F469249

General Info

Members Datasets Scaffolds Average Seq Length
613 336 590 333

Family's Representative Sequence

Representative Sequence 3300009176|Ga0105242_10015533|Ga0105242_100155333
Length 356
Sequence VRGCNRPAAYRANAVGGLRLSILDQSPIVSGGSSADALRATVALAQRADQLGYHRYWLAEHHNMRGLADPCPEILVGHVAAATRTIRVGTGGVMLPYYSPLKVAEVFRMHEALHPRRIDLGIGRAPGGDRMTANAMNAHAFDDMEDFPRQVMEVVGWLDRTLPEEHPYSTVQAMPSGLGSPEVWLLGSSDYSGALAAYLGLRFAFAHFINAHGGDAVARAYRTDFRASLRESAPYSMVCVFALCAQTEAEAQRLALSIDHRRLLMSVGREAPIASVAEAQAYPYTDRDRAIIERXXARAIIGTPDKVKSRLLEIAESYGADELMVVTITGDYASRMRSYELLAAEFALDTATGAAA

Samples

Sample ID Description Type Environment
1 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
2 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
3 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
4 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
5 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
6 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
7 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
8 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
9 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
10 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
11 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
12 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
13 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
14 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
15 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
16 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
17 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
18 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
19 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
20 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
21 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
22 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
23 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
24 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
25 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
26 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
27 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
28 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
29 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
30 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
31 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
32 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
33 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
34 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
35 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
36 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
37 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
38 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
39 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
40 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
41 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
42 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
43 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
44 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
45 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
46 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
47 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
52 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
59 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
72 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
78 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
79 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
84 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
91 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
92 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
93 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
94 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
100 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
118 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
119 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
121 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
123 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
170 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
174 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
175 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
176 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
177 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
178 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
179 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
180 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
181 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
182 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
183 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
184 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
185 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
186 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
187 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
188 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
189 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
190 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
191 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
192 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
193 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
194 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
195 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
196 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
197 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
198 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
199 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
200 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
201 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
202 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
203 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
204 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
205 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
206 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
207 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
208 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
209 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
210 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
211 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
212 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
213 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
214 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
215 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
216 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
217 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
218 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
219 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
220 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
221 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
222 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
223 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
224 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
225 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
226 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
227 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
228 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
229 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
230 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
231 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
232 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
233 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
234 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
235 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
236 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
237 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
238 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
239 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
240 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
241 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
242 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
243 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
244 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
245 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
246 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
247 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
248 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
249 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
250 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
251 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
252 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
253 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
254 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
255 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
256 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
257 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
258 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
259 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
260 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
261 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
262 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
263 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
264 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
265 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
266 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
267 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
268 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
269 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
270 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
271 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
272 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
273 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
274 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
275 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
276 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
277 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
278 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
279 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
280 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
281 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
282 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
283 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
284 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
285 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
286 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
287 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
288 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
289 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
290 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
291 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
292 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
293 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
295 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
298 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
301 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
303 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
304 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
305 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
306 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
307 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
308 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
309 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
310 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
311 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
312 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
313 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
314 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
316 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
317 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
318 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
319 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
320 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
321 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
322 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
323 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
324 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
325 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
326 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
327 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
328 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
329 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
330 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
331 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
332 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
333 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
334 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
335 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
336 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.25
Metatranscriptomes 0
Isolates 3.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.94
Nodule 0.98
Rhizoplane 2.45
Rhizosphere 90.05
Stem 0
Stem Tuber 0
Unclassified 3.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10002509 3300003187 Bacteria 10932
2 rootL2_10089033 3300003322 Bacteria 2154
3 JGI25160J50197_1000279 3300003354 Bacteria 37135
4 Ga0055526_1008754 3300003771 Bacteria 4990
5 Ga0070676_10124668 3300005328 Bacteria 1621
6 Ga0070683_100331926 3300005329 Unclassified 1448
7 Ga0070690_100000235 3300005330 Bacteria 28411
8 Ga0070690_100009422 3300005330 Bacteria 5657
9 Ga0070690_100059202 3300005330 Bacteria 2462
10 Ga0070690_100129672 3300005330 Bacteria 1702
