F469249
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 613 | 336 | 590 | 333 |
Family's Representative Sequence
| Representative Sequence | 3300009176|Ga0105242_10015533|Ga0105242_100155333 |
| Length | 356 |
| Sequence | VRGCNRPAAYRANAVGGLRLSILDQSPIVSGGSSADALRATVALAQRADQLGYHRYWLAEHHNMRGLADPCPEILVGHVAAATRTIRVGTGGVMLPYYSPLKVAEVFRMHEALHPRRIDLGIGRAPGGDRMTANAMNAHAFDDMEDFPRQVMEVVGWLDRTLPEEHPYSTVQAMPSGLGSPEVWLLGSSDYSGALAAYLGLRFAFAHFINAHGGDAVARAYRTDFRASLRESAPYSMVCVFALCAQTEAEAQRLALSIDHRRLLMSVGREAPIASVAEAQAYPYTDRDRAIIERXXARAIIGTPDKVKSRLLEIAESYGADELMVVTITGDYASRMRSYELLAAEFALDTATGAAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2501025501 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 2 | 2501025502 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 3 | 2501025504 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 4 | 2510917013 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 5 | 2510917014 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 6 | 2510917015 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 7 | 2513237082 | Paraburkholderia mimosarum STM3621 | Isolate | Nodule |
| 8 | 2513237083 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 9 | 2513237166 | Paraburkholderia azotifigens UYPR1.413 | Isolate | Nodule |
| 10 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 11 | 2562617112 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 12 | 2600255067 | Paraburkholderia kururiensis thiooxydans NBRC 107107 | Isolate | Unclassified |
| 13 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 14 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 15 | 2842775625 | Roseomonas sp. R-71825 | Isolate | Unclassified |
| 16 | 2856287931 | Paraburkholderia bannensis BE22 | Isolate | Rhizosphere |
| 17 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 18 | 2883087390 | Paraburkholderia guartelaensis CNPSo 3008 | Isolate | Unclassified |
| 19 | 2904615490 | Paraburkholderia franconis CNPSo 3157 | Isolate | Unclassified |
| 20 | 2919034639 | Paenarthrobacter nitroguajacolicus 247 | Isolate | Rhizosphere |
| 21 | 2932426870 | Paenarthrobacter sp. 4246 | Isolate | Rhizosphere |
| 22 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 23 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 24 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 25 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 26 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 31 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 34 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 51 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 56 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 64 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 65 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 66 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 68 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 69 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 70 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 71 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 72 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 73 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 74 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 75 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 76 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 77 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 78 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 80 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 82 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 83 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 84 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 85 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 86 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 87 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 88 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 89 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 91 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 92 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 93 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 94 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 105 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 116 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 119 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 122 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 170 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 174 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 175 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 176 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 177 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 178 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 179 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 180 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 181 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 182 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 183 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 184 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 185 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 186 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 187 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 188 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 189 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 190 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 191 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 192 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 193 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 194 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 195 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 196 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 197 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 198 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 199 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 200 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 201 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 202 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 203 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 204 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 205 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 206 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 207 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 208 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 209 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 210 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 211 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 212 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 213 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 214 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 215 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 216 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 217 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 218 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 219 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 220 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 221 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 222 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 223 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 277 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 278 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 279 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 280 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 281 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 282 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 283 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 284 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 285 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 286 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 287 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 288 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 289 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 290 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 291 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 292 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 293 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 317 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 328 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 329 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 330 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 331 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 332 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 335 | 642555112 | Paraburkholderia phymatum STM815 | Isolate | Nodule |
| 336 | 8003955200 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.25 |
| Metatranscriptomes | 0 |
| Isolates | 3.75 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.94 |
| Nodule | 0.98 |
| Rhizoplane | 2.45 |
| Rhizosphere | 90.05 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.59 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25151J46595_10002509 | 3300003187 | Bacteria | 10932 |
| 2 | rootL2_10089033 | 3300003322 | Bacteria | 2154 |
| 3 | JGI25160J50197_1000279 | 3300003354 | Bacteria | 37135 |
| 4 | Ga0055526_1008754 | 3300003771 | Bacteria | 4990 |
| 5 | Ga0070676_10124668 | 3300005328 | Bacteria | 1621 |
| 6 | Ga0070683_100331926 | 3300005329 | Unclassified | 1448 |
| 7 | Ga0070690_100000235 | 3300005330 | Bacteria | 28411 |
