Bacteria 1062
34 Ga0055531_10003646 3300003794 Bacteria 9711
35 Ga0055531_10022471 3300003794 Bacteria 2402
36 Ga0055531_10045466 3300003794 Bacteria 1218
37 Ga0055531_10046828 3300003794 Bacteria 1184
38 Ga0065165_1004847 3300005262 Bacteria 7999
39 Ga0065704_10000192 3300005289 Bacteria 216848
40 Ga0065704_10006257 3300005289 Bacteria 2774
41 Ga0065704_10111589 3300005289 Bacteria 1950
42 Ga0065707_10101327 3300005295 Bacteria 2872
43 Ga0070658_10033853 3300005327 Bacteria 4111
44 Ga0070658_10041598 3300005327 Bacteria 3708
45 Ga0070658_10358454 3300005327 Bacteria 1249
46 Ga0070658_10528373 3300005327 Bacteria 1020
47 Ga0070676_10002175 3300005328 Bacteria 9989
48 Ga0068869_100000848 3300005334 Bacteria 17540
49 Ga0070666_10040596 3300005335 Bacteria 3106
50 Ga0068868_100000154 3300005338 Bacteria 44616
51 Ga0068868_100147581 3300005338 Bacteria 1935
52 Ga0070660_100000544 3300005339 Bacteria 25288
53 Ga0070660_100174061 3300005339 Bacteria 1740
54 Ga0070660_100211179 3300005339 Bacteria 1576
55 Ga0070660_100409501 3300005339 Bacteria 1122
56 Ga0070660_100438185 3300005339 Bacteria 1083
57 Ga0070661_100092363 3300005344 Bacteria 2242
58 Ga0070668_100615823 3300005347 Bacteria 951
59 Ga0070673_100000023 3300005364 Bacteria 91936
60 Ga0070659_100059344 3300005366 Bacteria 3021
61 Ga0070659_100059457 3300005366 Bacteria 3018
62 Ga0070659_100066008 3300005366 Bacteria 2867
63 Ga0070659_100075161 3300005366 Bacteria 2692
64 Ga0070659_100663842 3300005366 Bacteria 899
65 Ga0070667_100001100 3300005367 Bacteria 24778
66 Ga0070663_100001998 3300005455 Bacteria 11388
67 Ga0070678_100054021 3300005456 Bacteria 2924
68 Ga0070662_100002062 3300005457 Bacteria 12318
69 Ga0070662_100081846 3300005457 Bacteria 2406
70 Ga0070662_100131072 3300005457 Bacteria 1933
71 Ga0070681_10094688 3300005458 Bacteria 2935
72 Ga0068867_100000007 3300005459 Bacteria 148726
73 Ga0070684_100180891 3300005535 Bacteria 1917
74 Ga0068853_100023296 3300005539 Bacteria 5181
75 Ga0068853_100025947 3300005539 Bacteria 4918
76 Ga0068853_100069304 3300005539 Bacteria 3068
77 Ga0070672_100042427 3300005543 Bacteria 3503
78 Ga0070693_100281806 3300005547 Bacteria 1113
79 Ga0070665_100004652 3300005548 Bacteria 14330
80 Ga0068855_100000029 3300005563 Bacteria 171278
81 Ga0068855_100001148 3300005563 Bacteria 32786
82 Ga0068855_100191725 3300005563 Bacteria 2305
83 Ga0068855_100449801 3300005563 Bacteria 1406
84 Ga0070664_100424026 3300005564 Bacteria 1219
85 Ga0068857_100055573 3300005577 Bacteria 3513
86 Ga0068854_100000027 3300005578 Bacteria 117836
87 Ga0068854_100066764 3300005578 Bacteria 2619
88 Ga0068854_100154085 3300005578 Bacteria 1774
89 Ga0068854_100218332 3300005578 Bacteria 1507
90 Ga0068856_100004098 3300005614 Bacteria 14566
91 Ga0068852_100004278 3300005616 Bacteria 10072
92 Ga0068852_100006260 3300005616 Bacteria 8587
93 Ga0068852_100025178 3300005616 Bacteria 4818
94 Ga0068852_100129866 3300005616 Bacteria 2319
95 Ga0068852_100182937 3300005616 Bacteria 1972
96 Ga0068864_100002125 3300005618 Bacteria 16383
97 Ga0068866_10012667 3300005718 Bacteria 3680
98 Ga0068858_100000228 3300005842 Bacteria 60736
99 Ga0068858_100001700 3300005842 Bacteria 22479
100 Ga0068860_100286162 3300005843 Bacteria 1612
101 Ga0075365_10178714 3300006038 Bacteria 1483
102 Ga0075368_10000055 3300006042 Bacteria 27866
103 Ga0075368_10000168 3300006042 Bacteria 17741
104 Ga0075368_10000967 3300006042 Bacteria 8953
105 Ga0075368_10032193 3300006042 Bacteria 2035
106 Ga0075363_100006130 3300006048 Bacteria 5429
107 Ga0075363_100017846 3300006048 Bacteria 3527
108 Ga0075363_100096373 3300006048 Bacteria 1633
109 Ga0075364_10206394 3300006051 Bacteria 1332
110 Ga0075362_10002811 3300006177 Bacteria 5939
111 Ga0075362_10034881 3300006177 Bacteria 2195
112 Ga0075367_10000109 3300006178 Bacteria 23429
113 Ga0075367_10000289 3300006178 Bacteria 17620
114 Ga0075367_10006417 3300006178 Bacteria 5939
115 Ga0075367_10049680 3300006178 Bacteria 2473
116 Ga0075369_10095090 3300006186 Bacteria 1332
117 Ga0075369_10155901 3300006186 Bacteria 1045
118 Ga0075366_10037690 3300006195 Bacteria 2855
119 Ga0075366_10076800 3300006195 Bacteria 1993
120 Ga0075366_10143533 3300006195 Bacteria 1444
121 Ga0097621_100002061 3300006237 Bacteria 13748
122 Ga0075370_10000257 3300006353 Bacteria 18995
123 Ga0075370_10026515 3300006353 Bacteria 3211
124 Ga0075370_10050753 3300006353 Bacteria 2353
125 Ga0075370_10085395 3300006353 Bacteria 1817
126 Ga0075370_10125899 3300006353 Bacteria 1493
127 Ga0068871_100002074 3300006358 Bacteria 13555
128 Ga0068865_100000010 3300006881 Bacteria 159548
129 Ga0105240_10013748 3300009093 Bacteria 11095
130 Ga0105240_10017476 3300009093 Bacteria 9666
131 Ga0105240_10070818 3300009093 Bacteria 4313
132 Ga0105240_10304868 3300009093 Bacteria 1821
133 Ga0105245_10002089 3300009098 Bacteria 18117
134 Ga0105245_10009485 3300009098 Bacteria 8488
135 Ga0114129_10149346 3300009147 Bacteria 3198
136 Ga0105243_10000950 3300009148 Bacteria 27049
137 Ga0105243_10056170 3300009148 Bacteria 3129
138 Ga0105243_10294328 3300009148 Bacteria 1468
139 Ga0105243_10715950 3300009148 Bacteria 977
140 Ga0105241_10045550 3300009174 Bacteria 3328
141 Ga0105241_10415116 3300009174 Bacteria 1183
142 Ga0105242_10000210 3300009176 Bacteria 45627
143 Ga0105248_10010320 3300009177 Bacteria 10279
144 Ga0105248_10017254 3300009177 Bacteria 7955
145 Ga0105237_10010097 3300009545 Bacteria 10069
146 Ga0105237_10051294 3300009545 Bacteria 4144