11 Ga0070670_100084019 3300005331 Bacteria 2735
12 Ga0070670_100137031 3300005331 Unclassified 2115
13 Ga0068869_100000023 3300005334 Bacteria 64701
14 Ga0068869_100002090 3300005334 Bacteria 12011
15 Ga0068869_100019561 3300005334 Bacteria 4629
16 Ga0068869_100030337 3300005334 Bacteria 3795
17 Ga0070666_10053867 3300005335 Bacteria 2714
18 Ga0070666_10083907 3300005335 Bacteria 2180
19 Ga0070680_100086548 3300005336 Bacteria 2590
20 Ga0068868_100006228 3300005338 Bacteria 8444
21 Ga0068868_100234279 3300005338 Bacteria 1541
22 Ga0070689_100087696 3300005340 Bacteria 2448
23 Ga0070689_100194966 3300005340 Bacteria 1651
24 Ga0070691_10015276 3300005341 Bacteria 3528
25 Ga0070661_100042312 3300005344 Bacteria 3325
26 Ga0070692_10031590 3300005345 Bacteria 2655
27 Ga0070669_100010026 3300005353 Bacteria 6735
28 Ga0070669_100322688 3300005353 Bacteria 1247
29 Ga0070675_100014453 3300005354 Bacteria 6225
30 Ga0070675_100039701 3300005354 Unclassified 3842
31 Ga0070675_100082502 3300005354 Bacteria 2682
32 Ga0070671_100030089 3300005355 Bacteria 4480
33 Ga0070673_100330176 3300005364 Bacteria 1349
34 Ga0070659_100106723 3300005366 Bacteria 2258
35 Ga0070667_100019707 3300005367 Bacteria 5596
36 Ga0070701_10043994 3300005438 Bacteria 2287
37 Ga0070705_100056581 3300005440 Bacteria 2310
38 Ga0070705_100057026 3300005440 Bacteria 2302
39 Ga0070705_100136565 3300005440 Bacteria 1607
40 Ga0070700_100003807 3300005441 Bacteria 7813
41 Ga0070700_100215098 3300005441 Bacteria 1358
42 Ga0070694_100035196 3300005444 Bacteria 3308
43 Ga0070694_100052129 3300005444 Bacteria 2764
44 Ga0070694_100081891 3300005444 Bacteria 2246
45 Ga0070694_100100704 3300005444 Bacteria 2044
46 Ga0070663_100003243 3300005455 Bacteria 9358
47 Ga0070681_10000688 3300005458 Bacteria 28034
48 Ga0070681_10016598 3300005458 Bacteria 7352
49 Ga0068867_100003419 3300005459 Bacteria 11170
50 Ga0068867_100041406 3300005459 Bacteria 3367
51 Ga0068867_100075236 3300005459 Bacteria 2533
52 Ga0070698_100020071 3300005471 Bacteria 7005
53 Ga0070699_100047497 3300005518 Bacteria 3715
54 Ga0070699_100191762 3300005518 Bacteria 1816
55 Ga0070679_100008648 3300005530 Bacteria 9593
56 Ga0070679_100078972 3300005530 Bacteria 3280
57 Ga0070697_100012729 3300005536 Bacteria 6587
58 Ga0068853_100025143 3300005539 Bacteria 4996
59 Ga0070672_100207613 3300005543 Bacteria 1640
60 Ga0070686_100137211 3300005544 Bacteria 1698
61 Ga0070695_100002624 3300005545 Bacteria 10393
62 Ga0070695_100063595 3300005545 Bacteria 2399
63 Ga0070695_100086681 3300005545 Bacteria 2081
64 Ga0070695_100090910 3300005545 Bacteria 2038
65 Ga0070696_100010019 3300005546 Bacteria 6339
66 Ga0070696_100075870 3300005546 Bacteria 2372
67 Ga0070693_100031745 3300005547 Bacteria 2898
68 Ga0070665_100066943 3300005548 Bacteria 3603
69 Ga0070665_100361293 3300005548 Bacteria 1458
70 Ga0070704_100005124 3300005549 Bacteria 7614
71 Ga0070704_100116830 3300005549 Bacteria 2041
72 Ga0068855_100085723 3300005563 Bacteria 3644
73 Ga0068857_100166146 3300005577 Bacteria 2004
74 Ga0068857_100264011 3300005577 Bacteria 1581
75 Ga0068857_100330929 3300005577 Bacteria 1408
76 Ga0068854_100165149 3300005578 Bacteria 1718
77 Ga0070702_100030421 3300005615 Bacteria 2944
78 Ga0068859_100014728 3300005617 Bacteria 7859
79 Ga0068859_100049658 3300005617 Bacteria 4213
80 Ga0068859_100061028 3300005617 Bacteria 3799
81 Ga0068859_100111076 3300005617 Bacteria 2803
82 Ga0068859_100147708 3300005617 Bacteria 2426
83 Ga0068859_100367817 3300005617 Bacteria 1533
84 Ga0068864_100012457 3300005618 Bacteria 7031
85 Ga0068866_10003557 3300005718 Bacteria 6377
86 Ga0068861_100009150 3300005719 Bacteria 6832
87 Ga0068861_100026678 3300005719 Bacteria 4202
88 Ga0068851_10033819 3300005834 Unclassified 2549
89 Ga0068870_10031043 3300005840 Bacteria 2704
90 Ga0068870_10095534 3300005840 Bacteria 1670
91 Ga0068863_100006757 3300005841 Bacteria 11247
92 Ga0068863_100043668 3300005841 Bacteria 4254
93 Ga0068858_100037353 3300005842 Bacteria 4504
94 Ga0068858_100090779 3300005842 Bacteria 2843
95 Ga0068858_100191946 3300005842 Bacteria 1930
96 Ga0068860_100064634 3300005843 Bacteria 3475
97 Ga0068862_100030956 3300005844 Bacteria 4512
98 Ga0068862_100069128 3300005844 Bacteria 3048
99 Ga0068862_100231531 3300005844 Bacteria 1676
100 Ga0068862_100349214 3300005844 Bacteria 1372
101 Ga0081539_10000233 3300005985 Bacteria 130647
102 Ga0070716_100008408 3300006173 Bacteria 5119
103 Ga0075366_10037538 3300006195 Bacteria 2861
104 Ga0097621_100040818 3300006237 Bacteria 3732
105 Ga0097621_100082294 3300006237 Unclassified 2680
106 Ga0097621_100118648 3300006237 Bacteria 2242
107 Ga0097621_100173833 3300006237 Bacteria 1858
108 Ga0068871_100001140 3300006358 Bacteria 17815
109 Ga0068871_100019043 3300006358 Bacteria 5233
110 Ga0068871_100054419 3300006358 Bacteria 3247
111 Ga0075428_100023506 3300006844 Bacteria 6823
112 Ga0075428_100055956 3300006844 Bacteria 4321
113 Ga0075428_100329193 3300006844 Bacteria 1641
114 Ga0075430_100003660 3300006846 Bacteria 12905
115 Ga0075430_100005239 3300006846 Bacteria 10938
116 Ga0075430_100023708 3300006846 Bacteria 5226
117 Ga0075431_100016781 3300006847 Bacteria 7437
118 Ga0075431_100046537 3300006847 Bacteria 4474
119 Ga0075431_100071633 3300006847 Bacteria 3576
120 Ga0075431_100221696 3300006847 Bacteria 1929
121 Ga0075431_100288268 3300006847 Bacteria 1661
122 Ga0075434_100028537 3300006871 Bacteria 5484
123 Ga0075434_100223841 3300006871 Bacteria 1901
124 Ga0075429_100000107 3300006880 Bacteria 47068
125 Ga0075429_100188325 3300006880 Bacteria 1808
126 Ga0068865_100004941 3300006881 Bacteria 8059
127 Ga0068865_100009129 3300006881 Bacteria 6138
128 Ga0068865_100039257 3300006881 Bacteria 3210
129 Ga0068865_100118240 3300006881 Bacteria 1966
130 Ga0075436_100000174 3300006914 Bacteria 40099
131 Ga0075436_100007287 3300006914 Bacteria 7564
132 Ga0075436_100014820 3300006914 Bacteria 5341
133 Ga0075436_100022801 3300006914 Bacteria 4301
134 Ga0097620_100014728 3300006931 Bacteria 7859
135 Ga0097620_100049654 3300006931 Bacteria 4213
136 Ga0097620_100061031 3300006931 Bacteria 3799
137 Ga0097620_100111067 3300006931 Bacteria 2803
138 Ga0097620_100147712 3300006931 Bacteria 2426
139 Ga0097620_100367823 3300006931 Bacteria 1533
140 Ga0099826_10000018 3300006948 Bacteria 198330
141 Ga0075435_100017409 3300007076 Bacteria 5441
142 Ga0099794_10003315 3300007265 Bacteria 6113
143 Ga0099795_10009238 3300007788 Bacteria 2851
144 Ga0105251_10001210 3300009011 Bacteria 22309
145 Ga0111539_10005851 3300009094 Bacteria 15896
146 Ga0111539_10022294 3300009094 Bacteria 7784
147 Ga0111539_10037272 3300009094 Bacteria 5874
148 Ga0111539_10510677 3300009094 Bacteria 1400
149 Ga0105245_10140163 3300009098 Bacteria 2276
150 Ga0114129_10017740 3300009147 Bacteria 10135
151 Ga0114129_10121767 3300009147 Bacteria 3590
152 Ga0114129_10227481 3300009147 Bacteria 2513
153 Ga0105243_10115073 3300009148 Bacteria 2258
154 Ga0105243_10190844 3300009148 Unclassified 1789
155 Ga0105241_10003849 3300009174 Bacteria 11126
156 Ga0105242_10015533 3300009176 Bacteria 5914
157 Ga0105248_10018203 3300009177 Bacteria 7759
158 Ga0105248_10037595 3300009177 Bacteria 5416
159 Ga0105237_10022420 3300009545 Bacteria 6480
160 Ga0105237_10310694 3300009545 Bacteria 1580
161 Ga0105249_10135007 3300009553 Bacteria 2360
162 Ga0105249_10188415 3300009553 Bacteria 2012
163 Ga0105249_10339772 3300009553 Bacteria 1518
164 Ga0099796_10097427 3300010159 Bacteria 1102
165 Ga0105239_10034652 3300010375 Bacteria 5545
166 Ga0105239_10418537 3300010375 Bacteria 1517
167 Ga0105246_10035404 3300011119 Bacteria 3337
168 Ga0157369_10270331 3300013105 Bacteria 1771
169 Ga0157378_10009009 3300013297 Bacteria 8689
170 Ga0157378_10059116 3300013297 Bacteria 3419
171 Ga0157378_10357731 3300013297 Bacteria 1428
172 Ga0163162_10000679 3300013306 Bacteria 31608
173 Ga0163162_10031995 3300013306 Bacteria 5222
174 Ga0163162_10107754 3300013306 Bacteria 2882
175 Ga0157375_10019124 3300013308 Bacteria 6221
176 Ga0157375_10034066 3300013308 Bacteria 4847
177 Ga0157375_10137543 3300013308 Unclassified 2568
178 Ga0157375_10157846 3300013308 Bacteria 2408
179 Ga0157380_10008501 3300014326 Bacteria 7334
180 Ga0157380_10221476 3300014326 Bacteria 1693
181 Ga0157377_10046903 3300014745 Bacteria 2419
182 Ga0157379_10232100 3300014968 Bacteria 1673
183 Ga0157376_10028680 3300014969 Bacteria 4427
184 Ga0157376_10040781 3300014969 Unclassified 3796
185 Ga0157376_10055394 3300014969 Bacteria 3308
186 Ga0183361_10009 3300016635 Bacteria 205218
187 Ga0163161_10121651 3300017792 Unclassified 1962
188 Ga0209130_1006067 3300025284 Bacteria 4012
189 Ga0209675_1000100 3300025291 Bacteria 128565
190 Ga0209676_1000012 3300025292 Bacteria 841431
191 Ga0209025_1001877 3300025294 Bacteria 24578
192 Ga0209025_1032186 3300025294 Bacteria 2459
193 Ga0209564_1002674 3300025295 Bacteria 13531
194 Ga0209564_1002716 3300025295 Bacteria 13354
195 Ga0207426_1006086 3300025302 Bacteria 5321
196 Ga0207656_10023035 3300025321 Bacteria 2504
197 Ga0207713_1003216 3300025735 Bacteria 11274
198 Ga0207642_10017270 3300025899 Bacteria 2740
199 Ga0207642_10035862 3300025899 Bacteria 2123
200 Ga0207680_10039106 3300025903 Bacteria 2750
201 Ga0207647_10063243 3300025904 Bacteria 2251
202 Ga0207705_10336356 3300025909 Bacteria 1162
203 Ga0207654_10027853 3300025911 Bacteria 3075
204 Ga0207707_10021130 3300025912 Bacteria 5688
205 Ga0207671_10205945 3300025914 Bacteria 1537
206 Ga0207660_10056874 3300025917 Bacteria 2800
207 Ga0207649_10138249 3300025920 Unclassified 1663
208 Ga0207681_10017627 3300025923 Bacteria 4487
209 Ga0207650_10001780 3300025925 Bacteria 15235
210 Ga0207650_10020629 3300025925 Bacteria 4648
211 Ga0207650_10144682 3300025925 Unclassified 1871
212 Ga0207659_10004000 3300025926 Bacteria 8895
213 Ga0207659_10008630 3300025926 Bacteria 6340
214 Ga0207659_10181973 3300025926 Bacteria 1666
215 Ga0207659_10365314 3300025926 Bacteria 1200
216 Ga0207687_10030877 3300025927 Bacteria 3617
217 Ga0207706_10007023 3300025933 Bacteria 10409
218 Ga0207686_10035164 3300025934 Bacteria 3005
219 Ga0207709_10008967 3300025935 Bacteria 5517
220 Ga0207709_10182491 3300025935 Bacteria 1483
221 Ga0207670_10107510 3300025936 Bacteria 2003
222 Ga0207670_10126052 3300025936 Bacteria 1869
223 Ga0207670_10272853 3300025936 Bacteria 1315
224 Ga0207704_10007294 3300025938 Bacteria 5215
225 Ga0207704_10024233 3300025938 Bacteria 3286
226 Ga0207704_10090420 3300025938 Bacteria 2009
227 Ga0207665_10000863 3300025939 Bacteria 20487
228 Ga0207691_10022571 3300025940 Bacteria 5933
229 Ga0207691_10162699 3300025940 Bacteria 1957
230 Ga0207691_10263422 3300025940 Unclassified 1486
231 Ga0207689_10001838 3300025942 Bacteria 20080
232 Ga0207689_10011310 3300025942 Bacteria 7658
233 Ga0207689_10023895 3300025942 Bacteria 5127
234 Ga0207689_10137006 3300025942 Unclassified 2016
235 Ga0207679_10148378 3300025945 Unclassified 1905
236 Ga0207667_10093541 3300025949 Bacteria 3104
237 Ga0207651_10132394 3300025960 Bacteria 1911
238 Ga0207651_10155229 3300025960 Bacteria 1787
239 Ga0207712_10021581 3300025961 Bacteria 4229
240 Ga0207658_10100983 3300025986 Bacteria 2260
241 Ga0207677_10406912 3300026023 Bacteria 1155
242 Ga0207703_10084380 3300026035 Bacteria 2656
243 Ga0207639_10017759 3300026041 Bacteria 5045
244 Ga0207639_10022045 3300026041 Bacteria 4584
245 Ga0207678_10007848 3300026067 Bacteria 9417
246 Ga0207708_10001796 3300026075 Bacteria 15801
247 Ga0207708_10014335 3300026075 Bacteria 5931
248 Ga0207708_10014488 3300026075 Bacteria 5900
249 Ga0207708_10127660 3300026075 Bacteria 1986
250 Ga0207641_10024724 3300026088 Bacteria 4951
251 Ga0207648_10002392 3300026089 Bacteria 20203
252 Ga0207648_10005404 3300026089 Bacteria 12878
253 Ga0207648_10026173 3300026089 Bacteria 5186
254 Ga0207648_10079866 3300026089 Bacteria 2853
255 Ga0207648_10180258 3300026089 Bacteria 1869
256 Ga0207676_10003104 3300026095 Bacteria 11853
257 Ga0207674_10080555 3300026116 Bacteria 3259
258 Ga0207674_10140223 3300026116 Bacteria 2377
259 Ga0207674_10198225 3300026116 Bacteria 1957
260 Ga0207674_10253358 3300026116 Unclassified 1707
261 Ga0207674_10255971 3300026116 Bacteria 1697
262 Ga0207675_100012953 3300026118 Bacteria 7787
263 Ga0207675_100043011 3300026118 Bacteria 4218
264 Ga0207683_10018182 3300026121 Bacteria 5995
265 Ga0207683_10019442 3300026121 Bacteria 5800
266 Ga0207698_10373842 3300026142 Bacteria 1354
267 Ga0210000_1001084 3300027462 Bacteria 3811
268 Ga0210000_1004157 3300027462 Bacteria 2091
269 Ga0209995_1007759 3300027471 Bacteria 1729
270 Ga0209995_1010912 3300027471 Bacteria 1476
271 Ga0209999_1002676 3300027543 Bacteria 3150
272 Ga0209999_1009959 3300027543 Bacteria 1716
273 Ga0209971_1005841 3300027682 Bacteria 2915
274 Ga0209966_1001147 3300027695 Bacteria 4733
275 Ga0209974_10000470 3300027876 Bacteria 13400
276 Ga0207428_10002806 3300027907 Bacteria 17304
277 Ga0207428_10053294 3300027907 Bacteria 3226
278 Ga0268266_10053509 3300028379 Bacteria 3469
279 Ga0268266_10315200 3300028379 Bacteria 1462
280 Ga0268266_10414575 3300028379 Bacteria 1276
281 Ga0268265_10016240 3300028380 Bacteria 5110
282 Ga0268265_10116117 3300028380 Bacteria 2195
283 Ga0268265_10333094 3300028380 Bacteria 1379
284 Ga0268264_10147790 3300028381 Bacteria 2103
285 Ga0265338_10001217 3300028800 Bacteria 42536
286 Ga0307511_10000108 3300030521 Bacteria 74238
287 Ga0265328_10022541 3300031239 Bacteria 2395
288 Ga0265329_10012019 3300031242 Bacteria 3128
289 Ga0265339_10163541 3300031249 Bacteria 1118
290 Ga0265331_10003333 3300031250 Bacteria 10423
291 Ga0265327_10014887 3300031251 Bacteria 5063
292 Ga0265316_10012711 3300031344 Bacteria 7527
293 Ga0307408_100137853 3300031548 Bacteria 1911
294 Ga0307408_100402255 3300031548 Bacteria 1176
295 Ga0316575_10003242 3300031665 Bacteria 5587
296 Ga0316575_10020705 3300031665 Bacteria 2525
297 Ga0316579_10009712 3300031691 Bacteria 4050