| 8 | Ga0070690_100009422 | 3300005330 | Bacteria | 5657 |
| 9 | Ga0070690_100059202 | 3300005330 | Bacteria | 2462 |
| 10 | Ga0070690_100129672 | 3300005330 | Bacteria | 1702 |
| 11 | Ga0070670_100084019 | 3300005331 | Bacteria | 2735 |
| 12 | Ga0070670_100137031 | 3300005331 | Unclassified | 2115 |
| 13 | Ga0068869_100000023 | 3300005334 | Bacteria | 64701 |
| 14 | Ga0068869_100002090 | 3300005334 | Bacteria | 12011 |
| 15 | Ga0068869_100019561 | 3300005334 | Bacteria | 4629 |
| 16 | Ga0068869_100030337 | 3300005334 | Bacteria | 3795 |
| 17 | Ga0070666_10053867 | 3300005335 | Bacteria | 2714 |
| 18 | Ga0070666_10083907 | 3300005335 | Bacteria | 2180 |
| 19 | Ga0070680_100086548 | 3300005336 | Bacteria | 2590 |
| 20 | Ga0068868_100006228 | 3300005338 | Bacteria | 8444 |
| 21 | Ga0068868_100234279 | 3300005338 | Bacteria | 1541 |
| 22 | Ga0070689_100087696 | 3300005340 | Bacteria | 2448 |
| 23 | Ga0070689_100194966 | 3300005340 | Bacteria | 1651 |
| 24 | Ga0070691_10015276 | 3300005341 | Bacteria | 3528 |
| 25 | Ga0070661_100042312 | 3300005344 | Bacteria | 3325 |
| 26 | Ga0070692_10031590 | 3300005345 | Bacteria | 2655 |
| 27 | Ga0070669_100010026 | 3300005353 | Bacteria | 6735 |
| 28 | Ga0070669_100322688 | 3300005353 | Bacteria | 1247 |
| 29 | Ga0070675_100014453 | 3300005354 | Bacteria | 6225 |
| 30 | Ga0070675_100039701 | 3300005354 | Unclassified | 3842 |
| 31 | Ga0070675_100082502 | 3300005354 | Bacteria | 2682 |
| 32 | Ga0070671_100030089 | 3300005355 | Bacteria | 4480 |
| 33 | Ga0070673_100330176 | 3300005364 | Bacteria | 1349 |
| 34 | Ga0070659_100106723 | 3300005366 | Bacteria | 2258 |
| 35 | Ga0070667_100019707 | 3300005367 | Bacteria | 5596 |
| 36 | Ga0070701_10043994 | 3300005438 | Bacteria | 2287 |
| 37 | Ga0070705_100056581 | 3300005440 | Bacteria | 2310 |
| 38 | Ga0070705_100057026 | 3300005440 | Bacteria | 2302 |
| 39 | Ga0070705_100136565 | 3300005440 | Bacteria | 1607 |
| 40 | Ga0070700_100003807 | 3300005441 | Bacteria | 7813 |
| 41 | Ga0070700_100215098 | 3300005441 | Bacteria | 1358 |
| 42 | Ga0070694_100035196 | 3300005444 | Bacteria | 3308 |
| 43 | Ga0070694_100052129 | 3300005444 | Bacteria | 2764 |
| 44 | Ga0070694_100081891 | 3300005444 | Bacteria | 2246 |
| 45 | Ga0070694_100100704 | 3300005444 | Bacteria | 2044 |
| 46 | Ga0070663_100003243 | 3300005455 | Bacteria | 9358 |
| 47 | Ga0070681_10000688 | 3300005458 | Bacteria | 28034 |
| 48 | Ga0070681_10016598 | 3300005458 | Bacteria | 7352 |
| 49 | Ga0068867_100003419 | 3300005459 | Bacteria | 11170 |
| 50 | Ga0068867_100041406 | 3300005459 | Bacteria | 3367 |
| 51 | Ga0068867_100075236 | 3300005459 | Bacteria | 2533 |
| 52 | Ga0070698_100020071 | 3300005471 | Bacteria | 7005 |
| 53 | Ga0070699_100047497 | 3300005518 | Bacteria | 3715 |
| 54 | Ga0070699_100191762 | 3300005518 | Bacteria | 1816 |
| 55 | Ga0070679_100008648 | 3300005530 | Bacteria | 9593 |
| 56 | Ga0070679_100078972 | 3300005530 | Bacteria | 3280 |
| 57 | Ga0070697_100012729 | 3300005536 | Bacteria | 6587 |
| 58 | Ga0068853_100025143 | 3300005539 | Bacteria | 4996 |
| 59 | Ga0070672_100207613 | 3300005543 | Bacteria | 1640 |
| 60 | Ga0070686_100137211 | 3300005544 | Bacteria | 1698 |
| 61 | Ga0070695_100002624 | 3300005545 | Bacteria | 10393 |
| 62 | Ga0070695_100063595 | 3300005545 | Bacteria | 2399 |
| 63 | Ga0070695_100086681 | 3300005545 | Bacteria | 2081 |
| 64 | Ga0070695_100090910 | 3300005545 | Bacteria | 2038 |
| 65 | Ga0070696_100010019 | 3300005546 | Bacteria | 6339 |
| 66 | Ga0070696_100075870 | 3300005546 | Bacteria | 2372 |
| 67 | Ga0070693_100031745 | 3300005547 | Bacteria | 2898 |
| 68 | Ga0070665_100066943 | 3300005548 | Bacteria | 3603 |
| 69 | Ga0070665_100361293 | 3300005548 | Bacteria | 1458 |
| 70 | Ga0070704_100005124 | 3300005549 | Bacteria | 7614 |
| 71 | Ga0070704_100116830 | 3300005549 | Bacteria | 2041 |
| 72 | Ga0068855_100085723 | 3300005563 | Bacteria | 3644 |
| 73 | Ga0068857_100166146 | 3300005577 | Bacteria | 2004 |
| 74 | Ga0068857_100264011 | 3300005577 | Bacteria | 1581 |
| 75 | Ga0068857_100330929 | 3300005577 | Bacteria | 1408 |
| 76 | Ga0068854_100165149 | 3300005578 | Bacteria | 1718 |
| 77 | Ga0070702_100030421 | 3300005615 | Bacteria | 2944 |
| 78 | Ga0068859_100014728 | 3300005617 | Bacteria | 7859 |
| 79 | Ga0068859_100049658 | 3300005617 | Bacteria | 4213 |
| 80 | Ga0068859_100061028 | 3300005617 | Bacteria | 3799 |
| 81 | Ga0068859_100111076 | 3300005617 | Bacteria | 2803 |
| 82 | Ga0068859_100147708 | 3300005617 | Bacteria | 2426 |
| 83 | Ga0068859_100367817 | 3300005617 | Bacteria | 1533 |
| 84 | Ga0068864_100012457 | 3300005618 | Bacteria | 7031 |
| 85 | Ga0068866_10003557 | 3300005718 | Bacteria | 6377 |
| 86 | Ga0068861_100009150 | 3300005719 | Bacteria | 6832 |
| 87 | Ga0068861_100026678 | 3300005719 | Bacteria | 4202 |
| 88 | Ga0068851_10033819 | 3300005834 | Unclassified | 2549 |
| 89 | Ga0068870_10031043 | 3300005840 | Bacteria | 2704 |
| 90 | Ga0068870_10095534 | 3300005840 | Bacteria | 1670 |
| 91 | Ga0068863_100006757 | 3300005841 | Bacteria | 11247 |
| 92 | Ga0068863_100043668 | 3300005841 | Bacteria | 4254 |
| 93 | Ga0068858_100037353 | 3300005842 | Bacteria | 4504 |
| 94 | Ga0068858_100090779 | 3300005842 | Bacteria | 2843 |
| 95 | Ga0068858_100191946 | 3300005842 | Bacteria | 1930 |
| 96 | Ga0068860_100064634 | 3300005843 | Bacteria | 3475 |
| 97 | Ga0068862_100030956 | 3300005844 | Bacteria | 4512 |
| 98 | Ga0068862_100069128 | 3300005844 | Bacteria | 3048 |
| 99 | Ga0068862_100231531 | 3300005844 | Bacteria | 1676 |
| 100 | Ga0068862_100349214 | 3300005844 | Bacteria | 1372 |
| 101 | Ga0081539_10000233 | 3300005985 | Bacteria | 130647 |
| 102 | Ga0070716_100008408 | 3300006173 | Bacteria | 5119 |
| 103 | Ga0075366_10037538 | 3300006195 | Bacteria | 2861 |
| 104 | Ga0097621_100040818 | 3300006237 | Bacteria | 3732 |
| 105 | Ga0097621_100082294 | 3300006237 | Unclassified | 2680 |
| 106 | Ga0097621_100118648 | 3300006237 | Bacteria | 2242 |
| 107 | Ga0097621_100173833 | 3300006237 | Bacteria | 1858 |
| 108 | Ga0068871_100001140 | 3300006358 | Bacteria | 17815 |
| 109 | Ga0068871_100019043 | 3300006358 | Bacteria | 5233 |
| 110 | Ga0068871_100054419 | 3300006358 | Bacteria | 3247 |
| 111 | Ga0075428_100023506 | 3300006844 | Bacteria | 6823 |
| 112 | Ga0075428_100055956 | 3300006844 | Bacteria | 4321 |
| 113 | Ga0075428_100329193 | 3300006844 | Bacteria | 1641 |
| 114 | Ga0075430_100003660 | 3300006846 | Bacteria | 12905 |
| 115 | Ga0075430_100005239 | 3300006846 | Bacteria | 10938 |
| 116 | Ga0075430_100023708 | 3300006846 | Bacteria | 5226 |
| 117 | Ga0075431_100016781 | 3300006847 | Bacteria | 7437 |
| 118 | Ga0075431_100046537 | 3300006847 | Bacteria | 4474 |
| 119 | Ga0075431_100071633 | 3300006847 | Bacteria | 3576 |
| 120 | Ga0075431_100221696 | 3300006847 | Bacteria | 1929 |
| 121 | Ga0075431_100288268 | 3300006847 | Bacteria | 1661 |
| 122 | Ga0075434_100028537 | 3300006871 | Bacteria | 5484 |
| 123 | Ga0075434_100223841 | 3300006871 | Bacteria | 1901 |
| 124 | Ga0075429_100000107 | 3300006880 | Bacteria | 47068 |
| 125 | Ga0075429_100188325 | 3300006880 | Bacteria | 1808 |
| 126 | Ga0068865_100004941 | 3300006881 | Bacteria | 8059 |
| 127 | Ga0068865_100009129 | 3300006881 | Bacteria | 6138 |
| 128 | Ga0068865_100039257 | 3300006881 | Bacteria | 3210 |
| 129 | Ga0068865_100118240 | 3300006881 | Bacteria | 1966 |
| 130 | Ga0075436_100000174 | 3300006914 | Bacteria | 40099 |
| 131 | Ga0075436_100007287 | 3300006914 | Bacteria | 7564 |
| 132 | Ga0075436_100014820 | 3300006914 | Bacteria | 5341 |
| 133 | Ga0075436_100022801 | 3300006914 | Bacteria | 4301 |
| 134 | Ga0097620_100014728 | 3300006931 | Bacteria | 7859 |
| 135 | Ga0097620_100049654 | 3300006931 | Bacteria | 4213 |
| 136 | Ga0097620_100061031 | 3300006931 | Bacteria | 3799 |
| 137 | Ga0097620_100111067 | 3300006931 | Bacteria | 2803 |
| 138 | Ga0097620_100147712 | 3300006931 | Bacteria | 2426 |
| 139 | Ga0097620_100367823 | 3300006931 | Bacteria | 1533 |
| 140 | Ga0099826_10000018 | 3300006948 | Bacteria | 198330 |
| 141 | Ga0075435_100017409 | 3300007076 | Bacteria | 5441 |
| 142 | Ga0099794_10003315 | 3300007265 | Bacteria | 6113 |
| 143 | Ga0099795_10009238 | 3300007788 | Bacteria | 2851 |
| 144 | Ga0105251_10001210 | 3300009011 | Bacteria | 22309 |
| 145 | Ga0111539_10005851 | 3300009094 | Bacteria | 15896 |
| 146 | Ga0111539_10022294 | 3300009094 | Bacteria | 7784 |
| 147 | Ga0111539_10037272 | 3300009094 | Bacteria | 5874 |
| 148 | Ga0111539_10510677 | 3300009094 | Bacteria | 1400 |
| 149 | Ga0105245_10140163 | 3300009098 | Bacteria | 2276 |
| 150 | Ga0114129_10017740 | 3300009147 | Bacteria | 10135 |
| 151 | Ga0114129_10121767 | 3300009147 | Bacteria | 3590 |
| 152 | Ga0114129_10227481 | 3300009147 | Bacteria | 2513 |
| 153 | Ga0105243_10115073 | 3300009148 | Bacteria | 2258 |
| 154 | Ga0105243_10190844 | 3300009148 | Unclassified | 1789 |
| 155 | Ga0105241_10003849 | 3300009174 | Bacteria | 11126 |
| 156 | Ga0105242_10015533 | 3300009176 | Bacteria | 5914 |
| 157 | Ga0105248_10018203 | 3300009177 | Bacteria | 7759 |
| 158 | Ga0105248_10037595 | 3300009177 | Bacteria | 5416 |
| 159 | Ga0105237_10022420 | 3300009545 | Bacteria | 6480 |
| 160 | Ga0105237_10310694 | 3300009545 | Bacteria | 1580 |
| 161 | Ga0105249_10135007 | 3300009553 | Bacteria | 2360 |
| 162 | Ga0105249_10188415 | 3300009553 | Bacteria | 2012 |
| 163 | Ga0105249_10339772 | 3300009553 | Bacteria | 1518 |
| 164 | Ga0099796_10097427 | 3300010159 | Bacteria | 1102 |