147 Ga0105237_10458234 3300009545 Bacteria 1281
148 Ga0105237_10585404 3300009545 Bacteria 1123
149 Ga0105238_10027777 3300009551 Bacteria 5766
150 Ga0105238_10226524 3300009551 Bacteria 1846
151 Ga0105238_10473056 3300009551 Bacteria 1252
152 Ga0105249_10017303 3300009553 Bacteria 6400
153 Ga0105148_100253 3300009978 Bacteria 7295
154 Ga0105239_10000025 3300010375 Bacteria 254049
155 Ga0105239_10004123 3300010375 Bacteria 17464
156 Ga0105239_10031481 3300010375 Bacteria 5833
157 Ga0105239_10046782 3300010375 Bacteria 4741
158 Ga0105246_10000472 3300011119 Bacteria 21681
159 Ga0157373_10047916 3300013100 Bacteria 3047
160 Ga0157373_10084627 3300013100 Bacteria 2235
161 Ga0157373_10264350 3300013100 Bacteria 1218
162 Ga0157371_10211638 3300013102 Bacteria 1391
163 Ga0157370_10000203 3300013104 Bacteria 75249
164 Ga0157370_10074058 3300013104 Bacteria 3212
165 Ga0157369_10057364 3300013105 Bacteria 4202
166 Ga0157369_10203149 3300013105 Bacteria 2079
167 Ga0157369_10511326 3300013105 Bacteria 1242
168 Ga0157374_10000830 3300013296 Bacteria 27049
169 Ga0157374_10045139 3300013296 Bacteria 4078
170 Ga0157374_10071508 3300013296 Bacteria 3271
171 Ga0157374_10103118 3300013296 Bacteria 2737
172 Ga0157378_10001477 3300013297 Bacteria 21228
173 Ga0157378_10084028 3300013297 Bacteria 2882
174 Ga0157378_10166335 3300013297 Bacteria 2066
175 Ga0163162_10001078 3300013306 Bacteria 25383
176 Ga0163162_10446220 3300013306 Bacteria 1426
177 Ga0157372_10010036 3300013307 Bacteria 10070
178 Ga0157372_10058023 3300013307 Bacteria 4327
179 Ga0157372_10179976 3300013307 Bacteria 2447
180 Ga0157372_10339814 3300013307 Bacteria 1749
181 Ga0157375_10002120 3300013308 Bacteria 17145
182 Ga0157376_10000047 3300014969 Bacteria 107974
183 Ga0183363_1002 3300015690 Bacteria 425040
184 Ga0163161_10013007 3300017792 Bacteria 5783
185 Ga0207427_101974 3300025231 Bacteria 6255
186 Ga0207425_1000022 3300025245 Bacteria 355305
187 Ga0209646_1021491 3300025246 Bacteria 926
188 Ga0209026_1002441 3300025250 Bacteria 6982
189 Ga0209026_1004353 3300025250 Bacteria 4235
190 Ga0209148_1000061 3300025254 Bacteria 349575
191 Ga0209148_1001013 3300025254 Bacteria 17719
192 Ga0209129_1000286 3300025258 Bacteria 48191
193 Ga0209233_1000120 3300025261 Bacteria 233311
194 Ga0209233_1000142 3300025261 Bacteria 192193
195 Ga0209565_1007352 3300025263 Bacteria 2981
196 Ga0209455_1000692 3300025272 Bacteria 19864
197 Ga0209675_1000126 3300025291 Bacteria 104792
198 Ga0209676_1000566 3300025292 Bacteria 55814
199 Ga0209676_1008708 3300025292 Bacteria 4479
200 Ga0209676_1009141 3300025292 Bacteria 4313
201 Ga0209676_1026483 3300025292 Bacteria 1840
202 Ga0209025_1001464 3300025294 Bacteria 30863
203 Ga0209025_1019511 3300025294 Bacteria 3766
204 Ga0209025_1075443 3300025294 Bacteria 1173
205 Ga0209758_1000004 3300025297 Bacteria 1375322
206 Ga0209050_1000001 3300025298 Bacteria 3563507
207 Ga0209050_1000047 3300025298 Bacteria 380561
208 Ga0209050_1000127 3300025298 Bacteria 187951
209 Ga0209051_1000246 3300025303 Bacteria 91170
210 Ga0209257_1000517 3300025304 Bacteria 67082
211 Ga0209257_1002394 3300025304 Bacteria 18771
212 Ga0209257_1002888 3300025304 Bacteria 15965
213 Ga0209257_1010863 3300025304 Bacteria 4507
214 Ga0209257_1030916 3300025304 Bacteria 1720
215 Ga0207697_10086321 3300025315 Bacteria 1326
216 Ga0207656_10059287 3300025321 Bacteria 1675
217 Ga0207642_10007810 3300025899 Bacteria 3631
218 Ga0207688_10080907 3300025901 Bacteria 1855
219 Ga0207680_10022733 3300025903 Bacteria 3414
220 Ga0207647_10000270 3300025904 Bacteria 42605
221 Ga0207647_10016335 3300025904 Bacteria 5068
222 Ga0207647_10017291 3300025904 Bacteria 4902
223 Ga0207647_10051484 3300025904 Bacteria 2545
224 Ga0207647_10054292 3300025904 Bacteria 2466
225 Ga0207647_10065747 3300025904 Bacteria 2200
226 Ga0207645_10029542 3300025907 Bacteria 3533
227 Ga0207705_10000316 3300025909 Bacteria 44059
228 Ga0207705_10000963 3300025909 Bacteria 23546
229 Ga0207705_10009514 3300025909 Bacteria 7072
230 Ga0207705_10369159 3300025909 Bacteria 1107
231 Ga0207705_10525168 3300025909 Bacteria 920
232 Ga0207654_10342347 3300025911 Bacteria 1027
233 Ga0207695_10008358 3300025913 Bacteria 12966
234 Ga0207695_10041776 3300025913 Bacteria 4905
235 Ga0207695_10057479 3300025913 Bacteria 4040
236 Ga0207671_10002163 3300025914 Bacteria 21356
237 Ga0207671_10098859 3300025914 Bacteria 2208
238 Ga0207671_10107147 3300025914 Bacteria 2122
239 Ga0207657_10003918 3300025919 Bacteria 15794
240 Ga0207657_10049263 3300025919 Bacteria 3673
241 Ga0207657_10057737 3300025919 Bacteria 3343
242 Ga0207649_10067641 3300025920 Bacteria 2269
243 Ga0207681_10047485 3300025923 Bacteria 2893
244 Ga0207694_10217153 3300025924 Bacteria 1559
245 Ga0207650_10203060 3300025925 Bacteria 1589
246 Ga0207687_10006744 3300025927 Bacteria 7566
247 Ga0207687_10027727 3300025927 Bacteria 3802
248 Ga0207644_10224943 3300025931 Bacteria 1489
249 Ga0207690_10077238 3300025932 Bacteria 2314
250 Ga0207690_10123350 3300025932 Bacteria 1885
251 Ga0207690_10207593 3300025932 Bacteria 1491
252 Ga0207690_10227985 3300025932 Bacteria 1429
253 Ga0207690_10430273 3300025932 Bacteria 1057
254 Ga0207706_10004159 3300025933 Bacteria 13640
255 Ga0207706_10019782 3300025933 Bacteria 6053
256 Ga0207706_10103379 3300025933 Bacteria 2506
257 Ga0207709_10000050 3300025935 Bacteria 234391
258 Ga0207704_10000020 3300025938 Bacteria 148847
259 Ga0207711_10005221 3300025941 Bacteria 11005
260 Ga0207711_10056418 3300025941 Bacteria 3376