298 Ga0265314_10026186 3300031711 Bacteria 4385
299 Ga0316578_10019166 3300031728 Bacteria 3760
300 Ga0307413_10351759 3300031824 Bacteria 1137
301 Ga0307416_100014967 3300032002 Bacteria 5339
302 Ga0307416_100106501 3300032002 Bacteria 2458
303 Ga0307507_10038968 3300033179 Bacteria 4805
304 Ga0373934_0000044 3300035086 Bacteria 41857
305 Ga0373934_0030676 3300035086 Bacteria 2102
306 Ga0373923_0023873 3300035111 Bacteria 2409
307 Ga0373936_0001037 3300035113 Bacteria 9932
308 Ga0373936_0005669 3300035113 Bacteria 4709
309 Ga0373945_0000906 3300035116 Bacteria 8768
310 Ga0373954_0000020 3300035118 Bacteria 60211
311 Ga0373954_0004897 3300035118 Bacteria 5778
312 Ga0373954_0055678 3300035118 Bacteria 1860
313 Ga0373956_0000003 3300035119 Bacteria 81669
314 Ga0373956_0005962 3300035119 Bacteria 4873
315 Ga0373957_0002342 3300035120 Bacteria 5386
316 Ga0373957_0036047 3300035120 Bacteria 1841
317 Ga0373943_0016340 3300035170 Bacteria 3383
318 Ga0373943_0169279 3300035170 Bacteria 1194
319 Ga0373946_0009414 3300035171 Bacteria 3597
320 Ga0373946_0023271 3300035171 Bacteria 2419
321 Ga0373955_0012959 3300035172 Bacteria 4019
322 Ga0373955_0016708 3300035172 Bacteria 3616
323 Ga0373962_0019089 3300035242 Bacteria 1790
324 Ga0316574_0018491 3300035398 Bacteria 4096
325 Ga0373924_0019331 3300035410 Bacteria 2638
326 Ga0373931_0032335 3300035691 Bacteria 2707
327 Ga0373931_0127047 3300035691 Unclassified 1463
328 Ga0373931_0129370 3300035691 Bacteria 1451
329 Ga0373935_0008672 3300035692 Bacteria 6086
330 Ga0373935_0012489 3300035692 Bacteria 5107
331 Ga0373935_0014087 3300035692 Bacteria 4827
332 Ga0373927_0025420 3300035695 Bacteria 3872
333 Ga0373927_0214445 3300035695 Bacteria 1264
334 Ga0373933_0000107 3300035724 Bacteria 53134
335 Ga0373933_0004387 3300035724 Bacteria 7746
336 Ga0373933_0021741 3300035724 Bacteria 3647
337 Ga0373933_0084844 3300035724 Bacteria 1946
338 Ga0373947_0090163 3300035725 Bacteria 1911
339 Ga0373937_0000179 3300036401 Bacteria 62280
340 Ga0373937_0000196 3300036401 Bacteria 59256
341 Ga0373937_0023517 3300036401 Bacteria 5549
342 Ga0373937_0127941 3300036401 Bacteria 2371
343 Ga0373937_0270218 3300036401 Bacteria 1604
344 Ga0373937_0357400 3300036401 Bacteria 1384
345 Ga0373925_0333686 3300037068 Bacteria 1229
346 Ga0436360_0400716 3300039438 Bacteria 1106
347 Ga0439436_0006031 3300041404 Bacteria 3714
348 Ga0451839_1137150 3300041496 Bacteria 1095
349 Ga0439441_001631 3300042001 Bacteria 2995
350 Ga0439441_002320 3300042001 Bacteria 2669
351 Ga0450920_004910 3300042122 Bacteria 2364
352 Ga0439446_0061945 3300042156 Bacteria 1132
353 Ga0439434_0001975 3300042435 Bacteria 5939
354 Ga0439435_0000025 3300042436 Bacteria 16268
355 Ga0451577_0205479 3300042876 Bacteria 1778
356 Ga0451577_0365537 3300042876 Bacteria 1309
357 Ga0466969_0025156 3300044656 Bacteria 3063
358 Ga0453684_0272373 3300044712 Bacteria 1934
359 Ga0466970_0102432 3300044765 Bacteria 1560
360 Ga0451576_0036919 3300045051 Bacteria 5177
361 Ga0451576_0248265 3300045051 Bacteria 1860
362 Ga0451576_0421390 3300045051 Bacteria 1400
363 Ga0466967_0558806 3300045976 Bacteria 1127
364 Ga0495592_0007672 3300046454 Bacteria 8076
365 Ga0495592_0022957 3300046454 Bacteria 4747
366 Ga0495603_0033367 3300046455 Bacteria 3097
367 Ga0495603_0040850 3300046455 Bacteria 2775
368 Ga0495590_0000630 3300046457 Bacteria 16380
369 Ga0495590_0022510 3300046457 Bacteria 2229
370 Ga0495629_0071962 3300046459 Bacteria 2413
371 Ga0495629_0172360 3300046459 Bacteria 1501
372 Ga0495641_0011338 3300046461 Bacteria 5088
373 Ga0495651_0000105 3300046462 Bacteria 61688
374 Ga0495653_0016485 3300046463 Bacteria 6014
375 Ga0495580_0008453 3300046472 Bacteria 8188
376 Ga0495580_0022721 3300046472 Bacteria 4611
377 Ga0495582_0015437 3300046473 Bacteria 4195
378 Ga0495582_0165219 3300046473 Bacteria 1259
379 Ga0495605_0021878 3300046474 Bacteria 3382
380 Ga0495639_0011536 3300046475 Bacteria 3811
381 Ga0495662_0008758 3300046476 Bacteria 4977
382 Ga0495662_0016590 3300046476 Bacteria 3568
383 Ga0495606_0063944 3300046507 Bacteria 2343
384 Ga0495606_0086766 3300046507 Bacteria 1933
385 Ga0495608_0001028 3300046511 Bacteria 19566
386 Ga0495618_0010655 3300046514 Bacteria 5564
387 Ga0495618_0057962 3300046514 Bacteria 2452
388 Ga0495620_0018493 3300046515 Bacteria 3450
389 Ga0495628_0004763 3300046516 Bacteria 11955
390 Ga0495628_0015546 3300046516 Bacteria 6354
391 Ga0495628_0016012 3300046516 Bacteria 6255
392 Ga0495628_0072664 3300046516 Bacteria 2680
393 Ga0495628_0188951 3300046516 Bacteria 1556
394 Ga0495630_0001187 3300046517 Bacteria 17958
395 Ga0495630_0012901 3300046517 Bacteria 6071
396 Ga0495630_0129733 3300046517 Bacteria 1914
397 Ga0495666_0007432 3300046526 Bacteria 5491
398 Ga0495666_0031526 3300046526 Bacteria 2596
399 Ga0495666_0046395 3300046526 Bacteria 2094
400 Ga0495642_0010968 3300046528 Bacteria 3474
401 Ga0495642_0045194 3300046528 Bacteria 1800
402 Ga0495652_0003931 3300046529 Bacteria 14435
403 Ga0495652_0071319 3300046529 Bacteria 2900
404 Ga0495652_0209072 3300046529 Bacteria 1475
405 Ga0495652_0315504 3300046529 Bacteria 1131
406 Ga0495665_0014916 3300046531 Bacteria 4184
407 Ga0495665_0023190 3300046531 Bacteria 3332
408 Ga0495665_0109617 3300046531 Bacteria 1448
409 Ga0495640_0018063 3300046533 Bacteria 5241
410 Ga0495640_0039390 3300046533 Bacteria 3316
411 Ga0495586_0012876 3300046535 Bacteria 4435
412 Ga0495586_0144227 3300046535 Bacteria 1337
413 Ga0495587_0031268 3300046536 Bacteria 3224
414 Ga0495587_0149903 3300046536 Bacteria 1329
415 Ga0495598_0001660 3300046537 Bacteria 4466
416 Ga0495597_0007513 3300046542 Bacteria 5527
417 Ga0495645_0002326 3300046543 Bacteria 12893
418 Ga0495645_0163772 3300046543 Bacteria 1535
419 Ga0495645_0165059 3300046543 Bacteria 1528
420 Ga0495622_0089957 3300046557 Bacteria 1410
421 Ga0495667_0000709 3300046559 Bacteria 21330
422 Ga0495656_0042980 3300046615 Bacteria 1895
423 Ga0495668_0163395 3300046616 Bacteria 1220
424 Ga0495634_0002751 3300046642 Bacteria 14465
425 Ga0495657_0056249 3300046675 Bacteria 2620
426 Ga0495599_0017778 3300046678 Bacteria 4425
427 Ga0495599_0035454 3300046678 Bacteria 3132
428 Ga0495623_0024279 3300046679 Bacteria 3907
429 Ga0495647_0000149 3300046681 Bacteria 17854
430 Ga0495658_0004885 3300046683 Bacteria 6577
431 Ga0495669_0010017 3300046684 Bacteria 4007
432 Ga0495669_0015535 3300046684 Bacteria 3261
433 Ga0495669_0182772 3300046684 Bacteria 1000
434 Ga0495670_0007900 3300046691 Bacteria 5230
435 Ga0495649_0021009 3300046694 Bacteria 3660
436 Ga0495589_0017714 3300046794 Bacteria 3655
437 Ga0495589_0094820 3300046794 Bacteria 1448
438 Ga0495600_0005190 3300046809 Bacteria 7830
439 Ga0495604_0013367 3300047317 Bacteria 6537
440 Ga0495604_0104703 3300047317 Bacteria 2072
441 Ga0495676_0024337 3300047321 Bacteria 5244
442 Ga0495680_0013596 3300047322 Bacteria 7091
443 Ga0495680_0014849 3300047322 Bacteria 6732
444 Ga0495680_0078630 3300047322 Bacteria 2496
445 Ga0495680_0091382 3300047322 Bacteria 2282
446 Ga0495680_0167984 3300047322 Bacteria 1589
447 Ga0495683_0001407 3300047323 Bacteria 15868
448 Ga0495683_0079052 3300047323 Bacteria 1606
449 Ga0495687_000169 3300047443 Bacteria 97243
450 Ga0495675_0028377 3300047444 Bacteria 3567
451 Ga0495675_0118543 3300047444 Bacteria 1649
452 Ga0495684_0101956 3300047471 Bacteria 2169
453 Ga0495684_0103336 3300047471 Bacteria 2154
454 Ga0495593_0115617 3300047673 Bacteria 1367
455 Ga0495602_0016723 3300048088 Bacteria 7368
456 Ga0495614_0102793 3300048089 Bacteria 1250
457 Ga0496100_0043465 3300048903 Bacteria 2873
458 Ga0496100_0101744 3300048903 Bacteria 1981
459 Ga0496101_0014626 3300048904 Bacteria 5277
460 Ga0496101_0024961 3300048904 Bacteria 4143
461 Ga0496102_0001320 3300048905 Bacteria 22249
462 Ga0496102_0021149 3300048905 Bacteria 5753
463 Ga0496103_0007295 3300048906 Bacteria 6589
464 Ga0496103_0093651 3300048906 Bacteria 1897
465 Ga0496106_0017418 3300048909 Bacteria 5316
466 Ga0496106_0057379 3300048909 Bacteria 2944
467 Ga0496107_0010544 3300048910 Bacteria 6424
468 Ga0496110_0065985 3300048913 Unclassified 3200
469 Ga0496111_0023860 3300048914 Bacteria 4298
470 Ga0496113_0017346 3300048916 Bacteria 4995
471 Ga0496115_0339750 3300048918 Bacteria 1226
472 Ga0496116_0025650 3300048919 Bacteria 4329
473 Ga0496119_0078263 3300048922 Bacteria 1913
474 Ga0496122_0007506 3300048925 Bacteria 12093
475 Ga0496123_0057060 3300048926 Bacteria 2545
476 Ga0496124_0016661 3300048927 Bacteria 6973
477 Ga0496124_0126888 3300048927 Bacteria 2031
478 Ga0496125_0009210 3300048928 Bacteria 10201
479 Ga0496126_0006916 3300048929 Bacteria 12564
480 Ga0501034_0000235 3300049571 Bacteria 102844
481 Ga0501034_0005666 3300049571 Bacteria 13590
482 Ga0501034_0034677 3300049571 Bacteria 5117
483 Ga0501034_0128677 3300049571 Bacteria 2516
484 Ga0501036_0023727 3300049572 Bacteria 5169
485 Ga0501036_0098655 3300049572 Bacteria 2470
486 Ga0501036_0115111 3300049572 Bacteria 2272
487 Ga0501037_0008126 3300049573 Bacteria 7688
488 Ga0501038_0075226 3300049574 Bacteria 2855
489 Ga0501039_0004640 3300049575 Bacteria 10390
490 Ga0501039_0009714 3300049575 Bacteria 7333
491 Ga0501039_0043879 3300049575 Bacteria 3454
492 Ga0501039_0065971 3300049575 Bacteria 2809
493 Ga0501039_0173601 3300049575 Bacteria 1695
494 Ga0501040_0035670 3300049576 Bacteria 3374
495 Ga0501040_0040558 3300049576 Bacteria 3168
496 Ga0501040_0044985 3300049576 Bacteria 3010
497 Ga0501041_0001754 3300049577 Bacteria 12159
498 Ga0501041_0002164 3300049577 Bacteria 11086
499 Ga0501041_0005052 3300049577 Bacteria 7684
500 Ga0501041_0056473 3300049577 Bacteria 2399
501 Ga0501041_0123401 3300049577 Bacteria 1611
502 Ga0501041_0134693 3300049577 Bacteria 1539
503 Ga0501042_0014362 3300049578 Bacteria 5405
504 Ga0501042_0034026 3300049578 Bacteria 3614
505 Ga0501042_0091522 3300049578 Bacteria 2183
506 Ga0501042_0255720 3300049578 Bacteria 1264
507 Ga0501042_0289384 3300049578 Bacteria 1183
508 Ga0501046_0014507 3300049580 Bacteria 6645
509 Ga0501046_0036810 3300049580 Bacteria 3936
510 Ga0501046_0127722 3300049580 Bacteria 1930
511 Ga0501048_0006221 3300049582 Bacteria 9081
512 Ga0501048_0135102 3300049582 Bacteria 1743
513 Ga0501068_0000232 3300049584 Bacteria 27160
514 Ga0501068_0104779 3300049584 Bacteria 1755
515 Ga0501071_0010642 3300049587 Bacteria 6170
516 Ga0501071_0020400 3300049587 Bacteria 4605
517 Ga0501071_0055954 3300049587 Bacteria 2848
518 Ga0501071_0056794 3300049587 Bacteria 2828
519 Ga0501071_0066885 3300049587 Bacteria 2613
520 Ga0501072_0000763 3300049588 Bacteria 23454
521 Ga0501072_0001017 3300049588 Bacteria 20765
522 Ga0501072_0112707 3300049588 Bacteria 2165
523 Ga0501072_0115148 3300049588 Bacteria 2140
524 Ga0501072_0129126 3300049588 Bacteria 2014
525 Ga0501073_0000752 3300049589 Bacteria 22939
526 Ga0501073_0058294 3300049589 Bacteria 2699
527 Ga0501074_0035810 3300049590 Bacteria 3596
528 Ga0501074_0073533 3300049590 Bacteria 2455
529 Ga0501074_0143724 3300049590 Bacteria 1706
530 Ga0501075_0000926 3300049591 Bacteria 18608
531 Ga0501075_0004661 3300049591 Bacteria 9303
532 Ga0501075_0059159 3300049591 Bacteria 2886
533 Ga0501076_0000948 3300049592 Bacteria 18921
534 Ga0501076_0003118 3300049592 Bacteria 11548
535 Ga0501076_0011561 3300049592 Bacteria 6582
536 Ga0501076_0031041 3300049592 Bacteria 4164
537 Ga0501077_0016328 3300049593 Bacteria 4679
538 Ga0501077_0035197 3300049593 Bacteria 3188
539 Ga0501079_0000752 3300049741 Bacteria 22032
540 Ga0501079_0000812 3300049741 Bacteria 21278
541 Ga0501079_0147202 3300049741 Bacteria 1836
542 Ga0501080_0000996 3300049742 Bacteria 23234
543 Ga0501080_0038629 3300049742 Bacteria 4456
544 Ga0501080_0052445 3300049742 Bacteria 3796
545 Ga0501080_0062544 3300049742 Bacteria 3464
546 Ga0501080_0159439 3300049742 Bacteria 2084
547 Ga0501081_0000928 3300049743 Bacteria 17394
548 Ga0501081_0020876 3300049743 Bacteria 4370
549 Ga0501081_0105433 3300049743 Bacteria 1997
550 Ga0501081_0168534 3300049743 Bacteria 1580
551 Ga0501035_0046680 3300049822 Bacteria 3896
552 Ga0501045_0000399 3300049824 Bacteria 26386
553 Ga0501045_0008896 3300049824 Bacteria 7011
554 Ga0501045_0059667 3300049824 Bacteria 2795
555 nmdc:mga0k408_9059_c1 3300050493 Bacteria 5357
556 nmdc:mga05p37_1054_c1 3300050507 Bacteria 31460
557 nmdc:mga09592_100_c1 3300050508 Bacteria 52155
558 nmdc:mga0qj67_15521_c1 3300050509 Bacteria 5766
559 nmdc:mga0qj67_81_c1 3300050509 Bacteria 65783
560 nmdc:mga0qj67_9124_c1 3300050509 Bacteria 7360
561 nmdc:mga06r32_17414_c1 3300050510 Bacteria 6557
562 nmdc:mga06r32_292659_c1 3300050510 Bacteria 1615
563 nmdc:mga06r32_32788_c1 3300050510 Bacteria 4890
564 nmdc:mga06r32_553056_c1 3300050510 Bacteria 1125
565 nmdc:mga08y16_141005_c1 3300050511 Bacteria 2506
566 nmdc:mga08y16_2754_c1 3300050511 Bacteria 18021
567 nmdc:mga08y16_463707_c1 3300050511 Bacteria 1291
568 nmdc:mga08y16_52510_c1 3300050511 Bacteria 4265
569 nmdc:mga0n895_29098_c1 3300050512 Bacteria 5264
570 nmdc:mga0n895_303871_c1 3300050512 Bacteria 1617
571 nmdc:mga0rr50_56901_c1 3300050513 Bacteria 2923
572 nmdc:mga08x19_20027_c1 3300050514 Bacteria 4116
573 nmdc:mga08x19_20825_c1 3300050514 Bacteria 4042
574 nmdc:mga08x19_41159_c1 3300050514 Bacteria 2943
575 nmdc:mga08x19_62143_c1 3300050514 Bacteria 2421
576 Ga0495601_0000321 3300053077 Bacteria 25398
577 Ga0495595_0036022 3300053084 Bacteria 2243
578 Ga0500646_0003828 3300053090 Bacteria 3843
579 Ga0500594_0023518 3300053118 Bacteria 1563
580 Ga0500655_002776 3300053133 Bacteria 3179
581 Ga0500568_0013943 3300053139 Bacteria 3647
582 Ga0500604_0000154 3300053151 Bacteria 20178
583 Ga0501084_0007233 3300054114 Bacteria 9150
584 Ga0501084_0158523 3300054114 Bacteria 1909
585 Ga0501082_0005827 3300060353 Bacteria 10698
586 Ga0501082_0008788 3300060353 Bacteria 8710
587 Ga0501082_0141215 3300060353 Bacteria 2090
588 Ga0501082_0355212 3300060353 Bacteria 1278
589 Ga0530510_0000542 3300061734 Bacteria 24234
590 Ga0530510_0000661 3300061734 Bacteria 22301