| 165 | Ga0105239_10034652 | 3300010375 | Bacteria | 5545 |
| 166 | Ga0105239_10418537 | 3300010375 | Bacteria | 1517 |
| 167 | Ga0105246_10035404 | 3300011119 | Bacteria | 3337 |
| 168 | Ga0157369_10270331 | 3300013105 | Bacteria | 1771 |
| 169 | Ga0157378_10009009 | 3300013297 | Bacteria | 8689 |
| 170 | Ga0157378_10059116 | 3300013297 | Bacteria | 3419 |
| 171 | Ga0157378_10357731 | 3300013297 | Bacteria | 1428 |
| 172 | Ga0163162_10000679 | 3300013306 | Bacteria | 31608 |
| 173 | Ga0163162_10031995 | 3300013306 | Bacteria | 5222 |
| 174 | Ga0163162_10107754 | 3300013306 | Bacteria | 2882 |
| 175 | Ga0157375_10019124 | 3300013308 | Bacteria | 6221 |
| 176 | Ga0157375_10034066 | 3300013308 | Bacteria | 4847 |
| 177 | Ga0157375_10137543 | 3300013308 | Unclassified | 2568 |
| 178 | Ga0157375_10157846 | 3300013308 | Bacteria | 2408 |
| 179 | Ga0157380_10008501 | 3300014326 | Bacteria | 7334 |
| 180 | Ga0157380_10221476 | 3300014326 | Bacteria | 1693 |
| 181 | Ga0157377_10046903 | 3300014745 | Bacteria | 2419 |
| 182 | Ga0157379_10232100 | 3300014968 | Bacteria | 1673 |
| 183 | Ga0157376_10028680 | 3300014969 | Bacteria | 4427 |
| 184 | Ga0157376_10040781 | 3300014969 | Unclassified | 3796 |
| 185 | Ga0157376_10055394 | 3300014969 | Bacteria | 3308 |
| 186 | Ga0183361_10009 | 3300016635 | Bacteria | 205218 |
| 187 | Ga0163161_10121651 | 3300017792 | Unclassified | 1962 |
| 188 | Ga0209130_1006067 | 3300025284 | Bacteria | 4012 |
| 189 | Ga0209675_1000100 | 3300025291 | Bacteria | 128565 |
| 190 | Ga0209676_1000012 | 3300025292 | Bacteria | 841431 |
| 191 | Ga0209025_1001877 | 3300025294 | Bacteria | 24578 |
| 192 | Ga0209025_1032186 | 3300025294 | Bacteria | 2459 |
| 193 | Ga0209564_1002674 | 3300025295 | Bacteria | 13531 |
| 194 | Ga0209564_1002716 | 3300025295 | Bacteria | 13354 |
| 195 | Ga0207426_1006086 | 3300025302 | Bacteria | 5321 |
| 196 | Ga0207656_10023035 | 3300025321 | Bacteria | 2504 |
| 197 | Ga0207713_1003216 | 3300025735 | Bacteria | 11274 |
| 198 | Ga0207642_10017270 | 3300025899 | Bacteria | 2740 |
| 199 | Ga0207642_10035862 | 3300025899 | Bacteria | 2123 |
| 200 | Ga0207680_10039106 | 3300025903 | Bacteria | 2750 |
| 201 | Ga0207647_10063243 | 3300025904 | Bacteria | 2251 |
| 202 | Ga0207705_10336356 | 3300025909 | Bacteria | 1162 |
| 203 | Ga0207654_10027853 | 3300025911 | Bacteria | 3075 |
| 204 | Ga0207707_10021130 | 3300025912 | Bacteria | 5688 |
| 205 | Ga0207671_10205945 | 3300025914 | Bacteria | 1537 |
| 206 | Ga0207660_10056874 | 3300025917 | Bacteria | 2800 |
| 207 | Ga0207649_10138249 | 3300025920 | Unclassified | 1663 |
| 208 | Ga0207681_10017627 | 3300025923 | Bacteria | 4487 |
| 209 | Ga0207650_10001780 | 3300025925 | Bacteria | 15235 |
| 210 | Ga0207650_10020629 | 3300025925 | Bacteria | 4648 |
| 211 | Ga0207650_10144682 | 3300025925 | Unclassified | 1871 |
| 212 | Ga0207659_10004000 | 3300025926 | Bacteria | 8895 |
| 213 | Ga0207659_10008630 | 3300025926 | Bacteria | 6340 |
| 214 | Ga0207659_10181973 | 3300025926 | Bacteria | 1666 |
| 215 | Ga0207659_10365314 | 3300025926 | Bacteria | 1200 |
| 216 | Ga0207687_10030877 | 3300025927 | Bacteria | 3617 |
| 217 | Ga0207706_10007023 | 3300025933 | Bacteria | 10409 |
| 218 | Ga0207686_10035164 | 3300025934 | Bacteria | 3005 |
| 219 | Ga0207709_10008967 | 3300025935 | Bacteria | 5517 |
| 220 | Ga0207709_10182491 | 3300025935 | Bacteria | 1483 |
| 221 | Ga0207670_10107510 | 3300025936 | Bacteria | 2003 |
| 222 | Ga0207670_10126052 | 3300025936 | Bacteria | 1869 |
| 223 | Ga0207670_10272853 | 3300025936 | Bacteria | 1315 |
| 224 | Ga0207704_10007294 | 3300025938 | Bacteria | 5215 |
| 225 | Ga0207704_10024233 | 3300025938 | Bacteria | 3286 |
| 226 | Ga0207704_10090420 | 3300025938 | Bacteria | 2009 |
| 227 | Ga0207665_10000863 | 3300025939 | Bacteria | 20487 |
| 228 | Ga0207691_10022571 | 3300025940 | Bacteria | 5933 |
| 229 | Ga0207691_10162699 | 3300025940 | Bacteria | 1957 |
| 230 | Ga0207691_10263422 | 3300025940 | Unclassified | 1486 |
| 231 | Ga0207689_10001838 | 3300025942 | Bacteria | 20080 |
| 232 | Ga0207689_10011310 | 3300025942 | Bacteria | 7658 |
| 233 | Ga0207689_10023895 | 3300025942 | Bacteria | 5127 |
| 234 | Ga0207689_10137006 | 3300025942 | Unclassified | 2016 |
| 235 | Ga0207679_10148378 | 3300025945 | Unclassified | 1905 |
| 236 | Ga0207667_10093541 | 3300025949 | Bacteria | 3104 |
| 237 | Ga0207651_10132394 | 3300025960 | Bacteria | 1911 |
| 238 | Ga0207651_10155229 | 3300025960 | Bacteria | 1787 |
| 239 | Ga0207712_10021581 | 3300025961 | Bacteria | 4229 |
| 240 | Ga0207658_10100983 | 3300025986 | Bacteria | 2260 |
| 241 | Ga0207677_10406912 | 3300026023 | Bacteria | 1155 |
| 242 | Ga0207703_10084380 | 3300026035 | Bacteria | 2656 |
| 243 | Ga0207639_10017759 | 3300026041 | Bacteria | 5045 |
| 244 | Ga0207639_10022045 | 3300026041 | Bacteria | 4584 |
| 245 | Ga0207678_10007848 | 3300026067 | Bacteria | 9417 |
| 246 | Ga0207708_10001796 | 3300026075 | Bacteria | 15801 |
| 247 | Ga0207708_10014335 | 3300026075 | Bacteria | 5931 |
| 248 | Ga0207708_10014488 | 3300026075 | Bacteria | 5900 |
| 249 | Ga0207708_10127660 | 3300026075 | Bacteria | 1986 |
| 250 | Ga0207641_10024724 | 3300026088 | Bacteria | 4951 |
| 251 | Ga0207648_10002392 | 3300026089 | Bacteria | 20203 |
| 252 | Ga0207648_10005404 | 3300026089 | Bacteria | 12878 |
| 253 | Ga0207648_10026173 | 3300026089 | Bacteria | 5186 |
| 254 | Ga0207648_10079866 | 3300026089 | Bacteria | 2853 |
| 255 | Ga0207648_10180258 | 3300026089 | Bacteria | 1869 |
| 256 | Ga0207676_10003104 | 3300026095 | Bacteria | 11853 |
| 257 | Ga0207674_10080555 | 3300026116 | Bacteria | 3259 |
| 258 | Ga0207674_10140223 | 3300026116 | Bacteria | 2377 |
| 259 | Ga0207674_10198225 | 3300026116 | Bacteria | 1957 |
| 260 | Ga0207674_10253358 | 3300026116 | Unclassified | 1707 |
| 261 | Ga0207674_10255971 | 3300026116 | Bacteria | 1697 |
| 262 | Ga0207675_100012953 | 3300026118 | Bacteria | 7787 |
| 263 | Ga0207675_100043011 | 3300026118 | Bacteria | 4218 |
| 264 | Ga0207683_10018182 | 3300026121 | Bacteria | 5995 |
| 265 | Ga0207683_10019442 | 3300026121 | Bacteria | 5800 |
| 266 | Ga0207698_10373842 | 3300026142 | Bacteria | 1354 |
| 267 | Ga0210000_1001084 | 3300027462 | Bacteria | 3811 |
| 268 | Ga0210000_1004157 | 3300027462 | Bacteria | 2091 |
| 269 | Ga0209995_1007759 | 3300027471 | Bacteria | 1729 |
| 270 | Ga0209995_1010912 | 3300027471 | Bacteria | 1476 |
| 271 | Ga0209999_1002676 | 3300027543 | Bacteria | 3150 |
| 272 | Ga0209999_1009959 | 3300027543 | Bacteria | 1716 |
| 273 | Ga0209971_1005841 | 3300027682 | Bacteria | 2915 |
| 274 | Ga0209966_1001147 | 3300027695 | Bacteria | 4733 |
| 275 | Ga0209974_10000470 | 3300027876 | Bacteria | 13400 |
| 276 | Ga0207428_10002806 | 3300027907 | Bacteria | 17304 |
| 277 | Ga0207428_10053294 | 3300027907 | Bacteria | 3226 |
| 278 | Ga0268266_10053509 | 3300028379 | Bacteria | 3469 |
| 279 | Ga0268266_10315200 | 3300028379 | Bacteria | 1462 |
| 280 | Ga0268266_10414575 | 3300028379 | Bacteria | 1276 |
| 281 | Ga0268265_10016240 | 3300028380 | Bacteria | 5110 |
| 282 | Ga0268265_10116117 | 3300028380 | Bacteria | 2195 |
| 283 | Ga0268265_10333094 | 3300028380 | Bacteria | 1379 |
| 284 | Ga0268264_10147790 | 3300028381 | Bacteria | 2103 |
| 285 | Ga0265338_10001217 | 3300028800 | Bacteria | 42536 |
| 286 | Ga0307511_10000108 | 3300030521 | Bacteria | 74238 |
| 287 | Ga0265328_10022541 | 3300031239 | Bacteria | 2395 |
| 288 | Ga0265329_10012019 | 3300031242 | Bacteria | 3128 |
| 289 | Ga0265339_10163541 | 3300031249 | Bacteria | 1118 |
| 290 | Ga0265331_10003333 | 3300031250 | Bacteria | 10423 |
| 291 | Ga0265327_10014887 | 3300031251 | Bacteria | 5063 |
| 292 | Ga0265316_10012711 | 3300031344 | Bacteria | 7527 |
| 293 | Ga0307408_100137853 | 3300031548 | Bacteria | 1911 |
| 294 | Ga0307408_100402255 | 3300031548 | Bacteria | 1176 |
| 295 | Ga0316575_10003242 | 3300031665 | Bacteria | 5587 |
| 296 | Ga0316575_10020705 | 3300031665 | Bacteria | 2525 |
| 297 | Ga0316579_10009712 | 3300031691 | Bacteria | 4050 |
| 298 | Ga0265314_10026186 | 3300031711 | Bacteria | 4385 |
| 299 | Ga0316578_10019166 | 3300031728 | Bacteria | 3760 |
| 300 | Ga0307413_10351759 | 3300031824 | Bacteria | 1137 |
| 301 | Ga0307416_100014967 | 3300032002 | Bacteria | 5339 |
| 302 | Ga0307416_100106501 | 3300032002 | Bacteria | 2458 |
| 303 | Ga0307507_10038968 | 3300033179 | Bacteria | 4805 |
| 304 | Ga0373934_0000044 | 3300035086 | Bacteria | 41857 |
| 305 | Ga0373934_0030676 | 3300035086 | Bacteria | 2102 |
| 306 | Ga0373923_0023873 | 3300035111 | Bacteria | 2409 |
| 307 | Ga0373936_0001037 | 3300035113 | Bacteria | 9932 |
| 308 | Ga0373936_0005669 | 3300035113 | Bacteria | 4709 |
| 309 | Ga0373945_0000906 | 3300035116 | Bacteria | 8768 |
| 310 | Ga0373954_0000020 | 3300035118 | Bacteria | 60211 |
| 311 | Ga0373954_0004897 | 3300035118 | Bacteria | 5778 |
| 312 | Ga0373954_0055678 | 3300035118 | Bacteria | 1860 |
| 313 | Ga0373956_0000003 | 3300035119 | Bacteria | 81669 |
| 314 | Ga0373956_0005962 | 3300035119 | Bacteria | 4873 |
| 315 | Ga0373957_0002342 | 3300035120 | Bacteria | 5386 |
| 316 | Ga0373957_0036047 | 3300035120 | Bacteria | 1841 |
| 317 | Ga0373943_0016340 | 3300035170 | Bacteria | 3383 |
| 318 | Ga0373943_0169279 | 3300035170 | Bacteria | 1194 |
| 319 | Ga0373946_0009414 | 3300035171 | Bacteria | 3597 |
| 320 | Ga0373946_0023271 | 3300035171 | Bacteria | 2419 |
| 321 | Ga0373955_0012959 | 3300035172 | Bacteria | 4019 |
| 322 | Ga0373955_0016708 | 3300035172 | Bacteria | 3616 |
| 323 | Ga0373962_0019089 | 3300035242 | Bacteria | 1790 |