261 Ga0207689_10001541 3300025942 Bacteria 21894
262 Ga0207661_10055536 3300025944 Bacteria 3177
263 Ga0207667_10000035 3300025949 Bacteria 301056
264 Ga0207667_10004932 3300025949 Bacteria 16295
265 Ga0207667_10075657 3300025949 Bacteria 3495
266 Ga0207667_10131103 3300025949 Bacteria 2582
267 Ga0207667_10697721 3300025949 Bacteria 1018
268 Ga0207651_10000005 3300025960 Bacteria 246132
269 Ga0207712_10097162 3300025961 Bacteria 2182
270 Ga0207668_10273471 3300025972 Bacteria 1382
271 Ga0207640_10000145 3300025981 Bacteria 51603
272 Ga0207640_10056590 3300025981 Bacteria 2575
273 Ga0207640_10059222 3300025981 Bacteria 2527
274 Ga0207640_10332653 3300025981 Bacteria 1214
275 Ga0207658_10000571 3300025986 Bacteria 33340
276 Ga0207677_10000373 3300026023 Bacteria 31103
277 Ga0207703_10000976 3300026035 Bacteria 27501
278 Ga0207703_10004598 3300026035 Bacteria 11293
279 Ga0207639_10002511 3300026041 Bacteria 12308
280 Ga0207639_10007809 3300026041 Bacteria 7304
281 Ga0207639_10332655 3300026041 Bacteria 1352
282 Ga0207678_10005889 3300026067 Bacteria 10929
283 Ga0207678_10249930 3300026067 Bacteria 1518
284 Ga0207678_10320657 3300026067 Bacteria 1333
285 Ga0207702_10003711 3300026078 Bacteria 13808
286 Ga0207702_10012620 3300026078 Bacteria 7034
287 Ga0207702_10037699 3300026078 Bacteria 4047
288 Ga0207702_10245821 3300026078 Bacteria 1678
289 Ga0207648_10000017 3300026089 Bacteria 148699
290 Ga0207676_10000190 3300026095 Bacteria 53850
291 Ga0207676_10348384 3300026095 Bacteria 1369
292 Ga0207674_10015748 3300026116 Bacteria 8294
293 Ga0207674_10022819 3300026116 Bacteria 6715
294 Ga0207674_10776312 3300026116 Bacteria 925
295 Ga0207674_10892142 3300026116 Bacteria 857
296 Ga0207683_10029414 3300026121 Bacteria 4757
297 Ga0207698_10000712 3300026142 Bacteria 19239
298 Ga0207698_10036634 3300026142 Bacteria 3603
299 Ga0207698_10036776 3300026142 Bacteria 3598
300 Ga0207698_10038607 3300026142 Bacteria 3530
301 Ga0207698_10713009 3300026142 Bacteria 999
302 Ga0209813_10000048 3300027866 Bacteria 48973
303 Ga0209813_10000191 3300027866 Bacteria 19193
304 Ga0209813_10000220 3300027866 Bacteria 17618
305 Ga0268266_10889770 3300028379 Bacteria 861
306 Ga0268264_10245060 3300028381 Bacteria 1662
307 Ga0307517_10026027 3300028786 Bacteria 7113
308 Ga0307513_10061622 3300031456 Bacteria 3971
309 Ga0307513_10256515 3300031456 Bacteria 1541
310 Ga0307508_10004238 3300031616 Bacteria 14080
311 Ga0307510_10191540 3300033180 Bacteria 1592
312 Ga0373946_0289600 3300035171 Bacteria 807
313 Ga0395899_0002116 3300037312 Bacteria 16321
314 Ga0395899_0317704 3300037312 Bacteria 1050
315 Ga0395900_0260720 3300037418 Bacteria 1731
316 Ga0395905_0497526 3300037471 Bacteria 1119
317 Ga0436364_1389735 3300037853 Bacteria 3606
318 Ga0395901_0245370 3300038443 Bacteria 1867
319 Ga0436365_1211005 3300039437 Bacteria 1323
320 Ga0436363_0389907 3300039450 Bacteria 1756
321 Ga0451802_0044966 3300041460 Bacteria 2341
322 Ga0451806_660356 3300041462 Bacteria 3795
323 Ga0451804_0756293 3300041463 Bacteria 1937
324 Ga0451807_2284404 3300041486 Bacteria 1071
325 Ga0451853_1879690 3300041512 Bacteria 3625
326 Ga0439448_0002573 3300042005 Bacteria 4944
327 Ga0439448_0003494 3300042005 Bacteria 4352
328 Ga0439448_0027604 3300042005 Bacteria 1790
329 Ga0439448_0038338 3300042005 Bacteria 1542
330 Ga0439455_0000252 3300042012 Bacteria 6482
331 Ga0439455_0000304 3300042012 Bacteria 6168
332 Ga0439455_0054729 3300042012 Bacteria 1048
333 Ga0439458_0000255 3300042157 Bacteria 12956
334 Ga0439458_0000305 3300042157 Bacteria 12201
335 Ga0439458_0026115 3300042157 Bacteria 1372
336 Ga0466972_0274254 3300044658 Bacteria 788
337 Ga0466966_0019647 3300044684 Bacteria 4445
338 Ga0466963_0008961 3300044694 Bacteria 6006
339 Ga0466964_0012394 3300044706 Bacteria 3226
340 Ga0466964_0018224 3300044706 Bacteria 2692
341 Ga0466971_0000834 3300044719 Bacteria 12515
342 Ga0466968_0054687 3300044735 Bacteria 1711
343 Ga0466970_0012023 3300044765 Bacteria 4420
344 Ga0466957_0274396 3300044842 Bacteria 1127
345 Ga0466960_0014885 3300044901 Bacteria 3342
346 Ga0495627_000582 3300046453 Bacteria 29200
347 Ga0495629_0157525 3300046459 Bacteria 1578
348 Ga0495638_0080909 3300046460 Bacteria 1973
349 Ga0495638_0144399 3300046460 Bacteria 1386
350 Ga0495638_0156654 3300046460 Bacteria 1317
351 Ga0495650_0001090 3300046471 Bacteria 29761
352 Ga0495650_0049328 3300046471 Bacteria 1749
353 Ga0495605_0069453 3300046474 Bacteria 1668
354 Ga0495584_0014651 3300046491 Bacteria 3995
355 Ga0495596_0000196 3300046500 Bacteria 41923
356 Ga0495596_0000537 3300046500 Bacteria 23841
357 Ga0495607_0016964 3300046501 Bacteria 4688
358 Ga0495607_0047613 3300046501 Bacteria 2511
359 Ga0495583_0000030 3300046506 Bacteria 254970
360 Ga0495583_0000252 3300046506 Bacteria 88617
361 Ga0495606_0044223 3300046507 Bacteria 2964
362 Ga0495606_0116794 3300046507 Bacteria 1602
363 Ga0495610_0000081 3300046512 Bacteria 113513
364 Ga0495610_0001175 3300046512 Bacteria 23733
365 Ga0495610_0003890 3300046512 Bacteria 11329
366 Ga0495610_0027251 3300046512 Bacteria 3039
367 Ga0495610_0047804 3300046512 Bacteria 2103
368 Ga0495620_0013539 3300046515 Bacteria 4173
369 Ga0495632_0000007 3300046519 Bacteria 343246
370 Ga0495632_0000306 3300046519 Bacteria 47401
371 Ga0495632_0027007 3300046519 Bacteria 3013
372 Ga0495637_0000569 3300046520 Bacteria 26380
373 Ga0495637_0033327 3300046520 Bacteria 2263
374 Ga0495637_0077167 3300046520 Bacteria 1334