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046684 Ga0495669_0182772 Ga0495669_0182772_126_959 275
2 3300027471 Ga0209995_1007759 Ga0209995_10077592 280
3 3300046476 Ga0495662_0008758 Ga0495662_0008758_1931_2818 294
4 3300046615 Ga0495656_0042980 Ga0495656_0042980_953_1840 294
5 iso_pu_bacteria 2919034639 2919034741 295
6 iso_pu_bacteria 2932426870 2932427919 295
7 3300042156 Ga0439446_0061945 Ga0439446_0061945_212_1108 297
8 3300026075 Ga0207708_10127660 Ga0207708_101276601 299
9 3300045976 Ga0466967_0558806 Ga0466967_0558806_94_1083 299
10 3300006847 Ga0075431_100071633 Ga0075431_1000716333 308
11 3300025321 Ga0207656_10023035 Ga0207656_100230352 312
12 3300025909 Ga0207705_10336356 Ga0207705_103363561 312
13 3300025920 Ga0207649_10138249 Ga0207649_101382492 312
14 3300025926 Ga0207659_10365314 Ga0207659_103653141 312
15 3300025940 Ga0207691_10022571 Ga0207691_100225715 312
16 3300025960 Ga0207651_10155229 Ga0207651_101552292 312
17 3300026023 Ga0207677_10406912 Ga0207677_104069121 312
18 3300026089 Ga0207648_10180258 Ga0207648_101802581 312
19 3300027543 Ga0209999_1009959 Ga0209999_10099592 312
20 3300028379 Ga0268266_10414575 Ga0268266_104145752 312
21 3300048906 Ga0496103_0093651 Ga0496103_0093651_358_1317 317
22 3300006881 Ga0068865_100118240 Ga0068865_1001182402 318
23 3300013297 Ga0157378_10357731 Ga0157378_103577311 318
24 3300025986 Ga0207658_10100983 Ga0207658_101009831 318
25 3300026089 Ga0207648_10026173 Ga0207648_100261734 318
26 3300049575 Ga0501039_0173601 Ga0501039_0173601_378_1403 318
27 3300049741 Ga0501079_0147202 Ga0501079_0147202_508_1533 318
28 3300006846 Ga0075430_100003660 Ga0075430_1000036606 319
29 3300006847 Ga0075431_100016781 Ga0075431_1000167815 319
30 3300031824 Ga0307413_10351759 Ga0307413_103517591 319
31 3300050509 nmdc:mga0qj67_81_c1 nmdc:mga0qj67_81_c1_49780_50745 319
32 3300050510 nmdc:mga06r32_32788_c1 nmdc:mga06r32_32788_c1_3265_4230 319
33 3300006880 Ga0075429_100188325 Ga0075429_1001883252 320
34 3300027462 Ga0210000_1004157 Ga0210000_10041572 320
35 3300027695 Ga0209966_1001147 Ga0209966_10011474 320
36 3300042001 Ga0439441_002320 Ga0439441_002320_1660_2625 320
37 3300053090 Ga0500646_0003828 Ga0500646_0003828_1966_3015 320
38 3300053133 Ga0500655_002776 Ga0500655_002776_2102_3151 320
39 3300053151 Ga0500604_0000154 Ga0500604_0000154_3313_4362 320
40 3300049578 Ga0501042_0255720 Ga0501042_0255720_41_1009 321
41 3300053139 Ga0500568_0013943 Ga0500568_0013943_2511_3560 321
42 3300005334 Ga0068869_100030337 Ga0068869_1000303373 322
43 3300005336 Ga0070680_100086548 Ga0070680_1000865482 322
44 3300005345 Ga0070692_10031590 Ga0070692_100315902 322
45 3300005353 Ga0070669_100010026 Ga0070669_1000100263 322
46 3300005354 Ga0070675_100014453 Ga0070675_1000144533 322
47 3300005440 Ga0070705_100057026 Ga0070705_1000570262 322
48 3300005441 Ga0070700_100215098 Ga0070700_1002150981 322
49 3300005459 Ga0068867_100003419 Ga0068867_1000034199 322
50 3300005543 Ga0070672_100207613 Ga0070672_1002076132 322
51 3300005545 Ga0070695_100063595 Ga0070695_1000635953 322
52 3300005546 Ga0070696_100075870 Ga0070696_1000758702 322
53 3300005719 Ga0068861_100026678 Ga0068861_1000266782 322
54 3300005840 Ga0068870_10031043 Ga0068870_100310432 322
55 3300005844 Ga0068862_100030956 Ga0068862_1000309562 322
56 3300005844 Ga0068862_100231531 Ga0068862_1002315312 322
57 3300006847 Ga0075431_100288268 Ga0075431_1002882683 322
58 3300006881 Ga0068865_100004941 Ga0068865_1000049413 322
59 3300009094 Ga0111539_10022294 Ga0111539_100222944 322
60 3300009094 Ga0111539_10510677 Ga0111539_105106772 322
61 3300009147 Ga0114129_10227481 Ga0114129_102274813 322
62 3300009553 Ga0105249_10135007 Ga0105249_101350073 322
63 3300014326 Ga0157380_10221476 Ga0157380_102214761 322
64 3300014745 Ga0157377_10046903 Ga0157377_100469033 322
65 3300025917 Ga0207660_10056874 Ga0207660_100568742 322
66 3300025926 Ga0207659_10008630 Ga0207659_100086303 322
67 3300025936 Ga0207670_10126052 Ga0207670_101260522 322
68 3300025938 Ga0207704_10024233 Ga0207704_100242333 322
69 3300025940 Ga0207691_10162699 Ga0207691_101626992 322
70 3300025942 Ga0207689_10011310 Ga0207689_100113103 322
71 3300025961 Ga0207712_10021581 Ga0207712_100215813 322
72 3300026075 Ga0207708_10014488 Ga0207708_100144884 322
73 3300026089 Ga0207648_10005404 Ga0207648_1000540411 322
74 3300028380 Ga0268265_10016240 Ga0268265_100162403 322
75 3300028380 Ga0268265_10116117 Ga0268265_101161172 322
76 3300049577 Ga0501041_0134693 Ga0501041_0134693_255_1226 322
77 3300049580 Ga0501046_0127722 Ga0501046_0127722_876_1847 322
78 3300049587 Ga0501071_0066885 Ga0501071_0066885_802_1773 322
79 3300050510 nmdc:mga06r32_553056_c1 nmdc:mga06r32_553056_c1_62_1033 322
80 3300050511 nmdc:mga08y16_141005_c1 nmdc:mga08y16_141005_c1_440_1411 322
81 3300050511 nmdc:mga08y16_463707_c1 nmdc:mga08y16_463707_c1_286_1257 322
82 3300050511 nmdc:mga08y16_52510_c1 nmdc:mga08y16_52510_c1_2960_3931 322
83 3300005330 Ga0070690_100129672 Ga0070690_1001296722 325
84 3300005335 Ga0070666_10083907 Ga0070666_100839072 325
85 3300005354 Ga0070675_100082502 Ga0070675_1000825022 325
86 3300005444 Ga0070694_100035196 Ga0070694_1000351962 325
87 3300005544 Ga0070686_100137211 Ga0070686_1001372112 325
88 3300005548 Ga0070665_100066943 Ga0070665_1000669433 325
89 3300005617 Ga0068859_100014728 Ga0068859_1000147282 325
90 3300005841 Ga0068863_100043668 Ga0068863_1000436684 325
91 3300006237 Ga0097621_100118648 Ga0097621_1001186482 325
92 3300006358 Ga0068871_100001140 Ga0068871_10000114026 325
93 3300006358 Ga0068871_100054419 Ga0068871_1000544193 325
94 3300006881 Ga0068865_100039257 Ga0068865_1000392572 325
95 3300006931 Ga0097620_100014728 Ga0097620_1000147282 325
96 3300007265 Ga0099794_10003315 Ga0099794_100033153 325
97 3300007788 Ga0099795_10009238 Ga0099795_100092383 325
98 3300009177 Ga0105248_10018203 Ga0105248_100182037 325
99 3300011119 Ga0105246_10035404 Ga0105246_100354043 325
100 3300013308 Ga0157375_10157846 Ga0157375_101578461 325
101 3300014969 Ga0157376_10028680 Ga0157376_100286803 325
102 3300014969 Ga0157376_10055394 Ga0157376_100553943 325
103 3300025926 Ga0207659_10181973 Ga0207659_101819732 325
104 3300025935 Ga0207709_10182491 Ga0207709_101824912 325
105 3300025938 Ga0207704_10090420 Ga0207704_100904202 325
106 3300025942 Ga0207689_10023895 Ga0207689_100238953 325
107 3300026116 Ga0207674_10198225 Ga0207674_101982252 325
108 3300028379 Ga0268266_10053509 Ga0268266_100535092 325
109 3300035691 Ga0373931_0032335 Ga0373931_0032335_1224_2204 325
110 3300005440 Ga0070705_100056581 Ga0070705_1000565812 326
111 3300009094 Ga0111539_10037272 Ga0111539_100372722 326
112 3300027462 Ga0210000_1001084 Ga0210000_10010843 326
113 3300027543 Ga0209999_1002676 Ga0209999_10026763 326
114 3300027682 Ga0209971_1005841 Ga0209971_10058412 326
115 3300027876 Ga0209974_10000470 Ga0209974_100004703 326
116 3300027907 Ga0207428_10053294 Ga0207428_100532943 326
117 3300045051 Ga0451576_0421390 Ga0451576_0421390_162_1145 326
118 3300046454 Ga0495592_0007672 Ga0495592_0007672_3345_4328 326
119 3300046473 Ga0495582_0165219 Ga0495582_0165219_42_1025 326
120 3300046476 Ga0495662_0016590 Ga0495662_0016590_202_1185 326
121 3300046511 Ga0495608_0001028 Ga0495608_0001028_13928_14911 326
122 3300046514 Ga0495618_0010655 Ga0495618_0010655_4304_5287 326
123 3300046516 Ga0495628_0016012 Ga0495628_0016012_333_1316 326
124 3300046517 Ga0495630_0012901 Ga0495630_0012901_1035_2018 326
125 3300046526 Ga0495666_0007432 Ga0495666_0007432_366_1349 326
126 3300046529 Ga0495652_0315504 Ga0495652_0315504_48_1031 326
127 3300046533 Ga0495640_0018063 Ga0495640_0018063_4239_5222 326
128 3300046535 Ga0495586_0012876 Ga0495586_0012876_454_1437 326
129 3300046536 Ga0495587_0031268 Ga0495587_0031268_1150_2133 326
130 3300046543 Ga0495645_0165059 Ga0495645_0165059_530_1513 326
131 3300046559 Ga0495667_0000709 Ga0495667_0000709_12989_13972 326
132 3300046642 Ga0495634_0002751 Ga0495634_0002751_6235_7218 326
133 3300046683 Ga0495658_0004885 Ga0495658_0004885_3126_4109 326
134 3300046809 Ga0495600_0005190 Ga0495600_0005190_2355_3338 326
135 3300047317 Ga0495604_0013367 Ga0495604_0013367_5264_6247 326
136 3300047322 Ga0495680_0013596 Ga0495680_0013596_4563_5546 326
137 3300047471 Ga0495684_0103336 Ga0495684_0103336_958_1941 326
138 3300049572 Ga0501036_0115111 Ga0501036_0115111_366_1349 326
139 3300049575 Ga0501039_0043879 Ga0501039_0043879_788_1771 326
140 3300049577 Ga0501041_0005052 Ga0501041_0005052_2676_3659 326
141 3300049578 Ga0501042_0091522 Ga0501042_0091522_616_1599 326
142 3300049580 Ga0501046_0014507 Ga0501046_0014507_2015_2998 326
143 3300049587 Ga0501071_0020400 Ga0501071_0020400_3431_4414 326
144 3300049588 Ga0501072_0000763 Ga0501072_0000763_12291_13274 326
145 3300049590 Ga0501074_0035810 Ga0501074_0035810_1254_2237 326
146 3300049591 Ga0501075_0000926 Ga0501075_0000926_10414_11397 326
147 3300049592 Ga0501076_0011561 Ga0501076_0011561_1033_2016 326
148 3300049742 Ga0501080_0038629 Ga0501080_0038629_1550_2533 326
149 3300049743 Ga0501081_0168534 Ga0501081_0168534_491_1474 326
150 3300060353 Ga0501082_0141215 Ga0501082_0141215_439_1422 326
151 3300061734 Ga0530510_0000542 Ga0530510_0000542_4463_5446 326
152 3300005330 Ga0070690_100000235 Ga0070690_10000023523 327
153 3300005330 Ga0070690_100059202 Ga0070690_1000592023 327
154 3300005334 Ga0068869_100000023 Ga0068869_10000002353 327
155 3300031548 Ga0307408_100402255 Ga0307408_1004022552 327