| 324 | Ga0316574_0018491 | 3300035398 | Bacteria | 4096 |
| 325 | Ga0373924_0019331 | 3300035410 | Bacteria | 2638 |
| 326 | Ga0373931_0032335 | 3300035691 | Bacteria | 2707 |
| 327 | Ga0373931_0127047 | 3300035691 | Unclassified | 1463 |
| 328 | Ga0373931_0129370 | 3300035691 | Bacteria | 1451 |
| 329 | Ga0373935_0008672 | 3300035692 | Bacteria | 6086 |
| 330 | Ga0373935_0012489 | 3300035692 | Bacteria | 5107 |
| 331 | Ga0373935_0014087 | 3300035692 | Bacteria | 4827 |
| 332 | Ga0373927_0025420 | 3300035695 | Bacteria | 3872 |
| 333 | Ga0373927_0214445 | 3300035695 | Bacteria | 1264 |
| 334 | Ga0373933_0000107 | 3300035724 | Bacteria | 53134 |
| 335 | Ga0373933_0004387 | 3300035724 | Bacteria | 7746 |
| 336 | Ga0373933_0021741 | 3300035724 | Bacteria | 3647 |
| 337 | Ga0373933_0084844 | 3300035724 | Bacteria | 1946 |
| 338 | Ga0373947_0090163 | 3300035725 | Bacteria | 1911 |
| 339 | Ga0373937_0000179 | 3300036401 | Bacteria | 62280 |
| 340 | Ga0373937_0000196 | 3300036401 | Bacteria | 59256 |
| 341 | Ga0373937_0023517 | 3300036401 | Bacteria | 5549 |
| 342 | Ga0373937_0127941 | 3300036401 | Bacteria | 2371 |
| 343 | Ga0373937_0270218 | 3300036401 | Bacteria | 1604 |
| 344 | Ga0373937_0357400 | 3300036401 | Bacteria | 1384 |
| 345 | Ga0373925_0333686 | 3300037068 | Bacteria | 1229 |
| 346 | Ga0436360_0400716 | 3300039438 | Bacteria | 1106 |
| 347 | Ga0439436_0006031 | 3300041404 | Bacteria | 3714 |
| 348 | Ga0451839_1137150 | 3300041496 | Bacteria | 1095 |
| 349 | Ga0439441_001631 | 3300042001 | Bacteria | 2995 |
| 350 | Ga0439441_002320 | 3300042001 | Bacteria | 2669 |
| 351 | Ga0450920_004910 | 3300042122 | Bacteria | 2364 |
| 352 | Ga0439446_0061945 | 3300042156 | Bacteria | 1132 |
| 353 | Ga0439434_0001975 | 3300042435 | Bacteria | 5939 |
| 354 | Ga0439435_0000025 | 3300042436 | Bacteria | 16268 |
| 355 | Ga0451577_0205479 | 3300042876 | Bacteria | 1778 |
| 356 | Ga0451577_0365537 | 3300042876 | Bacteria | 1309 |
| 357 | Ga0466969_0025156 | 3300044656 | Bacteria | 3063 |
| 358 | Ga0453684_0272373 | 3300044712 | Bacteria | 1934 |
| 359 | Ga0466970_0102432 | 3300044765 | Bacteria | 1560 |
| 360 | Ga0451576_0036919 | 3300045051 | Bacteria | 5177 |
| 361 | Ga0451576_0248265 | 3300045051 | Bacteria | 1860 |
| 362 | Ga0451576_0421390 | 3300045051 | Bacteria | 1400 |
| 363 | Ga0466967_0558806 | 3300045976 | Bacteria | 1127 |
| 364 | Ga0495592_0007672 | 3300046454 | Bacteria | 8076 |
| 365 | Ga0495592_0022957 | 3300046454 | Bacteria | 4747 |
| 366 | Ga0495603_0033367 | 3300046455 | Bacteria | 3097 |
| 367 | Ga0495603_0040850 | 3300046455 | Bacteria | 2775 |
| 368 | Ga0495590_0000630 | 3300046457 | Bacteria | 16380 |
| 369 | Ga0495590_0022510 | 3300046457 | Bacteria | 2229 |
| 370 | Ga0495629_0071962 | 3300046459 | Bacteria | 2413 |
| 371 | Ga0495629_0172360 | 3300046459 | Bacteria | 1501 |
| 372 | Ga0495641_0011338 | 3300046461 | Bacteria | 5088 |
| 373 | Ga0495651_0000105 | 3300046462 | Bacteria | 61688 |
| 374 | Ga0495653_0016485 | 3300046463 | Bacteria | 6014 |
| 375 | Ga0495580_0008453 | 3300046472 | Bacteria | 8188 |
| 376 | Ga0495580_0022721 | 3300046472 | Bacteria | 4611 |
| 377 | Ga0495582_0015437 | 3300046473 | Bacteria | 4195 |
| 378 | Ga0495582_0165219 | 3300046473 | Bacteria | 1259 |
| 379 | Ga0495605_0021878 | 3300046474 | Bacteria | 3382 |
| 380 | Ga0495639_0011536 | 3300046475 | Bacteria | 3811 |
| 381 | Ga0495662_0008758 | 3300046476 | Bacteria | 4977 |
| 382 | Ga0495662_0016590 | 3300046476 | Bacteria | 3568 |
| 383 | Ga0495606_0063944 | 3300046507 | Bacteria | 2343 |
| 384 | Ga0495606_0086766 | 3300046507 | Bacteria | 1933 |
| 385 | Ga0495608_0001028 | 3300046511 | Bacteria | 19566 |
| 386 | Ga0495618_0010655 | 3300046514 | Bacteria | 5564 |
| 387 | Ga0495618_0057962 | 3300046514 | Bacteria | 2452 |
| 388 | Ga0495620_0018493 | 3300046515 | Bacteria | 3450 |
| 389 | Ga0495628_0004763 | 3300046516 | Bacteria | 11955 |
| 390 | Ga0495628_0015546 | 3300046516 | Bacteria | 6354 |
| 391 | Ga0495628_0016012 | 3300046516 | Bacteria | 6255 |
| 392 | Ga0495628_0072664 | 3300046516 | Bacteria | 2680 |
| 393 | Ga0495628_0188951 | 3300046516 | Bacteria | 1556 |
| 394 | Ga0495630_0001187 | 3300046517 | Bacteria | 17958 |
| 395 | Ga0495630_0012901 | 3300046517 | Bacteria | 6071 |
| 396 | Ga0495630_0129733 | 3300046517 | Bacteria | 1914 |
| 397 | Ga0495666_0007432 | 3300046526 | Bacteria | 5491 |
| 398 | Ga0495666_0031526 | 3300046526 | Bacteria | 2596 |
| 399 | Ga0495666_0046395 | 3300046526 | Bacteria | 2094 |
| 400 | Ga0495642_0010968 | 3300046528 | Bacteria | 3474 |
| 401 | Ga0495642_0045194 | 3300046528 | Bacteria | 1800 |
| 402 | Ga0495652_0003931 | 3300046529 | Bacteria | 14435 |
| 403 | Ga0495652_0071319 | 3300046529 | Bacteria | 2900 |
| 404 | Ga0495652_0209072 | 3300046529 | Bacteria | 1475 |
| 405 | Ga0495652_0315504 | 3300046529 | Bacteria | 1131 |
| 406 | Ga0495665_0014916 | 3300046531 | Bacteria | 4184 |
| 407 | Ga0495665_0023190 | 3300046531 | Bacteria | 3332 |
| 408 | Ga0495665_0109617 | 3300046531 | Bacteria | 1448 |
| 409 | Ga0495640_0018063 | 3300046533 | Bacteria | 5241 |
| 410 | Ga0495640_0039390 | 3300046533 | Bacteria | 3316 |
| 411 | Ga0495586_0012876 | 3300046535 | Bacteria | 4435 |
| 412 | Ga0495586_0144227 | 3300046535 | Bacteria | 1337 |
| 413 | Ga0495587_0031268 | 3300046536 | Bacteria | 3224 |
| 414 | Ga0495587_0149903 | 3300046536 | Bacteria | 1329 |
| 415 | Ga0495598_0001660 | 3300046537 | Bacteria | 4466 |
| 416 | Ga0495597_0007513 | 3300046542 | Bacteria | 5527 |
| 417 | Ga0495645_0002326 | 3300046543 | Bacteria | 12893 |
| 418 | Ga0495645_0163772 | 3300046543 | Bacteria | 1535 |
| 419 | Ga0495645_0165059 | 3300046543 | Bacteria | 1528 |
| 420 | Ga0495622_0089957 | 3300046557 | Bacteria | 1410 |
| 421 | Ga0495667_0000709 | 3300046559 | Bacteria | 21330 |
| 422 | Ga0495656_0042980 | 3300046615 | Bacteria | 1895 |
| 423 | Ga0495668_0163395 | 3300046616 | Bacteria | 1220 |
| 424 | Ga0495634_0002751 | 3300046642 | Bacteria | 14465 |
| 425 | Ga0495657_0056249 | 3300046675 | Bacteria | 2620 |
| 426 | Ga0495599_0017778 | 3300046678 | Bacteria | 4425 |
| 427 | Ga0495599_0035454 | 3300046678 | Bacteria | 3132 |
| 428 | Ga0495623_0024279 | 3300046679 | Bacteria | 3907 |
| 429 | Ga0495647_0000149 | 3300046681 | Bacteria | 17854 |
| 430 | Ga0495658_0004885 | 3300046683 | Bacteria | 6577 |
| 431 | Ga0495669_0010017 | 3300046684 | Bacteria | 4007 |
| 432 | Ga0495669_0015535 | 3300046684 | Bacteria | 3261 |
| 433 | Ga0495669_0182772 | 3300046684 | Bacteria | 1000 |
| 434 | Ga0495670_0007900 | 3300046691 | Bacteria | 5230 |
| 435 | Ga0495649_0021009 | 3300046694 | Bacteria | 3660 |
| 436 | Ga0495589_0017714 | 3300046794 | Bacteria | 3655 |
| 437 | Ga0495589_0094820 | 3300046794 | Bacteria | 1448 |
| 438 | Ga0495600_0005190 | 3300046809 | Bacteria | 7830 |
| 439 | Ga0495604_0013367 | 3300047317 | Bacteria | 6537 |
| 440 | Ga0495604_0104703 | 3300047317 | Bacteria | 2072 |
| 441 | Ga0495676_0024337 | 3300047321 | Bacteria | 5244 |
| 442 | Ga0495680_0013596 | 3300047322 | Bacteria | 7091 |
| 443 | Ga0495680_0014849 | 3300047322 | Bacteria | 6732 |
| 444 | Ga0495680_0078630 | 3300047322 | Bacteria | 2496 |
| 445 | Ga0495680_0091382 | 3300047322 | Bacteria | 2282 |
| 446 | Ga0495680_0167984 | 3300047322 | Bacteria | 1589 |
| 447 | Ga0495683_0001407 | 3300047323 | Bacteria | 15868 |
| 448 | Ga0495683_0079052 | 3300047323 | Bacteria | 1606 |
| 449 | Ga0495687_000169 | 3300047443 | Bacteria | 97243 |
| 450 | Ga0495675_0028377 | 3300047444 | Bacteria | 3567 |
| 451 | Ga0495675_0118543 | 3300047444 | Bacteria | 1649 |
| 452 | Ga0495684_0101956 | 3300047471 | Bacteria | 2169 |
| 453 | Ga0495684_0103336 | 3300047471 | Bacteria | 2154 |
| 454 | Ga0495593_0115617 | 3300047673 | Bacteria | 1367 |
| 455 | Ga0495602_0016723 | 3300048088 | Bacteria | 7368 |
| 456 | Ga0495614_0102793 | 3300048089 | Bacteria | 1250 |
| 457 | Ga0496100_0043465 | 3300048903 | Bacteria | 2873 |
| 458 | Ga0496100_0101744 | 3300048903 | Bacteria | 1981 |
| 459 | Ga0496101_0014626 | 3300048904 | Bacteria | 5277 |
| 460 | Ga0496101_0024961 | 3300048904 | Bacteria | 4143 |
| 461 | Ga0496102_0001320 | 3300048905 | Bacteria | 22249 |
| 462 | Ga0496102_0021149 | 3300048905 | Bacteria | 5753 |
| 463 | Ga0496103_0007295 | 3300048906 | Bacteria | 6589 |
| 464 | Ga0496103_0093651 | 3300048906 | Bacteria | 1897 |
| 465 | Ga0496106_0017418 | 3300048909 | Bacteria | 5316 |
| 466 | Ga0496106_0057379 | 3300048909 | Bacteria | 2944 |
| 467 | Ga0496107_0010544 | 3300048910 | Bacteria | 6424 |
| 468 | Ga0496110_0065985 | 3300048913 | Unclassified | 3200 |
| 469 | Ga0496111_0023860 | 3300048914 | Bacteria | 4298 |
| 470 | Ga0496113_0017346 | 3300048916 | Bacteria | 4995 |
| 471 | Ga0496115_0339750 | 3300048918 | Bacteria | 1226 |
| 472 | Ga0496116_0025650 | 3300048919 | Bacteria | 4329 |
| 473 | Ga0496119_0078263 | 3300048922 | Bacteria | 1913 |
| 474 | Ga0496122_0007506 | 3300048925 | Bacteria | 12093 |
| 475 | Ga0496123_0057060 | 3300048926 | Bacteria | 2545 |
| 476 | Ga0496124_0016661 | 3300048927 | Bacteria | 6973 |
| 477 | Ga0496124_0126888 | 3300048927 | Bacteria | 2031 |
| 478 | Ga0496125_0009210 | 3300048928 | Bacteria | 10201 |
| 479 | Ga0496126_0006916 | 3300048929 | Bacteria | 12564 |
| 480 | Ga0501034_0000235 | 3300049571 | Bacteria | 102844 |
| 481 | Ga0501034_0005666 | 3300049571 | Bacteria | 13590 |
| 482 | Ga0501034_0034677 | 3300049571 | Bacteria | 5117 |
| 483 | Ga0501034_0128677 | 3300049571 | Bacteria | 2516 |
| 484 | Ga0501036_0023727 | 3300049572 | Bacteria | 5169 |