375 Ga0495643_0000042 3300046522 Bacteria 229665
376 Ga0495643_0000304 3300046522 Bacteria 68483
377 Ga0495643_0007419 3300046522 Bacteria 7074
378 Ga0495643_0021213 3300046522 Bacteria 3731
379 Ga0495648_0037584 3300046524 Bacteria 3109
380 Ga0495663_0000005 3300046525 Bacteria 342265
381 Ga0495663_0018295 3300046525 Bacteria 1995
382 Ga0495654_0034814 3300046530 Bacteria 2539
383 Ga0495654_0043751 3300046530 Bacteria 2218
384 Ga0495609_0007089 3300046538 Bacteria 5641
385 Ga0495622_0006810 3300046557 Bacteria 5304
386 Ga0495633_0000491 3300046558 Bacteria 39973
387 Ga0495633_0001879 3300046558 Bacteria 15338
388 Ga0495668_0000001 3300046616 Bacteria 1013420
389 Ga0495611_0098653 3300046648 Bacteria 1355
390 Ga0495611_0256250 3300046648 Bacteria 810
391 Ga0495625_0000671 3300046660 Bacteria 48757
392 Ga0495625_0002401 3300046660 Bacteria 20305
393 Ga0495625_0035771 3300046660 Bacteria 3657
394 Ga0495625_0050839 3300046660 Bacteria 2972
395 Ga0495625_0057335 3300046660 Bacteria 2770
396 Ga0495625_0063243 3300046660 Bacteria 2614
397 Ga0495625_0085854 3300046660 Bacteria 2184
398 Ga0495661_0033156 3300046665 Bacteria 3259
399 Ga0495670_0013380 3300046691 Bacteria 4036
400 Ga0495670_0028819 3300046691 Bacteria 2753
401 Ga0495670_0243820 3300046691 Bacteria 957
402 Ga0495671_0000011 3300046692 Bacteria 365582
403 Ga0495671_0000126 3300046692 Bacteria 68483
404 Ga0495671_0042256 3300046692 Bacteria 2292
405 Ga0495671_0115065 3300046692 Bacteria 1313
406 Ga0495671_0123561 3300046692 Bacteria 1262
407 Ga0495676_0203871 3300047321 Bacteria 1373
408 Ga0495677_0034004 3300047445 Bacteria 1859
409 Ga0495673_0000013 3300047469 Bacteria 612902
410 Ga0495681_0000517 3300047470 Bacteria 29470
411 Ga0495681_0002422 3300047470 Bacteria 13333
412 Ga0495681_0041330 3300047470 Bacteria 2239
413 Ga0495686_0000063 3300047472 Bacteria 228575
414 Ga0495686_0000082 3300047472 Bacteria 200115
415 Ga0495686_0000401 3300047472 Bacteria 68555
416 Ga0495686_0000661 3300047472 Bacteria 46810
417 Ga0495686_0009632 3300047472 Bacteria 6938
418 Ga0495686_0020603 3300047472 Bacteria 4395
419 Ga0495686_0027175 3300047472 Bacteria 3738
420 Ga0495686_0082333 3300047472 Bacteria 1964
421 Ga0495686_0104101 3300047472 Bacteria 1709
422 Ga0495615_0000020 3300048090 Bacteria 53202
423 Ga0495626_0000298 3300048091 Bacteria 53039
424 Ga0496102_0197094 3300048905 Unclassified 1898
425 Ga0496102_0586199 3300048905 Bacteria 1038
426 Ga0496103_0348167 3300048906 Bacteria 953
427 Ga0496110_0050768 3300048913 Bacteria 3643
428 Ga0496110_0609108 3300048913 Bacteria 990
429 Ga0496111_0033642 3300048914 Bacteria 3657
430 Ga0496111_0107898 3300048914 Bacteria 2050
431 Ga0496111_0413687 3300048914 Bacteria 996
432 Ga0496113_0092142 3300048916 Bacteria 2337
433 Ga0496115_0000285 3300048918 Bacteria 43764
434 Ga0496116_0000035 3300048919 Bacteria 402424
435 Ga0496116_0047806 3300048919 Bacteria 2877
436 Ga0496117_0011402 3300048920 Bacteria 7961
437 Ga0496117_0043351 3300048920 Bacteria 3272
438 Ga0496117_0047825 3300048920 Bacteria 3063
439 Ga0496117_0057221 3300048920 Bacteria 2710
440 Ga0496117_0119468 3300048920 Bacteria 1622
441 Ga0496118_0015807 3300048921 Bacteria 6962
442 Ga0496118_0030413 3300048921 Bacteria 4507
443 Ga0496118_0035164 3300048921 Bacteria 4074
444 Ga0496118_0036903 3300048921 Bacteria 3943
445 Ga0496118_0139977 3300048921 Bacteria 1536
446 Ga0496119_0033280 3300048922 Bacteria 3421
447 Ga0496119_0052623 3300048922 Bacteria 2493
448 Ga0496120_0102515 3300048923 Bacteria 1509
449 Ga0496121_0000105 3300048924 Bacteria 191437
450 Ga0496121_0000579 3300048924 Bacteria 68757
451 Ga0496121_0000671 3300048924 Bacteria 63867
452 Ga0496121_0002960 3300048924 Bacteria 24756
453 Ga0496121_0002979 3300048924 Bacteria 24637
454 Ga0496121_0003092 3300048924 Bacteria 24067
455 Ga0496121_0003231 3300048924 Bacteria 23434
456 Ga0496121_0030578 3300048924 Bacteria 4943
457 Ga0496122_0005685 3300048925 Bacteria 14721
458 Ga0496122_0018901 3300048925 Bacteria 6329
459 Ga0496122_0026933 3300048925 Bacteria 4935
460 Ga0496123_0000159 3300048926 Bacteria 136014
461 Ga0496123_0002459 3300048926 Bacteria 22941
462 Ga0496123_0003542 3300048926 Bacteria 17370
463 Ga0496123_0003707 3300048926 Bacteria 16803
464 Ga0496124_0002365 3300048927 Bacteria 24886
465 Ga0496124_0005911 3300048927 Bacteria 13541
466 Ga0496124_0015727 3300048927 Bacteria 7234
467 Ga0496124_0030523 3300048927 Bacteria 4783
468 Ga0496124_0038486 3300048927 Bacteria 4153
469 Ga0496124_0046585 3300048927 Bacteria 3712
470 Ga0496124_0067837 3300048927 Bacteria 2966
471 Ga0496124_0090965 3300048927 Bacteria 2487
472 Ga0496124_0155365 3300048927 Bacteria 1790
473 Ga0496124_0235082 3300048927 Bacteria 1367
474 Ga0496124_0262178 3300048927 Bacteria 1271
475 Ga0496125_0012910 3300048928 Bacteria 8247
476 Ga0496125_0031437 3300048928 Bacteria 4731
477 Ga0496125_0040553 3300048928 Bacteria 3992
478 Ga0496125_0121127 3300048928 Bacteria 1866
479 Ga0496125_0215487 3300048928 Bacteria 1242
480 Ga0496126_0000077 3300048929 Bacteria 231592
481 Ga0496126_0001878 3300048929 Bacteria 30558
482 Ga0496126_0014533 3300048929 Bacteria 7953
483 Ga0496126_0058122 3300048929 Bacteria 3487
484 Ga0496126_0112148 3300048929 Bacteria 2375
485 Ga0496126_0196016 3300048929 Bacteria 1708
486 Ga0496126_0320266 3300048929 Bacteria 1275
487 Ga0495682_0125592 3300049460 Bacteria 918
488 Ga0501033_0000215 3300049570 Bacteria 55477
489 Ga0501036_0095571 3300049572 Bacteria 2512
490 Ga0501037_0145969 3300049573 Bacteria 1692