156 3300035113 Ga0373936_0005669 Ga0373936_0005669_2513_3499 327
157 3300035116 Ga0373945_0000906 Ga0373945_0000906_4377_5363 327
158 3300035170 Ga0373943_0169279 Ga0373943_0169279_97_1083 327
159 3300035171 Ga0373946_0009414 Ga0373946_0009414_140_1126 327
160 3300035242 Ga0373962_0019089 Ga0373962_0019089_548_1534 327
161 3300035691 Ga0373931_0127047 Ga0373931_0127047_186_1172 327
162 3300035692 Ga0373935_0012489 Ga0373935_0012489_927_1913 327
163 3300035695 Ga0373927_0214445 Ga0373927_0214445_149_1135 327
164 3300046455 Ga0495603_0040850 Ga0495603_0040850_1758_2744 327
165 3300046472 Ga0495580_0008453 Ga0495580_0008453_3622_4608 327
166 3300046473 Ga0495582_0015437 Ga0495582_0015437_394_1380 327
167 3300046526 Ga0495666_0031526 Ga0495666_0031526_1579_2565 327
168 3300046531 Ga0495665_0109617 Ga0495665_0109617_93_1079 327
169 3300046537 Ga0495598_0001660 Ga0495598_0001660_1702_2688 327
170 3300046557 Ga0495622_0089957 Ga0495622_0089957_117_1103 327
171 3300046681 Ga0495647_0000149 Ga0495647_0000149_8605_9591 327
172 3300047321 Ga0495676_0024337 Ga0495676_0024337_439_1425 327
173 3300049575 Ga0501039_0065971 Ga0501039_0065971_1557_2573 327
174 3300049576 Ga0501040_0035670 Ga0501040_0035670_700_1716 327
175 3300049577 Ga0501041_0056473 Ga0501041_0056473_138_1154 327
176 3300049578 Ga0501042_0289384 Ga0501042_0289384_149_1165 327
177 3300049582 Ga0501048_0135102 Ga0501048_0135102_455_1471 327
178 3300049588 Ga0501072_0129126 Ga0501072_0129126_71_1087 327
179 3300049824 Ga0501045_0059667 Ga0501045_0059667_503_1519 327
180 3300005340 Ga0070689_100194966 Ga0070689_1001949661 328
181 3300005440 Ga0070705_100136565 Ga0070705_1001365652 328
182 3300005444 Ga0070694_100052129 Ga0070694_1000521292 328
183 3300005518 Ga0070699_100047497 Ga0070699_1000474972 328
184 3300005536 Ga0070697_100012729 Ga0070697_1000127292 328
185 3300005545 Ga0070695_100002624 Ga0070695_1000026248 328
186 3300005985 Ga0081539_10000233 Ga0081539_10000233117 328
187 3300006871 Ga0075434_100028537 Ga0075434_1000285375 328
188 3300006914 Ga0075436_100007287 Ga0075436_1000072873 328
189 3300006914 Ga0075436_100014820 Ga0075436_1000148201 328
190 3300007076 Ga0075435_100017409 Ga0075435_1000174093 328
191 3300009147 Ga0114129_10121767 Ga0114129_101217674 328
192 3300027471 Ga0209995_1010912 Ga0209995_10109121 328
193 3300031548 Ga0307408_100137853 Ga0307408_1001378531 328
194 3300032002 Ga0307416_100014967 Ga0307416_1000149677 328
195 3300037068 Ga0373925_0333686 Ga0373925_0333686_194_1183 328
196 3300041496 Ga0451839_1137150 Ga0451839_1137150_92_1081 328
197 3300042435 Ga0439434_0001975 Ga0439434_0001975_1748_2737 328
198 3300042436 Ga0439435_0000025 Ga0439435_0000025_6779_7768 328
199 3300046528 Ga0495642_0045194 Ga0495642_0045194_522_1511 328
200 3300046684 Ga0495669_0010017 Ga0495669_0010017_209_1198 328
201 3300050512 nmdc:mga0n895_29098_c1 nmdc:mga0n895_29098_c1_1556_2545 328
202 3300050513 nmdc:mga0rr50_56901_c1 nmdc:mga0rr50_56901_c1_558_1547 328
203 3300050514 nmdc:mga08x19_20027_c1 nmdc:mga08x19_20027_c1_1734_2723 328
204 3300050514 nmdc:mga08x19_41159_c1 nmdc:mga08x19_41159_c1_1408_2397 328
205 3300050514 nmdc:mga08x19_62143_c1 nmdc:mga08x19_62143_c1_720_1709 328
206 3300005353 Ga0070669_100322688 Ga0070669_1003226881 329
207 3300005444 Ga0070694_100100704 Ga0070694_1001007042 329
208 3300005471 Ga0070698_100020071 Ga0070698_1000200712 329
209 3300005518 Ga0070699_100191762 Ga0070699_1001917621 329
210 3300005545 Ga0070695_100090910 Ga0070695_1000909102 329
211 3300005549 Ga0070704_100005124 Ga0070704_1000051243 329
212 3300005577 Ga0068857_100264011 Ga0068857_1002640112 329
213 3300005617 Ga0068859_100111076 Ga0068859_1001110762 329
214 3300005842 Ga0068858_100191946 Ga0068858_1001919462 329
215 3300005844 Ga0068862_100349214 Ga0068862_1003492141 329
216 3300006844 Ga0075428_100055956 Ga0075428_1000559563 329
217 3300006847 Ga0075431_100221696 Ga0075431_1002216962 329
218 3300006880 Ga0075429_100000107 Ga0075429_10000010736 329
219 3300006931 Ga0097620_100111067 Ga0097620_1001110672 329
220 3300009147 Ga0114129_10017740 Ga0114129_100177404 329
221 3300009148 Ga0105243_10115073 Ga0105243_101150732 329
222 3300009553 Ga0105249_10188415 Ga0105249_101884152 329
223 3300026116 Ga0207674_10140223 Ga0207674_101402233 329
224 3300028380 Ga0268265_10333094 Ga0268265_103330942 329
225 3300035086 Ga0373934_0000044 Ga0373934_0000044_8541_9533 329
226 3300035118 Ga0373954_0000020 Ga0373954_0000020_20835_21863 329
227 3300035119 Ga0373956_0000003 Ga0373956_0000003_26578_27570 329
228 3300035120 Ga0373957_0002342 Ga0373957_0002342_3584_4576 329
229 3300035120 Ga0373957_0036047 Ga0373957_0036047_123_1115 329
230 3300035172 Ga0373955_0016708 Ga0373955_0016708_176_1168 329
231 3300035724 Ga0373933_0000107 Ga0373933_0000107_11808_12800 329
232 3300035724 Ga0373933_0004387 Ga0373933_0004387_5656_6684 329
233 3300035724 Ga0373933_0021741 Ga0373933_0021741_336_1328 329
234 3300036401 Ga0373937_0000179 Ga0373937_0000179_25029_26057 329
235 3300036401 Ga0373937_0000196 Ga0373937_0000196_54970_55962 329
236 3300036401 Ga0373937_0023517 Ga0373937_0023517_322_1314 329
237 3300045051 Ga0451576_0036919 Ga0451576_0036919_3320_4312 329
238 3300045051 Ga0451576_0248265 Ga0451576_0248265_838_1830 329
239 3300046462 Ga0495651_0000105 Ga0495651_0000105_30493_31485 329
240 3300046529 Ga0495652_0209072 Ga0495652_0209072_81_1073 329
241 3300046616 Ga0495668_0163395 Ga0495668_0163395_93_1085 329
242 3300046675 Ga0495657_0056249 Ga0495657_0056249_1156_2148 329
243 3300047322 Ga0495680_0167984 Ga0495680_0167984_524_1516 329
244 3300047444 Ga0495675_0118543 Ga0495675_0118543_574_1566 329
245 3300050507 nmdc:mga05p37_1054_c1 nmdc:mga05p37_1054_c1_10966_11958 329
246 3300050508 nmdc:mga09592_100_c1 nmdc:mga09592_100_c1_43398_44390 329
247 3300050510 nmdc:mga06r32_292659_c1 nmdc:mga06r32_292659_c1_132_1124 329
248 iso_pu_bacteria 2501025501 2501073093 329
249 iso_pu_bacteria 2501025502 2501081828 329
250 iso_pu_bacteria 2501025504 2501408150 329
251 iso_pu_bacteria 2510917013 2511085761 329
252 iso_pu_bacteria 2510917014 2511095889 329
253 iso_pu_bacteria 2510917015 2511103359 329
254 iso_pu_bacteria 2513237082 2513556202 329
255 iso_pu_bacteria 2513237083 2513561445 329
256 iso_pu_bacteria 2513237166 2514051798 329
257 iso_pu_bacteria 2515154189 2516020762 329
258 iso_pu_bacteria 2562617112 2563059491 329
259 iso_pu_bacteria 2600255067 2600811127 329
260 iso_pu_bacteria 2711768613 2713479563 329
261 iso_pu_bacteria 2791355137 2792834292 329
262 iso_pu_bacteria 2856287931 2856292062 329
263 iso_pu_bacteria 2857357740 2857361249 329
264 iso_pu_bacteria 2883087390 2883090952 329
265 iso_pu_bacteria 2904615490 2904620663 329
266 iso_pu_bacteria 642555112 642592334 329
267 iso_pu_bacteria 8003955200 8003957590 329
268 3300035692 Ga0373935_0008672 Ga0373935_0008672_278_1273 330
269 3300036401 Ga0373937_0357400 Ga0373937_0357400_101_1096 330
270 iso_pu_bacteria 2842775625 2842778160 330
271 3300005334 Ga0068869_100019561 Ga0068869_1000195612 331
272 3300005338 Ga0068868_100234279 Ga0068868_1002342792 331
273 3300005366 Ga0070659_100106723 Ga0070659_1001067232 331
274 3300005458 Ga0070681_10000688 Ga0070681_1000068824 331
275 3300005458 Ga0070681_10016598 Ga0070681_100165981 331
276 3300005530 Ga0070679_100008648 Ga0070679_1000086489 331
277 3300005545 Ga0070695_100086681 Ga0070695_1000866811 331
278 3300005577 Ga0068857_100166146 Ga0068857_1001661461 331
279 3300005617 Ga0068859_100367817 Ga0068859_1003678172 331
280 3300006173 Ga0070716_100008408 Ga0070716_1000084087 331
281 3300006871 Ga0075434_100223841 Ga0075434_1002238413 331
282 3300006914 Ga0075436_100000174 Ga0075436_10000017438 331
283 3300006914 Ga0075436_100022801 Ga0075436_1000228015 331
284 3300006931 Ga0097620_100367823 Ga0097620_1003678232 331
285 3300010159 Ga0099796_10097427 Ga0099796_100974271 331
286 3300010375 Ga0105239_10418537 Ga0105239_104185372 331
287 3300025912 Ga0207707_10021130 Ga0207707_100211306 331
288 3300025939 Ga0207665_10000863 Ga0207665_1000086316 331
289 3300026116 Ga0207674_10255971 Ga0207674_102559712 331
290 3300031665 Ga0316575_10003242 Ga0316575_100032422 331
291 3300031665 Ga0316575_10020705 Ga0316575_100207052 331
292 3300031691 Ga0316579_10009712 Ga0316579_100097122 331
293 3300031728 Ga0316578_10019166 Ga0316578_100191662 331
294 3300032002 Ga0307416_100106501 Ga0307416_1001065012 331
295 3300035086 Ga0373934_0030676 Ga0373934_0030676_577_1575 331
296 3300035111 Ga0373923_0023873 Ga0373923_0023873_471_1469 331
297 3300035113 Ga0373936_0001037 Ga0373936_0001037_8279_9277 331
298 3300035118 Ga0373954_0004897 Ga0373954_0004897_252_1250 331
299 3300035118 Ga0373954_0055678 Ga0373954_0055678_591_1589 331
300 3300035119 Ga0373956_0005962 Ga0373956_0005962_1374_2372 331
301 3300035170 Ga0373943_0016340 Ga0373943_0016340_787_1785 331
302 3300035171 Ga0373946_0023271 Ga0373946_0023271_563_1561 331
303 3300035172 Ga0373955_0012959 Ga0373955_0012959_2894_3892 331
304 3300035398 Ga0316574_0018491 Ga0316574_0018491_2162_3160 331
305 3300035410 Ga0373924_0019331 Ga0373924_0019331_266_1264 331
306 3300035692 Ga0373935_0014087 Ga0373935_0014087_2907_3905 331
307 3300035695 Ga0373927_0025420 Ga0373927_0025420_672_1670 331
308 3300035724 Ga0373933_0084844 Ga0373933_0084844_614_1612 331
309 3300035725 Ga0373947_0090163 Ga0373947_0090163_574_1572 331
310 3300036401 Ga0373937_0127941 Ga0373937_0127941_649_1647 331