| 485 | Ga0501036_0098655 | 3300049572 | Bacteria | 2470 |
| 486 | Ga0501036_0115111 | 3300049572 | Bacteria | 2272 |
| 487 | Ga0501037_0008126 | 3300049573 | Bacteria | 7688 |
| 488 | Ga0501038_0075226 | 3300049574 | Bacteria | 2855 |
| 489 | Ga0501039_0004640 | 3300049575 | Bacteria | 10390 |
| 490 | Ga0501039_0009714 | 3300049575 | Bacteria | 7333 |
| 491 | Ga0501039_0043879 | 3300049575 | Bacteria | 3454 |
| 492 | Ga0501039_0065971 | 3300049575 | Bacteria | 2809 |
| 493 | Ga0501039_0173601 | 3300049575 | Bacteria | 1695 |
| 494 | Ga0501040_0035670 | 3300049576 | Bacteria | 3374 |
| 495 | Ga0501040_0040558 | 3300049576 | Bacteria | 3168 |
| 496 | Ga0501040_0044985 | 3300049576 | Bacteria | 3010 |
| 497 | Ga0501041_0001754 | 3300049577 | Bacteria | 12159 |
| 498 | Ga0501041_0002164 | 3300049577 | Bacteria | 11086 |
| 499 | Ga0501041_0005052 | 3300049577 | Bacteria | 7684 |
| 500 | Ga0501041_0056473 | 3300049577 | Bacteria | 2399 |
| 501 | Ga0501041_0123401 | 3300049577 | Bacteria | 1611 |
| 502 | Ga0501041_0134693 | 3300049577 | Bacteria | 1539 |
| 503 | Ga0501042_0014362 | 3300049578 | Bacteria | 5405 |
| 504 | Ga0501042_0034026 | 3300049578 | Bacteria | 3614 |
| 505 | Ga0501042_0091522 | 3300049578 | Bacteria | 2183 |
| 506 | Ga0501042_0255720 | 3300049578 | Bacteria | 1264 |
| 507 | Ga0501042_0289384 | 3300049578 | Bacteria | 1183 |
| 508 | Ga0501046_0014507 | 3300049580 | Bacteria | 6645 |
| 509 | Ga0501046_0036810 | 3300049580 | Bacteria | 3936 |
| 510 | Ga0501046_0127722 | 3300049580 | Bacteria | 1930 |
| 511 | Ga0501048_0006221 | 3300049582 | Bacteria | 9081 |
| 512 | Ga0501048_0135102 | 3300049582 | Bacteria | 1743 |
| 513 | Ga0501068_0000232 | 3300049584 | Bacteria | 27160 |
| 514 | Ga0501068_0104779 | 3300049584 | Bacteria | 1755 |
| 515 | Ga0501071_0010642 | 3300049587 | Bacteria | 6170 |
| 516 | Ga0501071_0020400 | 3300049587 | Bacteria | 4605 |
| 517 | Ga0501071_0055954 | 3300049587 | Bacteria | 2848 |
| 518 | Ga0501071_0056794 | 3300049587 | Bacteria | 2828 |
| 519 | Ga0501071_0066885 | 3300049587 | Bacteria | 2613 |
| 520 | Ga0501072_0000763 | 3300049588 | Bacteria | 23454 |
| 521 | Ga0501072_0001017 | 3300049588 | Bacteria | 20765 |
| 522 | Ga0501072_0112707 | 3300049588 | Bacteria | 2165 |
| 523 | Ga0501072_0115148 | 3300049588 | Bacteria | 2140 |
| 524 | Ga0501072_0129126 | 3300049588 | Bacteria | 2014 |
| 525 | Ga0501073_0000752 | 3300049589 | Bacteria | 22939 |
| 526 | Ga0501073_0058294 | 3300049589 | Bacteria | 2699 |
| 527 | Ga0501074_0035810 | 3300049590 | Bacteria | 3596 |
| 528 | Ga0501074_0073533 | 3300049590 | Bacteria | 2455 |
| 529 | Ga0501074_0143724 | 3300049590 | Bacteria | 1706 |
| 530 | Ga0501075_0000926 | 3300049591 | Bacteria | 18608 |
| 531 | Ga0501075_0004661 | 3300049591 | Bacteria | 9303 |
| 532 | Ga0501075_0059159 | 3300049591 | Bacteria | 2886 |
| 533 | Ga0501076_0000948 | 3300049592 | Bacteria | 18921 |
| 534 | Ga0501076_0003118 | 3300049592 | Bacteria | 11548 |
| 535 | Ga0501076_0011561 | 3300049592 | Bacteria | 6582 |
| 536 | Ga0501076_0031041 | 3300049592 | Bacteria | 4164 |
| 537 | Ga0501077_0016328 | 3300049593 | Bacteria | 4679 |
| 538 | Ga0501077_0035197 | 3300049593 | Bacteria | 3188 |
| 539 | Ga0501079_0000752 | 3300049741 | Bacteria | 22032 |
| 540 | Ga0501079_0000812 | 3300049741 | Bacteria | 21278 |
| 541 | Ga0501079_0147202 | 3300049741 | Bacteria | 1836 |
| 542 | Ga0501080_0000996 | 3300049742 | Bacteria | 23234 |
| 543 | Ga0501080_0038629 | 3300049742 | Bacteria | 4456 |
| 544 | Ga0501080_0052445 | 3300049742 | Bacteria | 3796 |
| 545 | Ga0501080_0062544 | 3300049742 | Bacteria | 3464 |
| 546 | Ga0501080_0159439 | 3300049742 | Bacteria | 2084 |
| 547 | Ga0501081_0000928 | 3300049743 | Bacteria | 17394 |
| 548 | Ga0501081_0020876 | 3300049743 | Bacteria | 4370 |
| 549 | Ga0501081_0105433 | 3300049743 | Bacteria | 1997 |
| 550 | Ga0501081_0168534 | 3300049743 | Bacteria | 1580 |
| 551 | Ga0501035_0046680 | 3300049822 | Bacteria | 3896 |
| 552 | Ga0501045_0000399 | 3300049824 | Bacteria | 26386 |
| 553 | Ga0501045_0008896 | 3300049824 | Bacteria | 7011 |
| 554 | Ga0501045_0059667 | 3300049824 | Bacteria | 2795 |
| 555 | nmdc:mga0k408_9059_c1 | 3300050493 | Bacteria | 5357 |
| 556 | nmdc:mga05p37_1054_c1 | 3300050507 | Bacteria | 31460 |
| 557 | nmdc:mga09592_100_c1 | 3300050508 | Bacteria | 52155 |
| 558 | nmdc:mga0qj67_15521_c1 | 3300050509 | Bacteria | 5766 |
| 559 | nmdc:mga0qj67_81_c1 | 3300050509 | Bacteria | 65783 |
| 560 | nmdc:mga0qj67_9124_c1 | 3300050509 | Bacteria | 7360 |
| 561 | nmdc:mga06r32_17414_c1 | 3300050510 | Bacteria | 6557 |
| 562 | nmdc:mga06r32_292659_c1 | 3300050510 | Bacteria | 1615 |
| 563 | nmdc:mga06r32_32788_c1 | 3300050510 | Bacteria | 4890 |
| 564 | nmdc:mga06r32_553056_c1 | 3300050510 | Bacteria | 1125 |
| 565 | nmdc:mga08y16_141005_c1 | 3300050511 | Bacteria | 2506 |
| 566 | nmdc:mga08y16_2754_c1 | 3300050511 | Bacteria | 18021 |
| 567 | nmdc:mga08y16_463707_c1 | 3300050511 | Bacteria | 1291 |
| 568 | nmdc:mga08y16_52510_c1 | 3300050511 | Bacteria | 4265 |
| 569 | nmdc:mga0n895_29098_c1 | 3300050512 | Bacteria | 5264 |
| 570 | nmdc:mga0n895_303871_c1 | 3300050512 | Bacteria | 1617 |
| 571 | nmdc:mga0rr50_56901_c1 | 3300050513 | Bacteria | 2923 |
| 572 | nmdc:mga08x19_20027_c1 | 3300050514 | Bacteria | 4116 |
| 573 | nmdc:mga08x19_20825_c1 | 3300050514 | Bacteria | 4042 |
| 574 | nmdc:mga08x19_41159_c1 | 3300050514 | Bacteria | 2943 |
| 575 | nmdc:mga08x19_62143_c1 | 3300050514 | Bacteria | 2421 |
| 576 | Ga0495601_0000321 | 3300053077 | Bacteria | 25398 |
| 577 | Ga0495595_0036022 | 3300053084 | Bacteria | 2243 |
| 578 | Ga0500646_0003828 | 3300053090 | Bacteria | 3843 |
| 579 | Ga0500594_0023518 | 3300053118 | Bacteria | 1563 |
| 580 | Ga0500655_002776 | 3300053133 | Bacteria | 3179 |
| 581 | Ga0500568_0013943 | 3300053139 | Bacteria | 3647 |
| 582 | Ga0500604_0000154 | 3300053151 | Bacteria | 20178 |
| 583 | Ga0501084_0007233 | 3300054114 | Bacteria | 9150 |
| 584 | Ga0501084_0158523 | 3300054114 | Bacteria | 1909 |
| 585 | Ga0501082_0005827 | 3300060353 | Bacteria | 10698 |
| 586 | Ga0501082_0008788 | 3300060353 | Bacteria | 8710 |
| 587 | Ga0501082_0141215 | 3300060353 | Bacteria | 2090 |
| 588 | Ga0501082_0355212 | 3300060353 | Bacteria | 1278 |
| 589 | Ga0530510_0000542 | 3300061734 | Bacteria | 24234 |
| 590 | Ga0530510_0000661 | 3300061734 | Bacteria | 22301 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046684 | Ga0495669_0182772 | Ga0495669_0182772_126_959 | 275 |
| 2 | 3300027471 | Ga0209995_1007759 | Ga0209995_10077592 | 280 |
| 3 | 3300046476 | Ga0495662_0008758 | Ga0495662_0008758_1931_2818 | 294 |
| 4 | 3300046615 | Ga0495656_0042980 | Ga0495656_0042980_953_1840 | 294 |
| 5 | iso_pu_bacteria | 2919034639 | 2919034741 | 295 |
| 6 | iso_pu_bacteria | 2932426870 | 2932427919 | 295 |
| 7 | 3300042156 | Ga0439446_0061945 | Ga0439446_0061945_212_1108 | 297 |
| 8 | 3300026075 | Ga0207708_10127660 | Ga0207708_101276601 | 299 |
| 9 | 3300045976 | Ga0466967_0558806 | Ga0466967_0558806_94_1083 | 299 |
| 10 | 3300006847 | Ga0075431_100071633 | Ga0075431_1000716333 | 308 |
| 11 | 3300025321 | Ga0207656_10023035 | Ga0207656_100230352 | 312 |
| 12 | 3300025909 | Ga0207705_10336356 | Ga0207705_103363561 | 312 |
| 13 | 3300025920 | Ga0207649_10138249 | Ga0207649_101382492 | 312 |
| 14 | 3300025926 | Ga0207659_10365314 | Ga0207659_103653141 | 312 |
| 15 | 3300025940 | Ga0207691_10022571 | Ga0207691_100225715 | 312 |
| 16 | 3300025960 | Ga0207651_10155229 | Ga0207651_101552292 | 312 |
| 17 | 3300026023 | Ga0207677_10406912 | Ga0207677_104069121 | 312 |
| 18 | 3300026089 | Ga0207648_10180258 | Ga0207648_101802581 | 312 |
| 19 | 3300027543 | Ga0209999_1009959 | Ga0209999_10099592 | 312 |
| 20 | 3300028379 | Ga0268266_10414575 | Ga0268266_104145752 | 312 |
| 21 | 3300048906 | Ga0496103_0093651 | Ga0496103_0093651_358_1317 | 317 |
| 22 | 3300006881 | Ga0068865_100118240 | Ga0068865_1001182402 | 318 |
| 23 | 3300013297 | Ga0157378_10357731 | Ga0157378_103577311 | 318 |
| 24 | 3300025986 | Ga0207658_10100983 | Ga0207658_101009831 | 318 |
| 25 | 3300026089 | Ga0207648_10026173 | Ga0207648_100261734 | 318 |
| 26 | 3300049575 | Ga0501039_0173601 | Ga0501039_0173601_378_1403 | 318 |
| 27 | 3300049741 | Ga0501079_0147202 | Ga0501079_0147202_508_1533 | 318 |
| 28 | 3300006846 | Ga0075430_100003660 | Ga0075430_1000036606 | 319 |
| 29 | 3300006847 | Ga0075431_100016781 | Ga0075431_1000167815 | 319 |
| 30 | 3300031824 | Ga0307413_10351759 | Ga0307413_103517591 | 319 |
| 31 | 3300050509 | nmdc:mga0qj67_81_c1 | nmdc:mga0qj67_81_c1_49780_50745 | 319 |
| 32 | 3300050510 | nmdc:mga06r32_32788_c1 | nmdc:mga06r32_32788_c1_3265_4230 | 319 |
| 33 | 3300006880 | Ga0075429_100188325 | Ga0075429_1001883252 | 320 |
| 34 | 3300027462 | Ga0210000_1004157 | Ga0210000_10041572 | 320 |
| 35 | 3300027695 | Ga0209966_1001147 | Ga0209966_10011474 | 320 |
| 36 | 3300042001 | Ga0439441_002320 | Ga0439441_002320_1660_2625 | 320 |
| 37 | 3300053090 | Ga0500646_0003828 | Ga0500646_0003828_1966_3015 | 320 |
| 38 | 3300053133 | Ga0500655_002776 | Ga0500655_002776_2102_3151 | 320 |
| 39 | 3300053151 | Ga0500604_0000154 | Ga0500604_0000154_3313_4362 | 320 |
| 40 | 3300049578 | Ga0501042_0255720 | Ga0501042_0255720_41_1009 | 321 |
| 41 | 3300053139 | Ga0500568_0013943 | Ga0500568_0013943_2511_3560 | 321 |
| 42 | 3300005334 | Ga0068869_100030337 | Ga0068869_1000303373 | 322 |
| 43 | 3300005336 | Ga0070680_100086548 | Ga0070680_1000865482 | 322 |
| 44 | 3300005345 | Ga0070692_10031590 | Ga0070692_100315902 | 322 |