491 Ga0501038_0106928 3300049574 Bacteria 2321
492 Ga0501043_0072900 3300049579 Bacteria 2697
493 Ga0501047_0001117 3300049581 Bacteria 26643
494 Ga0501047_0009954 3300049581 Bacteria 8991
495 Ga0501073_0212203 3300049589 Bacteria 1338
496 Ga0501211_001344 3300049658 Bacteria 2623
497 Ga0501223_000064 3300049663 Bacteria 34167
498 Ga0501235_001360 3300049669 Bacteria 5179
499 Ga0501225_0000063 3300049705 Bacteria 34813
500 Ga0501245_005207 3300049708 Bacteria 1799
501 Ga0501044_0000160 3300049823 Bacteria 83543
502 Ga0501044_0079519 3300049823 Bacteria 3322
503 Ga0501044_0256729 3300049823 Bacteria 1687
504 nmdc:mga03683_10661_c1 3300050489 Bacteria 3302
505 nmdc:mga03683_16551_c1 3300050489 Bacteria 2772
506 nmdc:mga03683_927_c1 3300050489 Bacteria 8482
507 nmdc:mga03n38_30348_c1 3300050490 Bacteria 2272
508 nmdc:mga03n38_82620_c1 3300050490 Bacteria 1513
509 nmdc:mga00v17_11965_c1 3300050491 Bacteria 4776
510 nmdc:mga00v17_1563_c1 3300050491 Bacteria 11955
511 nmdc:mga00v17_3583_c1 3300050491 Bacteria 8021
512 nmdc:mga0yw44_158276_c1 3300050492 Bacteria 1482
513 nmdc:mga0yw44_330966_c1 3300050492 Bacteria 1024
514 nmdc:mga0k408_149619_c1 3300050493 Bacteria 1390
515 nmdc:mga0k408_3784_c1 3300050493 Bacteria 8022
516 nmdc:mga0k408_39900_c2 3300050493 Bacteria 2077
517 nmdc:mga06z11_117_c1 3300050494 Bacteria 32760
518 nmdc:mga06z11_295_c1 3300050494 Bacteria 19152
519 nmdc:mga04h51_162_c1 3300050495 Bacteria 19154
520 nmdc:mga04h51_178_c1 3300050495 Bacteria 17872
521 nmdc:mga04h51_29230_c1 3300050495 Bacteria 1725
522 nmdc:mga04h51_656_c1 3300050495 Bacteria 8066
523 nmdc:mga07m45_21157_c1 3300050496 Bacteria 3539
524 nmdc:mga07m45_22_c1 3300050496 Bacteria 117399
525 nmdc:mga07m45_40998_c1 3300050496 Bacteria 2592
526 nmdc:mga07m45_70616_c1 3300050496 Bacteria 1383
527 nmdc:mga07m45_9859_c1 3300050496 Bacteria 4968
528 nmdc:mga05p37_127775_c1 3300050507 Bacteria 3120
529 nmdc:mga0sz30_144328_c1 3300050516 Bacteria 1052
530 nmdc:mga0sz30_48389_c1 3300050516 Bacteria 1799
531 nmdc:mga0sz30_714_c2 3300050516 Bacteria 2578
532 Ga0495619_0384861 3300053085 Bacteria 969
533 Ga0500643_000385 3300053087 Bacteria 34308
534 Ga0500643_002094 3300053087 Bacteria 10622
535 Ga0500647_0066437 3300053091 Bacteria 1734
536 Ga0500651_0345311 3300053093 Bacteria 845
537 Ga0500641_0061888 3300053096 Bacteria 1560
538 Ga0500555_000163 3300053103 Bacteria 31013
539 Ga0500592_001641 3300053116 Bacteria 3633
540 Ga0500594_0009144 3300053118 Bacteria 2276
541 Ga0500597_019103 3300053120 Bacteria 2670
542 Ga0500607_000065 3300053121 Bacteria 74437
543 Ga0500607_000386 3300053121 Bacteria 42198
544 Ga0500614_016829 3300053123 Bacteria 1646
545 Ga0500618_013410 3300053125 Bacteria 2117
546 Ga0500618_031599 3300053125 Bacteria 1241
547 Ga0500642_0000574 3300053130 Bacteria 11074
548 Ga0500655_000165 3300053133 Bacteria 16205
549 Ga0500658_0007915 3300053134 Bacteria 3927
550 Ga0500559_0000668 3300053136 Bacteria 22938
551 Ga0500559_0012091 3300053136 Bacteria 3676
552 Ga0500559_0013370 3300053136 Bacteria 3477
553 Ga0500559_0059748 3300053136 Bacteria 1698
554 Ga0500568_0026023 3300053139 Bacteria 2460
555 Ga0500577_0012472 3300053142 Bacteria 2571
556 Ga0500577_0120786 3300053142 Bacteria 1090
557 Ga0500577_0132164 3300053142 Bacteria 1047
558 Ga0500590_000953 3300053148 Bacteria 11128
559 Ga0500616_0010849 3300053153 Bacteria 5431
560 Ga0500616_0035196 3300053153 Bacteria 2724
561 Ga0500616_0041068 3300053153 Bacteria 2484
562 Ga0500616_0129036 3300053153 Bacteria 1197
563 Ga0500616_0152766 3300053153 Eukaryota 1067
564 Ga0500622_0002328 3300053156 Bacteria 13870
565 Ga0500622_0034813 3300053156 Bacteria 2637
566 Ga0500622_0132477 3300053156 Bacteria 1197
567 Ga0500624_000012 3300053157 Bacteria 165895
568 Ga0500624_000020 3300053157 Bacteria 118392
569 Ga0500624_000061 3300053157 Bacteria 66422
570 Ga0500627_0000013 3300053158 Bacteria 136204
571 Ga0500639_096613 3300053163 Bacteria 1462
572 Ga0500636_0001685 3300053177 Bacteria 12100
573 Ga0500636_0041154 3300053177 Bacteria 2733
574 Ga0500637_0000022 3300053178 Bacteria 61494
575 Ga0500637_0006428 3300053178 Bacteria 5788
576 Ga0500570_053881 3300053724 Bacteria 2000
577 Ga0500645_020731 3300053730 Bacteria 2034
578 Ga0500645_037940 3300053730 Bacteria 1430
579 Ga0500661_004899 3300055283 Bacteria 2504
580 Ga0466962_0011448 3300061719 Bacteria 4270
581 2511128233 2510917021 Bacteria 5705459
582 2512645509 2512564014 Bacteria 4639632
583 2585262113 2582581305 Bacteria 4895574
584 2585262301 2582581305 Bacteria 4895574
585 2600200538 2599185354 Bacteria 4398675
586 2643731408 2643221541 Bacteria 5498788
587 2643822632 2643221560 Bacteria 4801179
588 2643822876 2643221560 Bacteria 4801179
589 2643833855 2643221563 Bacteria 4726935
590 2644042264 2643221606 Bacteria 5588032
591 2644054781 2643221608 Bacteria 4724829
592 2644394094 2643221671 Bacteria 5496681
593 2809064602 2808606401 Bacteria 4586670
594 2809080487 2808606404 Bacteria 4652788
595 2809084851 2808606405 Bacteria 4586632
596 2819552183 2818991438 Bacteria 5793701
597 2830076898 2830075706 Bacteria 3855215
598 2852653561 2852653556 Bacteria 4050083
599 2852656830 2852653556 Bacteria 4050083
600 2852683846 2852680915 Bacteria 4100189
601 2852683925 2852680915 Bacteria 4100189
602 2909047266 2909042592 Bacteria 6499737
603 2928030365 2928027323 Bacteria 4382488
604 2928971819 2928968154 Bacteria 4633371
605 2946789654 2946787523 Bacteria 4366789
606 2984555766 2984555340 Bacteria 4247089