311 3300036401 Ga0373937_0270218 Ga0373937_0270218_272_1270 331
312 3300046454 Ga0495592_0022957 Ga0495592_0022957_2808_3806 331
313 3300046459 Ga0495629_0071962 Ga0495629_0071962_780_1778 331
314 3300046461 Ga0495641_0011338 Ga0495641_0011338_147_1145 331
315 3300046463 Ga0495653_0016485 Ga0495653_0016485_2105_3103 331
316 3300046472 Ga0495580_0022721 Ga0495580_0022721_702_1700 331
317 3300046475 Ga0495639_0011536 Ga0495639_0011536_2796_3794 331
318 3300046514 Ga0495618_0057962 Ga0495618_0057962_472_1470 331
319 3300046516 Ga0495628_0004763 Ga0495628_0004763_8067_9065 331
320 3300046516 Ga0495628_0015546 Ga0495628_0015546_878_1876 331
321 3300046516 Ga0495628_0188951 Ga0495628_0188951_62_1060 331
322 3300046517 Ga0495630_0001187 Ga0495630_0001187_14125_15123 331
323 3300046517 Ga0495630_0129733 Ga0495630_0129733_556_1554 331
324 3300046526 Ga0495666_0046395 Ga0495666_0046395_116_1114 331
325 3300046529 Ga0495652_0003931 Ga0495652_0003931_613_1611 331
326 3300046531 Ga0495665_0023190 Ga0495665_0023190_668_1666 331
327 3300046533 Ga0495640_0039390 Ga0495640_0039390_654_1652 331
328 3300046535 Ga0495586_0144227 Ga0495586_0144227_272_1270 331
329 3300046536 Ga0495587_0149903 Ga0495587_0149903_293_1291 331
330 3300046543 Ga0495645_0002326 Ga0495645_0002326_11221_12219 331
331 3300046678 Ga0495599_0017778 Ga0495599_0017778_2289_3287 331
332 3300046678 Ga0495599_0035454 Ga0495599_0035454_147_1145 331
333 3300047317 Ga0495604_0104703 Ga0495604_0104703_803_1801 331
334 3300047322 Ga0495680_0014849 Ga0495680_0014849_2912_3910 331
335 3300047322 Ga0495680_0091382 Ga0495680_0091382_1157_2155 331
336 3300047444 Ga0495675_0028377 Ga0495675_0028377_1602_2600 331
337 3300047471 Ga0495684_0101956 Ga0495684_0101956_900_1898 331
338 3300048089 Ga0495614_0102793 Ga0495614_0102793_10_1008 331
339 3300049572 Ga0501036_0023727 Ga0501036_0023727_1091_2092 331
340 3300049574 Ga0501038_0075226 Ga0501038_0075226_1365_2366 331
341 3300049575 Ga0501039_0009714 Ga0501039_0009714_1928_2929 331
342 3300049577 Ga0501041_0002164 Ga0501041_0002164_8387_9388 331
343 3300049578 Ga0501042_0014362 Ga0501042_0014362_2371_3372 331
344 3300049580 Ga0501046_0036810 Ga0501046_0036810_1800_2801 331
345 3300049582 Ga0501048_0006221 Ga0501048_0006221_1028_2029 331
346 3300049584 Ga0501068_0104779 Ga0501068_0104779_249_1250 331
347 3300049587 Ga0501071_0056794 Ga0501071_0056794_1534_2535 331
348 3300049589 Ga0501073_0058294 Ga0501073_0058294_72_1073 331
349 3300049590 Ga0501074_0073533 Ga0501074_0073533_139_1143 331
350 3300049592 Ga0501076_0003118 Ga0501076_0003118_2598_3599 331
351 3300049592 Ga0501076_0031041 Ga0501076_0031041_1750_2754 331
352 3300049593 Ga0501077_0035197 Ga0501077_0035197_363_1367 331
353 3300049741 Ga0501079_0000812 Ga0501079_0000812_674_1675 331
354 3300049742 Ga0501080_0062544 Ga0501080_0062544_789_1790 331
355 3300049743 Ga0501081_0020876 Ga0501081_0020876_470_1471 331
356 3300049824 Ga0501045_0000399 Ga0501045_0000399_16216_17217 331
357 3300050512 nmdc:mga0n895_303871_c1 nmdc:mga0n895_303871_c1_182_1180 331
358 3300050514 nmdc:mga08x19_20825_c1 nmdc:mga08x19_20825_c1_769_1767 331
359 3300053077 Ga0495601_0000321 Ga0495601_0000321_10985_11983 331
360 3300053084 Ga0495595_0036022 Ga0495595_0036022_357_1355 331
361 3300054114 Ga0501084_0007233 Ga0501084_0007233_1625_2626 331
362 3300060353 Ga0501082_0008788 Ga0501082_0008788_6404_7405 331
363 3300061734 Ga0530510_0000661 Ga0530510_0000661_12975_13976 331
364 3300005329 Ga0070683_100331926 Ga0070683_1003319261 332
365 3300005331 Ga0070670_100084019 Ga0070670_1000840192 332
366 3300005331 Ga0070670_100137031 Ga0070670_1001370312 332
367 3300005338 Ga0068868_100006228 Ga0068868_1000062284 332
368 3300005344 Ga0070661_100042312 Ga0070661_1000423123 332
369 3300005354 Ga0070675_100039701 Ga0070675_1000397014 332
370 3300005355 Ga0070671_100030089 Ga0070671_1000300894 332
371 3300005459 Ga0068867_100075236 Ga0068867_1000752361 332
372 3300005530 Ga0070679_100078972 Ga0070679_1000789722 332
373 3300005539 Ga0068853_100025143 Ga0068853_1000251432 332
374 3300005548 Ga0070665_100361293 Ga0070665_1003612932 332
375 3300005549 Ga0070704_100116830 Ga0070704_1001168302 332
376 3300005563 Ga0068855_100085723 Ga0068855_1000857233 332
377 3300005577 Ga0068857_100330929 Ga0068857_1003309292 332
378 3300005578 Ga0068854_100165149 Ga0068854_1001651492 332
379 3300005617 Ga0068859_100049658 Ga0068859_1000496583 332
380 3300005618 Ga0068864_100012457 Ga0068864_1000124573 332
381 3300005834 Ga0068851_10033819 Ga0068851_100338192 332
382 3300005842 Ga0068858_100090779 Ga0068858_1000907791 332
383 3300006237 Ga0097621_100082294 Ga0097621_1000822943 332
384 3300006237 Ga0097621_100173833 Ga0097621_1001738332 332
385 3300006844 Ga0075428_100329193 Ga0075428_1003291932 332
386 3300006931 Ga0097620_100049654 Ga0097620_1000496545 332
387 3300009148 Ga0105243_10190844 Ga0105243_101908442 332
388 3300009174 Ga0105241_10003849 Ga0105241_100038493 332
389 3300009545 Ga0105237_10310694 Ga0105237_103106942 332
390 3300010375 Ga0105239_10034652 Ga0105239_100346524 332
391 3300013306 Ga0163162_10031995 Ga0163162_100319955 332
392 3300013306 Ga0163162_10107754 Ga0163162_101077545 332
393 3300013308 Ga0157375_10019124 Ga0157375_100191243 332
394 3300013308 Ga0157375_10137543 Ga0157375_101375432 332
395 3300014969 Ga0157376_10040781 Ga0157376_100407812 332
396 3300017792 Ga0163161_10121651 Ga0163161_101216512 332
397 3300025899 Ga0207642_10035862 Ga0207642_100358621 332
398 3300025911 Ga0207654_10027853 Ga0207654_100278533 332
399 3300025914 Ga0207671_10205945 Ga0207671_102059452 332
400 3300025923 Ga0207681_10017627 Ga0207681_100176273 332
401 3300025925 Ga0207650_10020629 Ga0207650_100206291 332
402 3300025925 Ga0207650_10144682 Ga0207650_101446822 332
403 3300025933 Ga0207706_10007023 Ga0207706_100070236 332
404 3300025936 Ga0207670_10272853 Ga0207670_102728531 332
405 3300025940 Ga0207691_10263422 Ga0207691_102634222 332
406 3300025942 Ga0207689_10137006 Ga0207689_101370061 332
407 3300025945 Ga0207679_10148378 Ga0207679_101483782 332
408 3300025949 Ga0207667_10093541 Ga0207667_100935412 332
409 3300025960 Ga0207651_10132394 Ga0207651_101323942 332
410 3300026035 Ga0207703_10084380 Ga0207703_100843803 332
411 3300026041 Ga0207639_10017759 Ga0207639_100177593 332
412 3300026089 Ga0207648_10079866 Ga0207648_100798665 332
413 3300026116 Ga0207674_10080555 Ga0207674_100805552 332
414 3300026116 Ga0207674_10253358 Ga0207674_102533582 332
415 3300026118 Ga0207675_100043011 Ga0207675_1000430112 332
416 3300026121 Ga0207683_10018182 Ga0207683_100181822 332
417 3300026142 Ga0207698_10373842 Ga0207698_103738422 332
418 3300028379 Ga0268266_10315200 Ga0268266_103152002 332
419 3300028381 Ga0268264_10147790 Ga0268264_101477902 332
420 3300031239 Ga0265328_10022541 Ga0265328_100225412 332
421 3300031242 Ga0265329_10012019 Ga0265329_100120193 332
422 3300031249 Ga0265339_10163541 Ga0265339_101635411 332
423 3300031250 Ga0265331_10003333 Ga0265331_1000333310 332
424 3300031344 Ga0265316_10012711 Ga0265316_100127112 332
425 3300031711 Ga0265314_10026186 Ga0265314_100261864 332
426 3300042122 Ga0450920_004910 Ga0450920_004910_86_1087 332
427 3300048913 Ga0496110_0065985 Ga0496110_0065985_629_1651 332
428 3300049571 Ga0501034_0000235 Ga0501034_0000235_50772_51776 332
429 3300049571 Ga0501034_0034677 Ga0501034_0034677_1465_2481 332
430 3300049572 Ga0501036_0098655 Ga0501036_0098655_756_1802 332
431 3300049573 Ga0501037_0008126 Ga0501037_0008126_5960_7006 332
432 3300049575 Ga0501039_0004640 Ga0501039_0004640_338_1384 332
433 3300049576 Ga0501040_0040558 Ga0501040_0040558_1999_3045 332
434 3300049576 Ga0501040_0044985 Ga0501040_0044985_405_1406 332
435 3300049577 Ga0501041_0001754 Ga0501041_0001754_8487_9533 332
436 3300049577 Ga0501041_0123401 Ga0501041_0123401_577_1578 332
437 3300049578 Ga0501042_0034026 Ga0501042_0034026_1303_2349 332
438 3300049584 Ga0501068_0000232 Ga0501068_0000232_4598_5611 332
439 3300049587 Ga0501071_0010642 Ga0501071_0010642_3312_4313 332
440 3300049587 Ga0501071_0055954 Ga0501071_0055954_1453_2499 332
441 3300049588 Ga0501072_0001017 Ga0501072_0001017_1860_2864 332
442 3300049588 Ga0501072_0112707 Ga0501072_0112707_669_1670 332
443 3300049588 Ga0501072_0115148 Ga0501072_0115148_833_1879 332
444 3300049589 Ga0501073_0000752 Ga0501073_0000752_20459_21472 332
445 3300049590 Ga0501074_0143724 Ga0501074_0143724_604_1605 332
446 3300049591 Ga0501075_0004661 Ga0501075_0004661_7894_8940 332
447 3300049591 Ga0501075_0059159 Ga0501075_0059159_1507_2508 332
448 3300049592 Ga0501076_0000948 Ga0501076_0000948_14247_15293 332
449 3300049741 Ga0501079_0000752 Ga0501079_0000752_18908_19954 332
450 3300049742 Ga0501080_0000996 Ga0501080_0000996_20459_21472 332
451 3300049742 Ga0501080_0052445 Ga0501080_0052445_2219_3220 332
452 3300049742 Ga0501080_0159439 Ga0501080_0159439_713_1717 332
453 3300049743 Ga0501081_0000928 Ga0501081_0000928_6926_7972 332
454 3300049822 Ga0501035_0046680 Ga0501035_0046680_18_1064 332
455 3300049824 Ga0501045_0008896 Ga0501045_0008896_784_1830 332
456 3300054114 Ga0501084_0158523 Ga0501084_0158523_86_1099 332
457 3300060353 Ga0501082_0005827 Ga0501082_0005827_1173_2219 332
458 3300060353 Ga0501082_0355212 Ga0501082_0355212_52_1065 332
459 3300003322 rootL2_10089033 rootL2_100890332 333
460 3300003354 JGI25160J50197_1000279 JGI25160J50197_100027913 333