| 45 | 3300005353 | Ga0070669_100010026 | Ga0070669_1000100263 | 322 |
| 46 | 3300005354 | Ga0070675_100014453 | Ga0070675_1000144533 | 322 |
| 47 | 3300005440 | Ga0070705_100057026 | Ga0070705_1000570262 | 322 |
| 48 | 3300005441 | Ga0070700_100215098 | Ga0070700_1002150981 | 322 |
| 49 | 3300005459 | Ga0068867_100003419 | Ga0068867_1000034199 | 322 |
| 50 | 3300005543 | Ga0070672_100207613 | Ga0070672_1002076132 | 322 |
| 51 | 3300005545 | Ga0070695_100063595 | Ga0070695_1000635953 | 322 |
| 52 | 3300005546 | Ga0070696_100075870 | Ga0070696_1000758702 | 322 |
| 53 | 3300005719 | Ga0068861_100026678 | Ga0068861_1000266782 | 322 |
| 54 | 3300005840 | Ga0068870_10031043 | Ga0068870_100310432 | 322 |
| 55 | 3300005844 | Ga0068862_100030956 | Ga0068862_1000309562 | 322 |
| 56 | 3300005844 | Ga0068862_100231531 | Ga0068862_1002315312 | 322 |
| 57 | 3300006847 | Ga0075431_100288268 | Ga0075431_1002882683 | 322 |
| 58 | 3300006881 | Ga0068865_100004941 | Ga0068865_1000049413 | 322 |
| 59 | 3300009094 | Ga0111539_10022294 | Ga0111539_100222944 | 322 |
| 60 | 3300009094 | Ga0111539_10510677 | Ga0111539_105106772 | 322 |
| 61 | 3300009147 | Ga0114129_10227481 | Ga0114129_102274813 | 322 |
| 62 | 3300009553 | Ga0105249_10135007 | Ga0105249_101350073 | 322 |
| 63 | 3300014326 | Ga0157380_10221476 | Ga0157380_102214761 | 322 |
| 64 | 3300014745 | Ga0157377_10046903 | Ga0157377_100469033 | 322 |
| 65 | 3300025917 | Ga0207660_10056874 | Ga0207660_100568742 | 322 |
| 66 | 3300025926 | Ga0207659_10008630 | Ga0207659_100086303 | 322 |
| 67 | 3300025936 | Ga0207670_10126052 | Ga0207670_101260522 | 322 |
| 68 | 3300025938 | Ga0207704_10024233 | Ga0207704_100242333 | 322 |
| 69 | 3300025940 | Ga0207691_10162699 | Ga0207691_101626992 | 322 |
| 70 | 3300025942 | Ga0207689_10011310 | Ga0207689_100113103 | 322 |
| 71 | 3300025961 | Ga0207712_10021581 | Ga0207712_100215813 | 322 |
| 72 | 3300026075 | Ga0207708_10014488 | Ga0207708_100144884 | 322 |
| 73 | 3300026089 | Ga0207648_10005404 | Ga0207648_1000540411 | 322 |
| 74 | 3300028380 | Ga0268265_10016240 | Ga0268265_100162403 | 322 |
| 75 | 3300028380 | Ga0268265_10116117 | Ga0268265_101161172 | 322 |
| 76 | 3300049577 | Ga0501041_0134693 | Ga0501041_0134693_255_1226 | 322 |
| 77 | 3300049580 | Ga0501046_0127722 | Ga0501046_0127722_876_1847 | 322 |
| 78 | 3300049587 | Ga0501071_0066885 | Ga0501071_0066885_802_1773 | 322 |
| 79 | 3300050510 | nmdc:mga06r32_553056_c1 | nmdc:mga06r32_553056_c1_62_1033 | 322 |
| 80 | 3300050511 | nmdc:mga08y16_141005_c1 | nmdc:mga08y16_141005_c1_440_1411 | 322 |
| 81 | 3300050511 | nmdc:mga08y16_463707_c1 | nmdc:mga08y16_463707_c1_286_1257 | 322 |
| 82 | 3300050511 | nmdc:mga08y16_52510_c1 | nmdc:mga08y16_52510_c1_2960_3931 | 322 |
| 83 | 3300005330 | Ga0070690_100129672 | Ga0070690_1001296722 | 325 |
| 84 | 3300005335 | Ga0070666_10083907 | Ga0070666_100839072 | 325 |
| 85 | 3300005354 | Ga0070675_100082502 | Ga0070675_1000825022 | 325 |
| 86 | 3300005444 | Ga0070694_100035196 | Ga0070694_1000351962 | 325 |
| 87 | 3300005544 | Ga0070686_100137211 | Ga0070686_1001372112 | 325 |
| 88 | 3300005548 | Ga0070665_100066943 | Ga0070665_1000669433 | 325 |
| 89 | 3300005617 | Ga0068859_100014728 | Ga0068859_1000147282 | 325 |
| 90 | 3300005841 | Ga0068863_100043668 | Ga0068863_1000436684 | 325 |
| 91 | 3300006237 | Ga0097621_100118648 | Ga0097621_1001186482 | 325 |
| 92 | 3300006358 | Ga0068871_100001140 | Ga0068871_10000114026 | 325 |
| 93 | 3300006358 | Ga0068871_100054419 | Ga0068871_1000544193 | 325 |
| 94 | 3300006881 | Ga0068865_100039257 | Ga0068865_1000392572 | 325 |
| 95 | 3300006931 | Ga0097620_100014728 | Ga0097620_1000147282 | 325 |
| 96 | 3300007265 | Ga0099794_10003315 | Ga0099794_100033153 | 325 |
| 97 | 3300007788 | Ga0099795_10009238 | Ga0099795_100092383 | 325 |
| 98 | 3300009177 | Ga0105248_10018203 | Ga0105248_100182037 | 325 |
| 99 | 3300011119 | Ga0105246_10035404 | Ga0105246_100354043 | 325 |
| 100 | 3300013308 | Ga0157375_10157846 | Ga0157375_101578461 | 325 |
| 101 | 3300014969 | Ga0157376_10028680 | Ga0157376_100286803 | 325 |
| 102 | 3300014969 | Ga0157376_10055394 | Ga0157376_100553943 | 325 |
| 103 | 3300025926 | Ga0207659_10181973 | Ga0207659_101819732 | 325 |
| 104 | 3300025935 | Ga0207709_10182491 | Ga0207709_101824912 | 325 |
| 105 | 3300025938 | Ga0207704_10090420 | Ga0207704_100904202 | 325 |
| 106 | 3300025942 | Ga0207689_10023895 | Ga0207689_100238953 | 325 |
| 107 | 3300026116 | Ga0207674_10198225 | Ga0207674_101982252 | 325 |
| 108 | 3300028379 | Ga0268266_10053509 | Ga0268266_100535092 | 325 |
| 109 | 3300035691 | Ga0373931_0032335 | Ga0373931_0032335_1224_2204 | 325 |
| 110 | 3300005440 | Ga0070705_100056581 | Ga0070705_1000565812 | 326 |
| 111 | 3300009094 | Ga0111539_10037272 | Ga0111539_100372722 | 326 |
| 112 | 3300027462 | Ga0210000_1001084 | Ga0210000_10010843 | 326 |
| 113 | 3300027543 | Ga0209999_1002676 | Ga0209999_10026763 | 326 |
| 114 | 3300027682 | Ga0209971_1005841 | Ga0209971_10058412 | 326 |
| 115 | 3300027876 | Ga0209974_10000470 | Ga0209974_100004703 | 326 |
| 116 | 3300027907 | Ga0207428_10053294 | Ga0207428_100532943 | 326 |
| 117 | 3300045051 | Ga0451576_0421390 | Ga0451576_0421390_162_1145 | 326 |
| 118 | 3300046454 | Ga0495592_0007672 | Ga0495592_0007672_3345_4328 | 326 |
| 119 | 3300046473 | Ga0495582_0165219 | Ga0495582_0165219_42_1025 | 326 |
| 120 | 3300046476 | Ga0495662_0016590 | Ga0495662_0016590_202_1185 | 326 |
| 121 | 3300046511 | Ga0495608_0001028 | Ga0495608_0001028_13928_14911 | 326 |
| 122 | 3300046514 | Ga0495618_0010655 | Ga0495618_0010655_4304_5287 | 326 |
| 123 | 3300046516 | Ga0495628_0016012 | Ga0495628_0016012_333_1316 | 326 |
| 124 | 3300046517 | Ga0495630_0012901 | Ga0495630_0012901_1035_2018 | 326 |
| 125 | 3300046526 | Ga0495666_0007432 | Ga0495666_0007432_366_1349 | 326 |
| 126 | 3300046529 | Ga0495652_0315504 | Ga0495652_0315504_48_1031 | 326 |
| 127 | 3300046533 | Ga0495640_0018063 | Ga0495640_0018063_4239_5222 | 326 |
| 128 | 3300046535 | Ga0495586_0012876 | Ga0495586_0012876_454_1437 | 326 |
| 129 | 3300046536 | Ga0495587_0031268 | Ga0495587_0031268_1150_2133 | 326 |
| 130 | 3300046543 | Ga0495645_0165059 | Ga0495645_0165059_530_1513 | 326 |
| 131 | 3300046559 | Ga0495667_0000709 | Ga0495667_0000709_12989_13972 | 326 |
| 132 | 3300046642 | Ga0495634_0002751 | Ga0495634_0002751_6235_7218 | 326 |
| 133 | 3300046683 | Ga0495658_0004885 | Ga0495658_0004885_3126_4109 | 326 |
| 134 | 3300046809 | Ga0495600_0005190 | Ga0495600_0005190_2355_3338 | 326 |
| 135 | 3300047317 | Ga0495604_0013367 | Ga0495604_0013367_5264_6247 | 326 |
| 136 | 3300047322 | Ga0495680_0013596 | Ga0495680_0013596_4563_5546 | 326 |
| 137 | 3300047471 | Ga0495684_0103336 | Ga0495684_0103336_958_1941 | 326 |
| 138 | 3300049572 | Ga0501036_0115111 | Ga0501036_0115111_366_1349 | 326 |
| 139 | 3300049575 | Ga0501039_0043879 | Ga0501039_0043879_788_1771 | 326 |
| 140 | 3300049577 | Ga0501041_0005052 | Ga0501041_0005052_2676_3659 | 326 |
| 141 | 3300049578 | Ga0501042_0091522 | Ga0501042_0091522_616_1599 | 326 |
| 142 | 3300049580 | Ga0501046_0014507 | Ga0501046_0014507_2015_2998 | 326 |
| 143 | 3300049587 | Ga0501071_0020400 | Ga0501071_0020400_3431_4414 | 326 |
| 144 | 3300049588 | Ga0501072_0000763 | Ga0501072_0000763_12291_13274 | 326 |
| 145 | 3300049590 | Ga0501074_0035810 | Ga0501074_0035810_1254_2237 | 326 |
| 146 | 3300049591 | Ga0501075_0000926 | Ga0501075_0000926_10414_11397 | 326 |
| 147 | 3300049592 | Ga0501076_0011561 | Ga0501076_0011561_1033_2016 | 326 |
| 148 | 3300049742 | Ga0501080_0038629 | Ga0501080_0038629_1550_2533 | 326 |
| 149 | 3300049743 | Ga0501081_0168534 | Ga0501081_0168534_491_1474 | 326 |
| 150 | 3300060353 | Ga0501082_0141215 | Ga0501082_0141215_439_1422 | 326 |
| 151 | 3300061734 | Ga0530510_0000542 | Ga0530510_0000542_4463_5446 | 326 |
| 152 | 3300005330 | Ga0070690_100000235 | Ga0070690_10000023523 | 327 |
| 153 | 3300005330 | Ga0070690_100059202 | Ga0070690_1000592023 | 327 |
| 154 | 3300005334 | Ga0068869_100000023 | Ga0068869_10000002353 | 327 |
| 155 | 3300031548 | Ga0307408_100402255 | Ga0307408_1004022552 | 327 |
| 156 | 3300035113 | Ga0373936_0005669 | Ga0373936_0005669_2513_3499 | 327 |
| 157 | 3300035116 | Ga0373945_0000906 | Ga0373945_0000906_4377_5363 | 327 |
| 158 | 3300035170 | Ga0373943_0169279 | Ga0373943_0169279_97_1083 | 327 |
| 159 | 3300035171 | Ga0373946_0009414 | Ga0373946_0009414_140_1126 | 327 |
| 160 | 3300035242 | Ga0373962_0019089 | Ga0373962_0019089_548_1534 | 327 |
| 161 | 3300035691 | Ga0373931_0127047 | Ga0373931_0127047_186_1172 | 327 |
| 162 | 3300035692 | Ga0373935_0012489 | Ga0373935_0012489_927_1913 | 327 |
| 163 | 3300035695 | Ga0373927_0214445 | Ga0373927_0214445_149_1135 | 327 |
| 164 | 3300046455 | Ga0495603_0040850 | Ga0495603_0040850_1758_2744 | 327 |
| 165 | 3300046472 | Ga0495580_0008453 | Ga0495580_0008453_3622_4608 | 327 |
| 166 | 3300046473 | Ga0495582_0015437 | Ga0495582_0015437_394_1380 | 327 |
| 167 | 3300046526 | Ga0495666_0031526 | Ga0495666_0031526_1579_2565 | 327 |
| 168 | 3300046531 | Ga0495665_0109617 | Ga0495665_0109617_93_1079 | 327 |
| 169 | 3300046537 | Ga0495598_0001660 | Ga0495598_0001660_1702_2688 | 327 |
| 170 | 3300046557 | Ga0495622_0089957 | Ga0495622_0089957_117_1103 | 327 |
| 171 | 3300046681 | Ga0495647_0000149 | Ga0495647_0000149_8605_9591 | 327 |
| 172 | 3300047321 | Ga0495676_0024337 | Ga0495676_0024337_439_1425 | 327 |
| 173 | 3300049575 | Ga0501039_0065971 | Ga0501039_0065971_1557_2573 | 327 |
| 174 | 3300049576 | Ga0501040_0035670 | Ga0501040_0035670_700_1716 | 327 |