607 2984566124 2984564862 Bacteria 4339992
608 2990268660 2990265787 Bacteria 3943888
609 2993357136 2993356040 Bacteria 4247105
610 2993694634 2993693658 Bacteria 4040749
611 8054303857 8054302542 Bacteria 5698134
612 8057101691 8057101203 Bacteria 5034064
613 Ga0495638_0000267
614 SwRhRL2b_contig_2866031
615 SwRhRL2b_contig_860484
616 JGI24736J21556_1008730
617 JGI24741J21665_1007135
618 JGI24740J21852_10042393
619 JGI24739J22299_10000601
620 JGI24739J22299_10002449
621 JGI24739J22299_10004424
622 JGI24737J22298_10000720
623 JGI24737J22298_10071114
624 JGI24735J21928_10001166
625 JGI24735J21928_10008108
626 JGI24735J21928_10027700
627 JGI24735J21928_10034178
628 JGI24738J21930_10000330
629 JGI24738J21930_10000338
630 JGI24738J21930_10000440
631 JGI24738J21930_10010342
632 JGI24744J21845_10004368
633 JGI24751J29686_10001912
634 JGI25157J39369_1018117
635 JGI25150J39212_1000020
636 JGI25165J46597_1000073
637 JGI25165J46597_1000188
638 JGI25153J46596_10000017
639 rootL2_10165951
640 Ga0055542_1004389
641 Ga0055536_1000713
642 Ga0055536_1011158
643 Ga0055530_10005655
644 Ga0055530_10008737
645 Ga0055530_10044614
646 Ga0055531_10003646
647 Ga0055531_10022471
648 Ga0055531_10045466
649 Ga0055531_10046828
650 Ga0065165_1004847
651 Ga0065704_10000192
652 Ga0065704_10006257
653 Ga0065704_10111589
654 Ga0065707_10101327
655 Ga0070658_10033853
656 Ga0070658_10041598
657 Ga0070658_10358454
658 Ga0070658_10528373
659 Ga0070676_10002175
660 Ga0068869_100000848
661 Ga0070666_10040596
662 Ga0068868_100000154
663 Ga0068868_100147581
664 Ga0070660_100000544
665 Ga0070660_100174061
666 Ga0070660_100211179
667 Ga0070660_100409501
668 Ga0070660_100438185
669 Ga0070661_100092363
670 Ga0070668_100615823
671 Ga0070673_100000023
672 Ga0070659_100059344
673 Ga0070659_100059457
674 Ga0070659_100066008
675 Ga0070659_100075161
676 Ga0070659_100663842
677 Ga0070667_100001100
678 Ga0070663_100001998
679 Ga0070678_100054021
680 Ga0070662_100002062
681 Ga0070662_100081846
682 Ga0070662_100131072
683 Ga0070681_10094688
684 Ga0068867_100000007
685 Ga0070684_100180891
686 Ga0068853_100023296
687 Ga0068853_100025947
688 Ga0068853_100069304
689 Ga0070672_100042427
690 Ga0070693_100281806
691 Ga0070665_100004652
692 Ga0068855_100000029
693 Ga0068855_100001148
694 Ga0068855_100191725
695 Ga0068855_100449801
696 Ga0070664_100424026
697 Ga0068857_100055573
698 Ga0068854_100000027
699 Ga0068854_100066764
700 Ga0068854_100154085
701 Ga0068854_100218332
702 Ga0068856_100004098
703 Ga0068852_100004278
704 Ga0068852_100006260
705 Ga0068852_100025178
706 Ga0068852_100129866
707 Ga0068852_100182937
708 Ga0068864_100002125
709 Ga0068866_10012667
710 Ga0068858_100000228
711 Ga0068858_100001700
712 Ga0068860_100286162
713 Ga0075365_10178714
714 Ga0075368_10000055
715 Ga0075368_10000168
716 Ga0075368_10000967
717 Ga0075368_10032193
718 Ga0075363_100006130
719 Ga0075363_100017846
720 Ga0075363_100096373
721 Ga0075364_10206394
722 Ga0075362_10002811
723 Ga0075362_10034881
724 Ga0075367_10000109
725 Ga0075367_10000289
726 Ga0075367_10006417
727 Ga0075367_10049680
728 Ga0075369_10095090
729 Ga0075369_10155901
730 Ga0075366_10037690
731 Ga0075366_10076800
732 Ga0075366_10143533
733 Ga0097621_100002061
734 Ga0075370_10000257
735 Ga0075370_10026515
736 Ga0075370_10050753
737 Ga0075370_10085395
738 Ga0075370_10125899
739 Ga0068871_100002074
740 Ga0068865_100000010
741 Ga0105240_10013748
742 Ga0105240_10017476
743 Ga0105240_10070818
744 Ga0105240_10304868
745 Ga0105245_10002089
746 Ga0105245_10009485
747 Ga0114129_10149346
748 Ga0105243_10000950
749 Ga0105243_10056170
750 Ga0105243_10294328
751 Ga0105243_10715950
752 Ga0105241_10045550
753 Ga0105241_10415116
754 Ga0105242_10000210
755 Ga0105248_10010320
756 Ga0105248_10017254
757 Ga0105237_10010097
758 Ga0105237_10051294
759 Ga0105237_10458234
760 Ga0105237_10585404
761 Ga0105238_10027777
762 Ga0105238_10226524
763 Ga0105238_10473056
764 Ga0105249_10017303
765 Ga0105148_100253
766 Ga0105239_10000025
767 Ga0105239_10004123
768 Ga0105239_10031481
769 Ga0105239_10046782
770 Ga0105246_10000472
771 Ga0157373_10047916
772 Ga0157373_10084627
773 Ga0157373_10264350
774 Ga0157371_10211638
775 Ga0157370_10000203
776 Ga0157370_10074058
777 Ga0157369_10057364
778 Ga0157369_10203149
779 Ga0157369_10511326
780 Ga0157374_10000830
781 Ga0157374_10045139
782 Ga0157374_10071508
783 Ga0157374_10103118
784 Ga0157378_10001477
785 Ga0157378_10084028
786 Ga0157378_10166335
787 Ga0163162_10001078
788 Ga0163162_10446220
789 Ga0157372_10010036
790 Ga0157372_10058023
791 Ga0157372_10179976
792 Ga0157372_10339814
793 Ga0157375_10002120
794 Ga0157376_10000047
795 Ga0183363_1002
796 Ga0163161_10013007
797 Ga0207427_101974
798 Ga0207425_1000022
799 Ga0209646_1021491
800 Ga0209026_1002441
801 Ga0209026_1004353
802 Ga0209148_1000061
803 Ga0209148_1001013
804 Ga0209129_1000286
805 Ga0209233_1000120
806 Ga0209233_1000142
807 Ga0209565_1007352
808 Ga0209455_1000692
809 Ga0209675_1000126
810 Ga0209676_1000566
811 Ga0209676_1008708
812 Ga0209676_1009141
813 Ga0209676_1026483
814 Ga0209025_1001464
815 Ga0209025_1019511
816 Ga0209025_1075443
817 Ga0209758_1000004
818 Ga0209050_1000001
819 Ga0209050_1000047
820 Ga0209050_1000127
821 Ga0209051_1000246
822 Ga0209257_1000517
823 Ga0209257_1002394
824 Ga0209257_1002888
825 Ga0209257_1010863
826 Ga0209257_1030916
827 Ga0207697_10086321
828 Ga0207656_10059287
829 Ga0207642_10007810
830 Ga0207688_10080907
831 Ga0207680_10022733
832 Ga0207647_10000270