461 3300005335 Ga0070666_10053867 Ga0070666_100538672 333
462 3300005367 Ga0070667_100019707 Ga0070667_1000197072 333
463 3300005455 Ga0070663_100003243 Ga0070663_1000032433 333
464 3300006195 Ga0075366_10037538 Ga0075366_100375383 333
465 3300006846 Ga0075430_100005239 Ga0075430_1000052396 333
466 3300006847 Ga0075431_100046537 Ga0075431_1000465373 333
467 3300009011 Ga0105251_10001210 Ga0105251_100012102 333
468 3300009177 Ga0105248_10037595 Ga0105248_100375954 333
469 3300013105 Ga0157369_10270331 Ga0157369_102703311 333
470 3300013306 Ga0163162_10000679 Ga0163162_100006793 333
471 3300013308 Ga0157375_10034066 Ga0157375_100340663 333
472 3300016635 Ga0183361_10009 Ga0183361_10009116 333
473 3300025302 Ga0207426_1006086 Ga0207426_10060863 333
474 3300025735 Ga0207713_1003216 Ga0207713_10032168 333
475 3300025903 Ga0207680_10039106 Ga0207680_100391062 333
476 3300025904 Ga0207647_10063243 Ga0207647_100632433 333
477 3300026067 Ga0207678_10007848 Ga0207678_100078483 333
478 3300028800 Ga0265338_10001217 Ga0265338_1000121721 333
479 3300030521 Ga0307511_10000108 Ga0307511_1000010818 333
480 3300031251 Ga0265327_10014887 Ga0265327_100148874 333
481 3300033179 Ga0307507_10038968 Ga0307507_100389684 333
482 3300039438 Ga0436360_0400716 Ga0436360_0400716_23_1027 333
483 3300042001 Ga0439441_001631 Ga0439441_001631_563_1633 333
484 3300042876 Ga0451577_0205479 Ga0451577_0205479_426_1430 333
485 3300044765 Ga0466970_0102432 Ga0466970_0102432_476_1483 333
486 3300046455 Ga0495603_0033367 Ga0495603_0033367_810_1814 333
487 3300046457 Ga0495590_0000630 Ga0495590_0000630_911_1912 333
488 3300046457 Ga0495590_0022510 Ga0495590_0022510_99_1109 333
489 3300046459 Ga0495629_0172360 Ga0495629_0172360_357_1358 333
490 3300046474 Ga0495605_0021878 Ga0495605_0021878_1298_2305 333
491 3300046507 Ga0495606_0063944 Ga0495606_0063944_369_1370 333
492 3300046507 Ga0495606_0086766 Ga0495606_0086766_314_1321 333
493 3300046515 Ga0495620_0018493 Ga0495620_0018493_2169_3170 333
494 3300046516 Ga0495628_0072664 Ga0495628_0072664_526_1527 333
495 3300046528 Ga0495642_0010968 Ga0495642_0010968_1590_2597 333
496 3300046529 Ga0495652_0071319 Ga0495652_0071319_1046_2047 333
497 3300046531 Ga0495665_0014916 Ga0495665_0014916_3012_4013 333
498 3300046542 Ga0495597_0007513 Ga0495597_0007513_1067_2068 333
499 3300046543 Ga0495645_0163772 Ga0495645_0163772_459_1460 333
500 3300046679 Ga0495623_0024279 Ga0495623_0024279_2237_3238 333
501 3300046684 Ga0495669_0015535 Ga0495669_0015535_1159_2166 333
502 3300046691 Ga0495670_0007900 Ga0495670_0007900_1288_2295 333
503 3300046694 Ga0495649_0021009 Ga0495649_0021009_1754_2755 333
504 3300046794 Ga0495589_0017714 Ga0495589_0017714_2014_3021 333
505 3300046794 Ga0495589_0094820 Ga0495589_0094820_160_1161 333
506 3300047322 Ga0495680_0078630 Ga0495680_0078630_454_1455 333
507 3300047323 Ga0495683_0001407 Ga0495683_0001407_11088_12089 333
508 3300047323 Ga0495683_0079052 Ga0495683_0079052_220_1227 333
509 3300047443 Ga0495687_000169 Ga0495687_000169_62321_63328 333
510 3300047673 Ga0495593_0115617 Ga0495593_0115617_19_1020 333
511 3300048088 Ga0495602_0016723 Ga0495602_0016723_4784_5785 333
512 3300048903 Ga0496100_0043465 Ga0496100_0043465_591_1592 333
513 3300048903 Ga0496100_0101744 Ga0496100_0101744_735_1742 333
514 3300048904 Ga0496101_0014626 Ga0496101_0014626_3094_4095 333
515 3300048904 Ga0496101_0024961 Ga0496101_0024961_2660_3667 333
516 3300048905 Ga0496102_0001320 Ga0496102_0001320_592_1593 333
517 3300048905 Ga0496102_0021149 Ga0496102_0021149_4137_5144 333
518 3300048906 Ga0496103_0007295 Ga0496103_0007295_930_1931 333
519 3300048909 Ga0496106_0017418 Ga0496106_0017418_3475_4476 333
520 3300048909 Ga0496106_0057379 Ga0496106_0057379_884_1891 333
521 3300048910 Ga0496107_0010544 Ga0496107_0010544_2080_3081 333
522 3300048914 Ga0496111_0023860 Ga0496111_0023860_457_1458 333
523 3300048916 Ga0496113_0017346 Ga0496113_0017346_1077_2078 333
524 3300048918 Ga0496115_0339750 Ga0496115_0339750_171_1172 333
525 3300048919 Ga0496116_0025650 Ga0496116_0025650_3254_4255 333
526 3300048922 Ga0496119_0078263 Ga0496119_0078263_449_1450 333
527 3300048925 Ga0496122_0007506 Ga0496122_0007506_3998_4999 333
528 3300048926 Ga0496123_0057060 Ga0496123_0057060_1105_2106 333
529 3300048927 Ga0496124_0016661 Ga0496124_0016661_3781_4782 333
530 3300048927 Ga0496124_0126888 Ga0496124_0126888_71_1072 333
531 3300048928 Ga0496125_0009210 Ga0496125_0009210_5583_6584 333
532 3300048929 Ga0496126_0006916 Ga0496126_0006916_10718_11719 333
533 3300049571 Ga0501034_0005666 Ga0501034_0005666_1094_2101 333
534 3300050493 nmdc:mga0k408_9059_c1 nmdc:mga0k408_9059_c1_3891_4943 333
535 3300050509 nmdc:mga0qj67_9124_c1 nmdc:mga0qj67_9124_c1_1436_2440 333
536 3300050510 nmdc:mga06r32_17414_c1 nmdc:mga06r32_17414_c1_2906_3910 333
537 3300053118 Ga0500594_0023518 Ga0500594_0023518_446_1492 333
538 3300013297 Ga0157378_10059116 Ga0157378_100591162 334
539 3300035691 Ga0373931_0129370 Ga0373931_0129370_246_1271 334
540 3300042876 Ga0451577_0365537 Ga0451577_0365537_134_1144 334
541 3300044712 Ga0453684_0272373 Ga0453684_0272373_569_1579 334
542 3300049593 Ga0501077_0016328 Ga0501077_0016328_2020_3027 334
543 3300049743 Ga0501081_0105433 Ga0501081_0105433_616_1623 334
544 3300005328 Ga0070676_10124668 Ga0070676_101246682 335
545 3300005330 Ga0070690_100009422 Ga0070690_1000094224 335
546 3300005334 Ga0068869_100002090 Ga0068869_1000020902 335
547 3300005340 Ga0070689_100087696 Ga0070689_1000876962 335
548 3300005341 Ga0070691_10015276 Ga0070691_100152763 335
549 3300005438 Ga0070701_10043994 Ga0070701_100439942 335
550 3300005441 Ga0070700_100003807 Ga0070700_1000038072 335
551 3300005444 Ga0070694_100081891 Ga0070694_1000818912 335
552 3300005459 Ga0068867_100041406 Ga0068867_1000414063 335
553 3300005546 Ga0070696_100010019 Ga0070696_1000100196 335
554 3300005547 Ga0070693_100031745 Ga0070693_1000317452 335
555 3300005615 Ga0070702_100030421 Ga0070702_1000304213 335
556 3300005617 Ga0068859_100061028 Ga0068859_1000610283 335
557 3300005617 Ga0068859_100147708 Ga0068859_1001477082 335
558 3300005718 Ga0068866_10003557 Ga0068866_100035572 335
559 3300005719 Ga0068861_100009150 Ga0068861_1000091502 335
560 3300005840 Ga0068870_10095534 Ga0068870_100955342 335
561 3300005841 Ga0068863_100006757 Ga0068863_10000675710 335
562 3300005842 Ga0068858_100037353 Ga0068858_1000373533 335
563 3300005843 Ga0068860_100064634 Ga0068860_1000646342 335
564 3300005844 Ga0068862_100069128 Ga0068862_1000691282 335
565 3300006237 Ga0097621_100040818 Ga0097621_1000408182 335
566 3300006358 Ga0068871_100019043 Ga0068871_1000190434 335
567 3300006844 Ga0075428_100023506 Ga0075428_1000235062 335
568 3300006846 Ga0075430_100023708 Ga0075430_1000237089 335
569 3300006881 Ga0068865_100009129 Ga0068865_1000091293 335
570 3300006931 Ga0097620_100061031 Ga0097620_1000610312 335
571 3300006931 Ga0097620_100147712 Ga0097620_1001477122 335
572 3300009094 Ga0111539_10005851 Ga0111539_100058512 335
573 3300009098 Ga0105245_10140163 Ga0105245_101401632 335
574 3300009176 Ga0105242_10015533 Ga0105242_100155333 335
575 3300009545 Ga0105237_10022420 Ga0105237_100224206 335
576 3300009553 Ga0105249_10339772 Ga0105249_103397722 335
577 3300013297 Ga0157378_10009009 Ga0157378_100090096 335
578 3300014326 Ga0157380_10008501 Ga0157380_100085016 335
579 3300014968 Ga0157379_10232100 Ga0157379_102321002 335
580 3300025899 Ga0207642_10017270 Ga0207642_100172702 335
581 3300025925 Ga0207650_10001780 Ga0207650_1000178012 335
582 3300025926 Ga0207659_10004000 Ga0207659_100040005 335
583 3300025927 Ga0207687_10030877 Ga0207687_100308772 335
584 3300025934 Ga0207686_10035164 Ga0207686_100351643 335
585 3300025935 Ga0207709_10008967 Ga0207709_100089672 335
586 3300025936 Ga0207670_10107510 Ga0207670_101075102 335
587 3300025938 Ga0207704_10007294 Ga0207704_100072942 335
588 3300025942 Ga0207689_10001838 Ga0207689_1000183816 335
589 3300026041 Ga0207639_10022045 Ga0207639_100220453 335
590 3300026075 Ga0207708_10001796 Ga0207708_1000179614 335
591 3300026075 Ga0207708_10014335 Ga0207708_100143352 335
592 3300026088 Ga0207641_10024724 Ga0207641_100247243 335
593 3300026089 Ga0207648_10002392 Ga0207648_1000239217 335
594 3300026095 Ga0207676_10003104 Ga0207676_1000310411 335
595 3300026118 Ga0207675_100012953 Ga0207675_1000129536 335
596 3300026121 Ga0207683_10019442 Ga0207683_100194423 335
597 3300027907 Ga0207428_10002806 Ga0207428_1000280614 335
598 3300049571 Ga0501034_0128677 Ga0501034_0128677_253_1272 335
599 3300050509 nmdc:mga0qj67_15521_c1 nmdc:mga0qj67_15521_c1_964_2025 335
600 3300050511 nmdc:mga08y16_2754_c1 nmdc:mga08y16_2754_c1_3193_4227 335
601 3300041404 Ga0439436_0006031 Ga0439436_0006031_1432_2454 336
602 3300005364 Ga0070673_100330176 Ga0070673_1003301762 337
603 3300003187 JGI25151J46595_10002509 JGI25151J46595_100025097 339
604 3300003771 Ga0055526_1008754 Ga0055526_10087544 339
605 3300006948 Ga0099826_10000018 Ga0099826_1000001884 339
606 3300025284 Ga0209130_1006067 Ga0209130_10060671 339
607 3300025291 Ga0209675_1000100 Ga0209675_100010099 339
608 3300025292 Ga0209676_1000012 Ga0209676_1000012757 339
609 3300025294 Ga0209025_1001877 Ga0209025_100187716 339
610 3300025294 Ga0209025_1032186 Ga0209025_10321862 339
611 3300025295 Ga0209564_1002674 Ga0209564_10026745 339
612 3300025295 Ga0209564_1002716 Ga0209564_10027167 339
613 3300044656 Ga0466969_0025156 Ga0466969_0025156_1064_2095 339