| 175 | 3300049577 | Ga0501041_0056473 | Ga0501041_0056473_138_1154 | 327 |
| 176 | 3300049578 | Ga0501042_0289384 | Ga0501042_0289384_149_1165 | 327 |
| 177 | 3300049582 | Ga0501048_0135102 | Ga0501048_0135102_455_1471 | 327 |
| 178 | 3300049588 | Ga0501072_0129126 | Ga0501072_0129126_71_1087 | 327 |
| 179 | 3300049824 | Ga0501045_0059667 | Ga0501045_0059667_503_1519 | 327 |
| 180 | 3300005340 | Ga0070689_100194966 | Ga0070689_1001949661 | 328 |
| 181 | 3300005440 | Ga0070705_100136565 | Ga0070705_1001365652 | 328 |
| 182 | 3300005444 | Ga0070694_100052129 | Ga0070694_1000521292 | 328 |
| 183 | 3300005518 | Ga0070699_100047497 | Ga0070699_1000474972 | 328 |
| 184 | 3300005536 | Ga0070697_100012729 | Ga0070697_1000127292 | 328 |
| 185 | 3300005545 | Ga0070695_100002624 | Ga0070695_1000026248 | 328 |
| 186 | 3300005985 | Ga0081539_10000233 | Ga0081539_10000233117 | 328 |
| 187 | 3300006871 | Ga0075434_100028537 | Ga0075434_1000285375 | 328 |
| 188 | 3300006914 | Ga0075436_100007287 | Ga0075436_1000072873 | 328 |
| 189 | 3300006914 | Ga0075436_100014820 | Ga0075436_1000148201 | 328 |
| 190 | 3300007076 | Ga0075435_100017409 | Ga0075435_1000174093 | 328 |
| 191 | 3300009147 | Ga0114129_10121767 | Ga0114129_101217674 | 328 |
| 192 | 3300027471 | Ga0209995_1010912 | Ga0209995_10109121 | 328 |
| 193 | 3300031548 | Ga0307408_100137853 | Ga0307408_1001378531 | 328 |
| 194 | 3300032002 | Ga0307416_100014967 | Ga0307416_1000149677 | 328 |
| 195 | 3300037068 | Ga0373925_0333686 | Ga0373925_0333686_194_1183 | 328 |
| 196 | 3300041496 | Ga0451839_1137150 | Ga0451839_1137150_92_1081 | 328 |
| 197 | 3300042435 | Ga0439434_0001975 | Ga0439434_0001975_1748_2737 | 328 |
| 198 | 3300042436 | Ga0439435_0000025 | Ga0439435_0000025_6779_7768 | 328 |
| 199 | 3300046528 | Ga0495642_0045194 | Ga0495642_0045194_522_1511 | 328 |
| 200 | 3300046684 | Ga0495669_0010017 | Ga0495669_0010017_209_1198 | 328 |
| 201 | 3300050512 | nmdc:mga0n895_29098_c1 | nmdc:mga0n895_29098_c1_1556_2545 | 328 |
| 202 | 3300050513 | nmdc:mga0rr50_56901_c1 | nmdc:mga0rr50_56901_c1_558_1547 | 328 |
| 203 | 3300050514 | nmdc:mga08x19_20027_c1 | nmdc:mga08x19_20027_c1_1734_2723 | 328 |
| 204 | 3300050514 | nmdc:mga08x19_41159_c1 | nmdc:mga08x19_41159_c1_1408_2397 | 328 |
| 205 | 3300050514 | nmdc:mga08x19_62143_c1 | nmdc:mga08x19_62143_c1_720_1709 | 328 |
| 206 | 3300005353 | Ga0070669_100322688 | Ga0070669_1003226881 | 329 |
| 207 | 3300005444 | Ga0070694_100100704 | Ga0070694_1001007042 | 329 |
| 208 | 3300005471 | Ga0070698_100020071 | Ga0070698_1000200712 | 329 |
| 209 | 3300005518 | Ga0070699_100191762 | Ga0070699_1001917621 | 329 |
| 210 | 3300005545 | Ga0070695_100090910 | Ga0070695_1000909102 | 329 |
| 211 | 3300005549 | Ga0070704_100005124 | Ga0070704_1000051243 | 329 |
| 212 | 3300005577 | Ga0068857_100264011 | Ga0068857_1002640112 | 329 |
| 213 | 3300005617 | Ga0068859_100111076 | Ga0068859_1001110762 | 329 |
| 214 | 3300005842 | Ga0068858_100191946 | Ga0068858_1001919462 | 329 |
| 215 | 3300005844 | Ga0068862_100349214 | Ga0068862_1003492141 | 329 |
| 216 | 3300006844 | Ga0075428_100055956 | Ga0075428_1000559563 | 329 |
| 217 | 3300006847 | Ga0075431_100221696 | Ga0075431_1002216962 | 329 |
| 218 | 3300006880 | Ga0075429_100000107 | Ga0075429_10000010736 | 329 |
| 219 | 3300006931 | Ga0097620_100111067 | Ga0097620_1001110672 | 329 |
| 220 | 3300009147 | Ga0114129_10017740 | Ga0114129_100177404 | 329 |
| 221 | 3300009148 | Ga0105243_10115073 | Ga0105243_101150732 | 329 |
| 222 | 3300009553 | Ga0105249_10188415 | Ga0105249_101884152 | 329 |
| 223 | 3300026116 | Ga0207674_10140223 | Ga0207674_101402233 | 329 |
| 224 | 3300028380 | Ga0268265_10333094 | Ga0268265_103330942 | 329 |
| 225 | 3300035086 | Ga0373934_0000044 | Ga0373934_0000044_8541_9533 | 329 |
| 226 | 3300035118 | Ga0373954_0000020 | Ga0373954_0000020_20835_21863 | 329 |
| 227 | 3300035119 | Ga0373956_0000003 | Ga0373956_0000003_26578_27570 | 329 |
| 228 | 3300035120 | Ga0373957_0002342 | Ga0373957_0002342_3584_4576 | 329 |
| 229 | 3300035120 | Ga0373957_0036047 | Ga0373957_0036047_123_1115 | 329 |
| 230 | 3300035172 | Ga0373955_0016708 | Ga0373955_0016708_176_1168 | 329 |
| 231 | 3300035724 | Ga0373933_0000107 | Ga0373933_0000107_11808_12800 | 329 |
| 232 | 3300035724 | Ga0373933_0004387 | Ga0373933_0004387_5656_6684 | 329 |
| 233 | 3300035724 | Ga0373933_0021741 | Ga0373933_0021741_336_1328 | 329 |
| 234 | 3300036401 | Ga0373937_0000179 | Ga0373937_0000179_25029_26057 | 329 |
| 235 | 3300036401 | Ga0373937_0000196 | Ga0373937_0000196_54970_55962 | 329 |
| 236 | 3300036401 | Ga0373937_0023517 | Ga0373937_0023517_322_1314 | 329 |
| 237 | 3300045051 | Ga0451576_0036919 | Ga0451576_0036919_3320_4312 | 329 |
| 238 | 3300045051 | Ga0451576_0248265 | Ga0451576_0248265_838_1830 | 329 |
| 239 | 3300046462 | Ga0495651_0000105 | Ga0495651_0000105_30493_31485 | 329 |
| 240 | 3300046529 | Ga0495652_0209072 | Ga0495652_0209072_81_1073 | 329 |
| 241 | 3300046616 | Ga0495668_0163395 | Ga0495668_0163395_93_1085 | 329 |
| 242 | 3300046675 | Ga0495657_0056249 | Ga0495657_0056249_1156_2148 | 329 |
| 243 | 3300047322 | Ga0495680_0167984 | Ga0495680_0167984_524_1516 | 329 |
| 244 | 3300047444 | Ga0495675_0118543 | Ga0495675_0118543_574_1566 | 329 |
| 245 | 3300050507 | nmdc:mga05p37_1054_c1 | nmdc:mga05p37_1054_c1_10966_11958 | 329 |
| 246 | 3300050508 | nmdc:mga09592_100_c1 | nmdc:mga09592_100_c1_43398_44390 | 329 |
| 247 | 3300050510 | nmdc:mga06r32_292659_c1 | nmdc:mga06r32_292659_c1_132_1124 | 329 |
| 248 | iso_pu_bacteria | 2501025501 | 2501073093 | 329 |
| 249 | iso_pu_bacteria | 2501025502 | 2501081828 | 329 |
| 250 | iso_pu_bacteria | 2501025504 | 2501408150 | 329 |
| 251 | iso_pu_bacteria | 2510917013 | 2511085761 | 329 |
| 252 | iso_pu_bacteria | 2510917014 | 2511095889 | 329 |
| 253 | iso_pu_bacteria | 2510917015 | 2511103359 | 329 |
| 254 | iso_pu_bacteria | 2513237082 | 2513556202 | 329 |
| 255 | iso_pu_bacteria | 2513237083 | 2513561445 | 329 |
| 256 | iso_pu_bacteria | 2513237166 | 2514051798 | 329 |
| 257 | iso_pu_bacteria | 2515154189 | 2516020762 | 329 |
| 258 | iso_pu_bacteria | 2562617112 | 2563059491 | 329 |
| 259 | iso_pu_bacteria | 2600255067 | 2600811127 | 329 |
| 260 | iso_pu_bacteria | 2711768613 | 2713479563 | 329 |
| 261 | iso_pu_bacteria | 2791355137 | 2792834292 | 329 |
| 262 | iso_pu_bacteria | 2856287931 | 2856292062 | 329 |
| 263 | iso_pu_bacteria | 2857357740 | 2857361249 | 329 |
| 264 | iso_pu_bacteria | 2883087390 | 2883090952 | 329 |
| 265 | iso_pu_bacteria | 2904615490 | 2904620663 | 329 |
| 266 | iso_pu_bacteria | 642555112 | 642592334 | 329 |
| 267 | iso_pu_bacteria | 8003955200 | 8003957590 | 329 |
| 268 | 3300035692 | Ga0373935_0008672 | Ga0373935_0008672_278_1273 | 330 |
| 269 | 3300036401 | Ga0373937_0357400 | Ga0373937_0357400_101_1096 | 330 |
| 270 | iso_pu_bacteria | 2842775625 | 2842778160 | 330 |
| 271 | 3300005334 | Ga0068869_100019561 | Ga0068869_1000195612 | 331 |
| 272 | 3300005338 | Ga0068868_100234279 | Ga0068868_1002342792 | 331 |
| 273 | 3300005366 | Ga0070659_100106723 | Ga0070659_1001067232 | 331 |
| 274 | 3300005458 | Ga0070681_10000688 | Ga0070681_1000068824 | 331 |
| 275 | 3300005458 | Ga0070681_10016598 | Ga0070681_100165981 | 331 |
| 276 | 3300005530 | Ga0070679_100008648 | Ga0070679_1000086489 | 331 |
| 277 | 3300005545 | Ga0070695_100086681 | Ga0070695_1000866811 | 331 |
| 278 | 3300005577 | Ga0068857_100166146 | Ga0068857_1001661461 | 331 |
| 279 | 3300005617 | Ga0068859_100367817 | Ga0068859_1003678172 | 331 |
| 280 | 3300006173 | Ga0070716_100008408 | Ga0070716_1000084087 | 331 |
| 281 | 3300006871 | Ga0075434_100223841 | Ga0075434_1002238413 | 331 |
| 282 | 3300006914 | Ga0075436_100000174 | Ga0075436_10000017438 | 331 |
| 283 | 3300006914 | Ga0075436_100022801 | Ga0075436_1000228015 | 331 |
| 284 | 3300006931 | Ga0097620_100367823 | Ga0097620_1003678232 | 331 |
| 285 | 3300010159 | Ga0099796_10097427 | Ga0099796_100974271 | 331 |
| 286 | 3300010375 | Ga0105239_10418537 | Ga0105239_104185372 | 331 |
| 287 | 3300025912 | Ga0207707_10021130 | Ga0207707_100211306 | 331 |
| 288 | 3300025939 | Ga0207665_10000863 | Ga0207665_1000086316 | 331 |
| 289 | 3300026116 | Ga0207674_10255971 | Ga0207674_102559712 | 331 |
| 290 | 3300031665 | Ga0316575_10003242 | Ga0316575_100032422 | 331 |
| 291 | 3300031665 | Ga0316575_10020705 | Ga0316575_100207052 | 331 |
| 292 | 3300031691 | Ga0316579_10009712 | Ga0316579_100097122 | 331 |
| 293 | 3300031728 | Ga0316578_10019166 | Ga0316578_100191662 | 331 |
| 294 | 3300032002 | Ga0307416_100106501 | Ga0307416_1001065012 | 331 |
| 295 | 3300035086 | Ga0373934_0030676 | Ga0373934_0030676_577_1575 | 331 |
| 296 | 3300035111 | Ga0373923_0023873 | Ga0373923_0023873_471_1469 | 331 |
| 297 | 3300035113 | Ga0373936_0001037 | Ga0373936_0001037_8279_9277 | 331 |
| 298 | 3300035118 | Ga0373954_0004897 | Ga0373954_0004897_252_1250 | 331 |
| 299 | 3300035118 | Ga0373954_0055678 | Ga0373954_0055678_591_1589 | 331 |
| 300 | 3300035119 | Ga0373956_0005962 | Ga0373956_0005962_1374_2372 | 331 |
| 301 | 3300035170 | Ga0373943_0016340 | Ga0373943_0016340_787_1785 | 331 |
| 302 | 3300035171 | Ga0373946_0023271 | Ga0373946_0023271_563_1561 | 331 |
| 303 | 3300035172 | Ga0373955_0012959 | Ga0373955_0012959_2894_3892 | 331 |
| 304 | 3300035398 | Ga0316574_0018491 | Ga0316574_0018491_2162_3160 | 331 |
| 305 | 3300035410 | Ga0373924_0019331 | Ga0373924_0019331_266_1264 | 331 |
| 306 | 3300035692 | Ga0373935_0014087 | Ga0373935_0014087_2907_3905 | 331 |