833 Ga0207647_10016335
834 Ga0207647_10017291
835 Ga0207647_10051484
836 Ga0207647_10054292
837 Ga0207647_10065747
838 Ga0207645_10029542
839 Ga0207705_10000316
840 Ga0207705_10000963
841 Ga0207705_10009514
842 Ga0207705_10369159
843 Ga0207705_10525168
844 Ga0207654_10342347
845 Ga0207695_10008358
846 Ga0207695_10041776
847 Ga0207695_10057479
848 Ga0207671_10002163
849 Ga0207671_10098859
850 Ga0207671_10107147
851 Ga0207657_10003918
852 Ga0207657_10049263
853 Ga0207657_10057737
854 Ga0207649_10067641
855 Ga0207681_10047485
856 Ga0207694_10217153
857 Ga0207650_10203060
858 Ga0207687_10006744
859 Ga0207687_10027727
860 Ga0207644_10224943
861 Ga0207690_10077238
862 Ga0207690_10123350
863 Ga0207690_10207593
864 Ga0207690_10227985
865 Ga0207690_10430273
866 Ga0207706_10004159
867 Ga0207706_10019782
868 Ga0207706_10103379
869 Ga0207709_10000050
870 Ga0207704_10000020
871 Ga0207711_10005221
872 Ga0207711_10056418
873 Ga0207689_10001541
874 Ga0207661_10055536
875 Ga0207667_10000035
876 Ga0207667_10004932
877 Ga0207667_10075657
878 Ga0207667_10131103
879 Ga0207667_10697721
880 Ga0207651_10000005
881 Ga0207712_10097162
882 Ga0207668_10273471
883 Ga0207640_10000145
884 Ga0207640_10056590
885 Ga0207640_10059222
886 Ga0207640_10332653
887 Ga0207658_10000571
888 Ga0207677_10000373
889 Ga0207703_10000976
890 Ga0207703_10004598
891 Ga0207639_10002511
892 Ga0207639_10007809
893 Ga0207639_10332655
894 Ga0207678_10005889
895 Ga0207678_10249930
896 Ga0207678_10320657
897 Ga0207702_10003711
898 Ga0207702_10012620
899 Ga0207702_10037699
900 Ga0207702_10245821
901 Ga0207648_10000017
902 Ga0207676_10000190
903 Ga0207676_10348384
904 Ga0207674_10015748
905 Ga0207674_10022819
906 Ga0207674_10776312
907 Ga0207674_10892142
908 Ga0207683_10029414
909 Ga0207698_10000712
910 Ga0207698_10036634
911 Ga0207698_10036776
912 Ga0207698_10038607
913 Ga0207698_10713009
914 Ga0209813_10000048
915 Ga0209813_10000191
916 Ga0209813_10000220
917 Ga0268266_10889770
918 Ga0268264_10245060
919 Ga0307517_10026027
920 Ga0307513_10061622
921 Ga0307513_10256515
922 Ga0307508_10004238
923 Ga0307510_10191540
924 Ga0373946_0289600
925 Ga0395899_0002116
926 Ga0395899_0317704
927 Ga0395900_0260720
928 Ga0395905_0497526
929 Ga0436364_1389735
930 Ga0395901_0245370
931 Ga0436365_1211005
932 Ga0436363_0389907
933 Ga0451802_0044966
934 Ga0451806_660356
935 Ga0451804_0756293
936 Ga0451807_2284404
937 Ga0451853_1879690
938 Ga0439448_0002573
939 Ga0439448_0003494
940 Ga0439448_0027604
941 Ga0439448_0038338
942 Ga0439455_0000252
943 Ga0439455_0000304
944 Ga0439455_0054729
945 Ga0439458_0000255
946 Ga0439458_0000305
947 Ga0439458_0026115
948 Ga0466972_0274254
949 Ga0466966_0019647
950 Ga0466963_0008961
951 Ga0466964_0012394
952 Ga0466964_0018224
953 Ga0466971_0000834
954 Ga0466968_0054687
955 Ga0466970_0012023
956 Ga0466957_0274396
957 Ga0466960_0014885
958 Ga0495627_000582
959 Ga0495629_0157525
960 Ga0495638_0080909
961 Ga0495638_0144399
962 Ga0495638_0156654
963 Ga0495650_0001090
964 Ga0495650_0049328
965 Ga0495605_0069453
966 Ga0495584_0014651
967 Ga0495596_0000196
968 Ga0495596_0000537
969 Ga0495607_0016964
970 Ga0495607_0047613
971 Ga0495583_0000030
972 Ga0495583_0000252
973 Ga0495606_0044223
974 Ga0495606_0116794
975 Ga0495610_0000081
976 Ga0495610_0001175
977 Ga0495610_0003890
978 Ga0495610_0027251
979 Ga0495610_0047804
980 Ga0495620_0013539
981 Ga0495632_0000007
982 Ga0495632_0000306
983 Ga0495632_0027007
984 Ga0495637_0000569
985 Ga0495637_0033327
986 Ga0495637_0077167
987 Ga0495643_0000042
988 Ga0495643_0000304
989 Ga0495643_0007419
990 Ga0495643_0021213
991 Ga0495648_0037584
992 Ga0495663_0000005
993 Ga0495663_0018295
994 Ga0495654_0034814
995 Ga0495654_0043751
996 Ga0495609_0007089
997 Ga0495622_0006810
998 Ga0495633_0000491
999 Ga0495633_0001879
1000 Ga0495668_0000001
1001 Ga0495611_0098653
1002 Ga0495611_0256250
1003 Ga0495625_0000671
1004 Ga0495625_0002401
1005 Ga0495625_0035771
1006 Ga0495625_0050839
1007 Ga0495625_0057335
1008 Ga0495625_0063243
1009 Ga0495625_0085854
1010 Ga0495661_0033156
1011 Ga0495670_0013380
1012 Ga0495670_0028819
1013 Ga0495670_0243820
1014 Ga0495671_0000011
1015 Ga0495671_0000126
1016 Ga0495671_0042256
1017 Ga0495671_0115065
1018 Ga0495671_0123561
1019 Ga0495676_0203871
1020 Ga0495677_0034004
1021 Ga0495673_0000013
1022 Ga0495681_0000517
1023 Ga0495681_0002422
1024 Ga0495681_0041330
1025 Ga0495686_0000063
1026 Ga0495686_0000082
1027 Ga0495686_0000401
1028 Ga0495686_0000661
1029 Ga0495686_0009632
1030 Ga0495686_0020603
1031 Ga0495686_0027175
1032 Ga0495686_0082333
1033 Ga0495686_0104101
1034 Ga0495615_0000020
1035 Ga0495626_0000298
1036 Ga0496102_0197094
1037 Ga0496102_0586199
1038 Ga0496103_0348167
1039 Ga0496110_0050768
1040 Ga0496110_0609108
1041 Ga0496111_0033642
1042 Ga0496111_0107898
1043 Ga0496111_0413687
1044 Ga0496113_0092142
1045 Ga0496115_0000285
1046 Ga0496116_0000035
1047 Ga0496116_0047806
1048 Ga0496117_0011402
1049 Ga0496117_0043351
1050 Ga0496117_0047825
1051 Ga0496117_0057221
1052 Ga0496117_0119468
1053 Ga0496118_0015807
1054 Ga0496118_0030413
1055 Ga0496118_0035164
1056 Ga0496118_0036903
1057 Ga0496118_0139977
1058 Ga0496119_0033280
1059 Ga0496119_0052623
1060 Ga0496120_0102515
1061 Ga0496121_0000105
1062 Ga0496121_0000579
1063 Ga0496121_0000671
1064 Ga0496121_0002960
1065 Ga0496121_0002979
1066 Ga0496121_0003092
1067 Ga0496121_0003231
1068 Ga0496121_0030578
1069 Ga0496122_0005685
1070 Ga0496122_0018901
1071 Ga0496122_0026933
1072 Ga0496123_0000159
1073 Ga0496123_0002459