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00296

Bac_luciferase

Luciferase-like monooxygenase

18

322

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
4us5-assembly2.cif.gz_C crystal structure of apo-msno8 0.9311 8 337
4us5-assembly2.cif.gz_D crystal structure of apo-msno8 0.9304 7 337
4us5-assembly1.cif.gz_A crystal structure of apo-msno8 0.9301 8 337
4us5-assembly2.cif.gz_C crystal structure of apo-msno8 0.9175 8 337
4us5-assembly1.cif.gz_A crystal structure of apo-msno8 0.9165 8 337
ID Description Score Start End Superfamily
af_P0ADV5_3_330_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9393 8 334 3.20.20.30
af_Q2G151_1_332_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9256 8 335 3.20.20.30
af_P0ADV5_3_330_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9255 8 334 3.20.20.30
4us5A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9133 8 337 3.20.20.30
af_Q2G151_1_332_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.912 8 335 3.20.20.30
ID Description Score Start End GO Terms
AF-A0A4U1HNQ0-F1-model_v4 LLM class flavin-dependent oxidoreductase 0.9969 8 337 GO:0005829
GO:0016705
AF-A0A0S8B8R0-F1-model_v4 Luciferase 0.9875 8 268 GO:0005829
GO:0016705
AF-X8CPQ9-F1-model_v4 Luciferase oxidoreductase, group 1 family protein (EC 1.-.-.-) 0.9835 8 119 GO:0016705
GO:0071949
AF-A0A2N5XJM8-F1-model_v4 Alkanal monooxygenase 0.9823 8 119 GO:0004497
GO:0005829
GO:0016705
AF-A0A250JW90-F1-model_v4 Luciferase 0.9795 8 337 GO:0005829
GO:0016705

Feature Viewer

pLDDT pTM Quality
94.43 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map