1074 Ga0496123_0003542
1075 Ga0496123_0003707
1076 Ga0496124_0002365
1077 Ga0496124_0005911
1078 Ga0496124_0015727
1079 Ga0496124_0030523
1080 Ga0496124_0038486
1081 Ga0496124_0046585
1082 Ga0496124_0067837
1083 Ga0496124_0090965
1084 Ga0496124_0155365
1085 Ga0496124_0235082
1086 Ga0496124_0262178
1087 Ga0496125_0012910
1088 Ga0496125_0031437
1089 Ga0496125_0040553
1090 Ga0496125_0121127
1091 Ga0496125_0215487
1092 Ga0496126_0000077
1093 Ga0496126_0001878
1094 Ga0496126_0014533
1095 Ga0496126_0058122
1096 Ga0496126_0112148
1097 Ga0496126_0196016
1098 Ga0496126_0320266
1099 Ga0495682_0125592
1100 Ga0501033_0000215
1101 Ga0501036_0095571
1102 Ga0501037_0145969
1103 Ga0501038_0106928
1104 Ga0501043_0072900
1105 Ga0501047_0001117
1106 Ga0501047_0009954
1107 Ga0501073_0212203
1108 Ga0501211_001344
1109 Ga0501223_000064
1110 Ga0501235_001360
1111 Ga0501225_0000063
1112 Ga0501245_005207
1113 Ga0501044_0000160
1114 Ga0501044_0079519
1115 Ga0501044_0256729
1116 nmdc:mga03683_10661_c1
1117 nmdc:mga03683_16551_c1
1118 nmdc:mga03683_927_c1
1119 nmdc:mga03n38_30348_c1
1120 nmdc:mga03n38_82620_c1
1121 nmdc:mga00v17_11965_c1
1122 nmdc:mga00v17_1563_c1
1123 nmdc:mga00v17_3583_c1
1124 nmdc:mga0yw44_158276_c1
1125 nmdc:mga0yw44_330966_c1
1126 nmdc:mga0k408_149619_c1
1127 nmdc:mga0k408_3784_c1
1128 nmdc:mga0k408_39900_c2
1129 nmdc:mga06z11_117_c1
1130 nmdc:mga06z11_295_c1
1131 nmdc:mga04h51_162_c1
1132 nmdc:mga04h51_178_c1
1133 nmdc:mga04h51_29230_c1
1134 nmdc:mga04h51_656_c1
1135 nmdc:mga07m45_21157_c1
1136 nmdc:mga07m45_22_c1
1137 nmdc:mga07m45_40998_c1
1138 nmdc:mga07m45_70616_c1
1139 nmdc:mga07m45_9859_c1
1140 nmdc:mga05p37_127775_c1
1141 nmdc:mga0sz30_144328_c1
1142 nmdc:mga0sz30_48389_c1
1143 nmdc:mga0sz30_714_c2
1144 Ga0495619_0384861
1145 Ga0500643_000385
1146 Ga0500643_002094
1147 Ga0500647_0066437
1148 Ga0500651_0345311
1149 Ga0500641_0061888
1150 Ga0500555_000163
1151 Ga0500592_001641
1152 Ga0500594_0009144
1153 Ga0500597_019103
1154 Ga0500607_000065
1155 Ga0500607_000386
1156 Ga0500614_016829
1157 Ga0500618_013410
1158 Ga0500618_031599
1159 Ga0500642_0000574
1160 Ga0500655_000165
1161 Ga0500658_0007915
1162 Ga0500559_0000668
1163 Ga0500559_0012091
1164 Ga0500559_0013370
1165 Ga0500559_0059748
1166 Ga0500568_0026023
1167 Ga0500577_0012472
1168 Ga0500577_0120786
1169 Ga0500577_0132164
1170 Ga0500590_000953
1171 Ga0500616_0010849
1172 Ga0500616_0035196
1173 Ga0500616_0041068
1174 Ga0500616_0129036
1175 Ga0500616_0152766
1176 Ga0500622_0002328
1177 Ga0500622_0034813
1178 Ga0500622_0132477
1179 Ga0500624_000012
1180 Ga0500624_000020
1181 Ga0500624_000061
1182 Ga0500627_0000013
1183 Ga0500639_096613
1184 Ga0500636_0001685
1185 Ga0500636_0041154
1186 Ga0500637_0000022
1187 Ga0500637_0006428
1188 Ga0500570_053881
1189 Ga0500645_020731
1190 Ga0500645_037940
1191 Ga0500661_004899
1192 Ga0466962_0011448
1193 2511128233
1194 2512645509
1195 2585262113
1196 2585262301
1197 2600200538
1198 2643731408
1199 2643822632
1200 2643822876
1201 2643833855
1202 2644042264
1203 2644054781
1204 2644394094
1205 2809064602
1206 2809080487
1207 2809084851
1208 2819552183
1209 2830076898
1210 2852653561
1211 2852656830
1212 2852683846
1213 2852683925
1214 2909047266
1215 2928030365
1216 2928971819
1217 2946789654
1218 2984555766
1219 2984566124
1220 2990268660
1221 2993357136
1222 2993694634
1223 8054303857
1224 8057101691

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08282

Hydrolase_3

haloacid dehalogenase-like hydrolase

178

257

0.86

PF03332

PMM

Eukaryotic phosphomannomutase

63

284

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
4bnd-assembly2.cif.gz_B structure of an atypical alpha-phosphoglucomutase similar to eukaryotic phosphomannomutases 0.9199 42 287
4bnd-assembly2.cif.gz_A structure of an atypical alpha-phosphoglucomutase similar to eukaryotic phosphomannomutases 0.9193 42 287
4bnd-assembly2.cif.gz_A structure of an atypical alpha-phosphoglucomutase similar to eukaryotic phosphomannomutases 0.8953 42 287
4bnd-assembly2.cif.gz_B structure of an atypical alpha-phosphoglucomutase similar to eukaryotic phosphomannomutases 0.8925 42 287
2no5-assembly1.cif.gz_B crystal structure analysis of a dehalogenase with intermediate complex 0.7985 228 271
ID Description Score Start End Superfamily
4bndA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9734 42 287 3.40.50.1000
4bndA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.949 42 287 3.40.50.1000
4bndB02 Alpha Beta;2-Layer Sandwich;Hypothetical Protein, Haloacid Dehalogenase-like Hydrolase; Chain: A; domain 2;Eukaryotic phosphomannomutase, cap domain 0.928 132 223 3.30.1240.20
4bndB02 Alpha Beta;2-Layer Sandwich;Hypothetical Protein, Haloacid Dehalogenase-like Hydrolase; Chain: A; domain 2;Eukaryotic phosphomannomutase, cap domain 0.8822 132 223 3.30.1240.20
6cfsA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8564 43 284 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A5N6KS71-F1-model_v4 Phosphomannomutase (EC 5.4.2.8) 0.9972 42 290 GO:0004615
GO:0005829
GO:0006013
GO:0006487
GO:0009298
GO:0046872
AF-A0A2A2K688-F1-model_v4 phosphomannomutase (EC 5.4.2.8) 0.9951 66 288 GO:0004615
GO:0005737
GO:0009298
GO:0046872
AF-D4D4Z5-F1-model_v4 phosphomannomutase (EC 5.4.2.8) 0.9892 42 288 GO:0004615
GO:0005737
GO:0009298
GO:0046872
AF-A0A520IRZ7-F1-model_v4 HAD family hydrolase 0.9889 42 127
AF-A0A1J9RXN2-F1-model_v4 Phosphomannomutase (EC 5.4.2.8) 0.9828 42 290 GO:0004615
GO:0005829
GO:0006013
GO:0006487
GO:0009298
GO:0046872

Map