| 307 | 3300035695 | Ga0373927_0025420 | Ga0373927_0025420_672_1670 | 331 |
| 308 | 3300035724 | Ga0373933_0084844 | Ga0373933_0084844_614_1612 | 331 |
| 309 | 3300035725 | Ga0373947_0090163 | Ga0373947_0090163_574_1572 | 331 |
| 310 | 3300036401 | Ga0373937_0127941 | Ga0373937_0127941_649_1647 | 331 |
| 311 | 3300036401 | Ga0373937_0270218 | Ga0373937_0270218_272_1270 | 331 |
| 312 | 3300046454 | Ga0495592_0022957 | Ga0495592_0022957_2808_3806 | 331 |
| 313 | 3300046459 | Ga0495629_0071962 | Ga0495629_0071962_780_1778 | 331 |
| 314 | 3300046461 | Ga0495641_0011338 | Ga0495641_0011338_147_1145 | 331 |
| 315 | 3300046463 | Ga0495653_0016485 | Ga0495653_0016485_2105_3103 | 331 |
| 316 | 3300046472 | Ga0495580_0022721 | Ga0495580_0022721_702_1700 | 331 |
| 317 | 3300046475 | Ga0495639_0011536 | Ga0495639_0011536_2796_3794 | 331 |
| 318 | 3300046514 | Ga0495618_0057962 | Ga0495618_0057962_472_1470 | 331 |
| 319 | 3300046516 | Ga0495628_0004763 | Ga0495628_0004763_8067_9065 | 331 |
| 320 | 3300046516 | Ga0495628_0015546 | Ga0495628_0015546_878_1876 | 331 |
| 321 | 3300046516 | Ga0495628_0188951 | Ga0495628_0188951_62_1060 | 331 |
| 322 | 3300046517 | Ga0495630_0001187 | Ga0495630_0001187_14125_15123 | 331 |
| 323 | 3300046517 | Ga0495630_0129733 | Ga0495630_0129733_556_1554 | 331 |
| 324 | 3300046526 | Ga0495666_0046395 | Ga0495666_0046395_116_1114 | 331 |
| 325 | 3300046529 | Ga0495652_0003931 | Ga0495652_0003931_613_1611 | 331 |
| 326 | 3300046531 | Ga0495665_0023190 | Ga0495665_0023190_668_1666 | 331 |
| 327 | 3300046533 | Ga0495640_0039390 | Ga0495640_0039390_654_1652 | 331 |
| 328 | 3300046535 | Ga0495586_0144227 | Ga0495586_0144227_272_1270 | 331 |
| 329 | 3300046536 | Ga0495587_0149903 | Ga0495587_0149903_293_1291 | 331 |
| 330 | 3300046543 | Ga0495645_0002326 | Ga0495645_0002326_11221_12219 | 331 |
| 331 | 3300046678 | Ga0495599_0017778 | Ga0495599_0017778_2289_3287 | 331 |
| 332 | 3300046678 | Ga0495599_0035454 | Ga0495599_0035454_147_1145 | 331 |
| 333 | 3300047317 | Ga0495604_0104703 | Ga0495604_0104703_803_1801 | 331 |
| 334 | 3300047322 | Ga0495680_0014849 | Ga0495680_0014849_2912_3910 | 331 |
| 335 | 3300047322 | Ga0495680_0091382 | Ga0495680_0091382_1157_2155 | 331 |
| 336 | 3300047444 | Ga0495675_0028377 | Ga0495675_0028377_1602_2600 | 331 |
| 337 | 3300047471 | Ga0495684_0101956 | Ga0495684_0101956_900_1898 | 331 |
| 338 | 3300048089 | Ga0495614_0102793 | Ga0495614_0102793_10_1008 | 331 |
| 339 | 3300049572 | Ga0501036_0023727 | Ga0501036_0023727_1091_2092 | 331 |
| 340 | 3300049574 | Ga0501038_0075226 | Ga0501038_0075226_1365_2366 | 331 |
| 341 | 3300049575 | Ga0501039_0009714 | Ga0501039_0009714_1928_2929 | 331 |
| 342 | 3300049577 | Ga0501041_0002164 | Ga0501041_0002164_8387_9388 | 331 |
| 343 | 3300049578 | Ga0501042_0014362 | Ga0501042_0014362_2371_3372 | 331 |
| 344 | 3300049580 | Ga0501046_0036810 | Ga0501046_0036810_1800_2801 | 331 |
| 345 | 3300049582 | Ga0501048_0006221 | Ga0501048_0006221_1028_2029 | 331 |
| 346 | 3300049584 | Ga0501068_0104779 | Ga0501068_0104779_249_1250 | 331 |
| 347 | 3300049587 | Ga0501071_0056794 | Ga0501071_0056794_1534_2535 | 331 |
| 348 | 3300049589 | Ga0501073_0058294 | Ga0501073_0058294_72_1073 | 331 |
| 349 | 3300049590 | Ga0501074_0073533 | Ga0501074_0073533_139_1143 | 331 |
| 350 | 3300049592 | Ga0501076_0003118 | Ga0501076_0003118_2598_3599 | 331 |
| 351 | 3300049592 | Ga0501076_0031041 | Ga0501076_0031041_1750_2754 | 331 |
| 352 | 3300049593 | Ga0501077_0035197 | Ga0501077_0035197_363_1367 | 331 |
| 353 | 3300049741 | Ga0501079_0000812 | Ga0501079_0000812_674_1675 | 331 |
| 354 | 3300049742 | Ga0501080_0062544 | Ga0501080_0062544_789_1790 | 331 |
| 355 | 3300049743 | Ga0501081_0020876 | Ga0501081_0020876_470_1471 | 331 |
| 356 | 3300049824 | Ga0501045_0000399 | Ga0501045_0000399_16216_17217 | 331 |
| 357 | 3300050512 | nmdc:mga0n895_303871_c1 | nmdc:mga0n895_303871_c1_182_1180 | 331 |
| 358 | 3300050514 | nmdc:mga08x19_20825_c1 | nmdc:mga08x19_20825_c1_769_1767 | 331 |
| 359 | 3300053077 | Ga0495601_0000321 | Ga0495601_0000321_10985_11983 | 331 |
| 360 | 3300053084 | Ga0495595_0036022 | Ga0495595_0036022_357_1355 | 331 |
| 361 | 3300054114 | Ga0501084_0007233 | Ga0501084_0007233_1625_2626 | 331 |
| 362 | 3300060353 | Ga0501082_0008788 | Ga0501082_0008788_6404_7405 | 331 |
| 363 | 3300061734 | Ga0530510_0000661 | Ga0530510_0000661_12975_13976 | 331 |
| 364 | 3300005329 | Ga0070683_100331926 | Ga0070683_1003319261 | 332 |
| 365 | 3300005331 | Ga0070670_100084019 | Ga0070670_1000840192 | 332 |
| 366 | 3300005331 | Ga0070670_100137031 | Ga0070670_1001370312 | 332 |
| 367 | 3300005338 | Ga0068868_100006228 | Ga0068868_1000062284 | 332 |
| 368 | 3300005344 | Ga0070661_100042312 | Ga0070661_1000423123 | 332 |
| 369 | 3300005354 | Ga0070675_100039701 | Ga0070675_1000397014 | 332 |
| 370 | 3300005355 | Ga0070671_100030089 | Ga0070671_1000300894 | 332 |
| 371 | 3300005459 | Ga0068867_100075236 | Ga0068867_1000752361 | 332 |
| 372 | 3300005530 | Ga0070679_100078972 | Ga0070679_1000789722 | 332 |
| 373 | 3300005539 | Ga0068853_100025143 | Ga0068853_1000251432 | 332 |
| 374 | 3300005548 | Ga0070665_100361293 | Ga0070665_1003612932 | 332 |
| 375 | 3300005549 | Ga0070704_100116830 | Ga0070704_1001168302 | 332 |
| 376 | 3300005563 | Ga0068855_100085723 | Ga0068855_1000857233 | 332 |
| 377 | 3300005577 | Ga0068857_100330929 | Ga0068857_1003309292 | 332 |
| 378 | 3300005578 | Ga0068854_100165149 | Ga0068854_1001651492 | 332 |
| 379 | 3300005617 | Ga0068859_100049658 | Ga0068859_1000496583 | 332 |
| 380 | 3300005618 | Ga0068864_100012457 | Ga0068864_1000124573 | 332 |
| 381 | 3300005834 | Ga0068851_10033819 | Ga0068851_100338192 | 332 |
| 382 | 3300005842 | Ga0068858_100090779 | Ga0068858_1000907791 | 332 |
| 383 | 3300006237 | Ga0097621_100082294 | Ga0097621_1000822943 | 332 |
| 384 | 3300006237 | Ga0097621_100173833 | Ga0097621_1001738332 | 332 |
| 385 | 3300006844 | Ga0075428_100329193 | Ga0075428_1003291932 | 332 |
| 386 | 3300006931 | Ga0097620_100049654 | Ga0097620_1000496545 | 332 |
| 387 | 3300009148 | Ga0105243_10190844 | Ga0105243_101908442 | 332 |
| 388 | 3300009174 | Ga0105241_10003849 | Ga0105241_100038493 | 332 |
| 389 | 3300009545 | Ga0105237_10310694 | Ga0105237_103106942 | 332 |
| 390 | 3300010375 | Ga0105239_10034652 | Ga0105239_100346524 | 332 |
| 391 | 3300013306 | Ga0163162_10031995 | Ga0163162_100319955 | 332 |
| 392 | 3300013306 | Ga0163162_10107754 | Ga0163162_101077545 | 332 |
| 393 | 3300013308 | Ga0157375_10019124 | Ga0157375_100191243 | 332 |
| 394 | 3300013308 | Ga0157375_10137543 | Ga0157375_101375432 | 332 |
| 395 | 3300014969 | Ga0157376_10040781 | Ga0157376_100407812 | 332 |
| 396 | 3300017792 | Ga0163161_10121651 | Ga0163161_101216512 | 332 |
| 397 | 3300025899 | Ga0207642_10035862 | Ga0207642_100358621 | 332 |
| 398 | 3300025911 | Ga0207654_10027853 | Ga0207654_100278533 | 332 |
| 399 | 3300025914 | Ga0207671_10205945 | Ga0207671_102059452 | 332 |
| 400 | 3300025923 | Ga0207681_10017627 | Ga0207681_100176273 | 332 |
| 401 | 3300025925 | Ga0207650_10020629 | Ga0207650_100206291 | 332 |
| 402 | 3300025925 | Ga0207650_10144682 | Ga0207650_101446822 | 332 |
| 403 | 3300025933 | Ga0207706_10007023 | Ga0207706_100070236 | 332 |
| 404 | 3300025936 | Ga0207670_10272853 | Ga0207670_102728531 | 332 |
| 405 | 3300025940 | Ga0207691_10263422 | Ga0207691_102634222 | 332 |
| 406 | 3300025942 | Ga0207689_10137006 | Ga0207689_101370061 | 332 |
| 407 | 3300025945 | Ga0207679_10148378 | Ga0207679_101483782 | 332 |
| 408 | 3300025949 | Ga0207667_10093541 | Ga0207667_100935412 | 332 |
| 409 | 3300025960 | Ga0207651_10132394 | Ga0207651_101323942 | 332 |
| 410 | 3300026035 | Ga0207703_10084380 | Ga0207703_100843803 | 332 |
| 411 | 3300026041 | Ga0207639_10017759 | Ga0207639_100177593 | 332 |
| 412 | 3300026089 | Ga0207648_10079866 | Ga0207648_100798665 | 332 |
| 413 | 3300026116 | Ga0207674_10080555 | Ga0207674_100805552 | 332 |
| 414 | 3300026116 | Ga0207674_10253358 | Ga0207674_102533582 | 332 |
| 415 | 3300026118 | Ga0207675_100043011 | Ga0207675_1000430112 | 332 |
| 416 | 3300026121 | Ga0207683_10018182 | Ga0207683_100181822 | 332 |
| 417 | 3300026142 | Ga0207698_10373842 | Ga0207698_103738422 | 332 |
| 418 | 3300028379 | Ga0268266_10315200 | Ga0268266_103152002 | 332 |
| 419 | 3300028381 | Ga0268264_10147790 | Ga0268264_101477902 | 332 |
| 420 | 3300031239 | Ga0265328_10022541 | Ga0265328_100225412 | 332 |
| 421 | 3300031242 | Ga0265329_10012019 | Ga0265329_100120193 | 332 |
| 422 | 3300031249 | Ga0265339_10163541 | Ga0265339_101635411 | 332 |
| 423 | 3300031250 | Ga0265331_10003333 | Ga0265331_1000333310 | 332 |
| 424 | 3300031344 | Ga0265316_10012711 | Ga0265316_100127112 | 332 |
| 425 | 3300031711 | Ga0265314_10026186 | Ga0265314_100261864 | 332 |
| 426 | 3300042122 | Ga0450920_004910 | Ga0450920_004910_86_1087 | 332 |
| 427 | 3300048913 | Ga0496110_0065985 | Ga0496110_0065985_629_1651 | 332 |
| 428 | 3300049571 | Ga0501034_0000235 | Ga0501034_0000235_50772_51776 | 332 |
| 429 | 3300049571 | Ga0501034_0034677 | Ga0501034_0034677_1465_2481 | 332 |
| 430 | 3300049572 | Ga0501036_0098655 | Ga0501036_0098655_756_1802 | 332 |
| 431 | 3300049573 | Ga0501037_0008126 | Ga0501037_0008126_5960_7006 | 332 |
| 432 | 3300049575 | Ga0501039_0004640 | Ga0501039_0004640_338_1384 | 332 |
| 433 | 3300049576 | Ga0501040_0040558 | Ga0501040_0040558_1999_3045 | 332 |
| 434 | 3300049576 | Ga0501040_0044985 | Ga0501040_0044985_405_1406 | 332 |
| 435 | 3300049577 | Ga0501041_0001754 | Ga0501041_0001754_8487_9533 | 332 |
| 436 | 3300049577 | Ga0501041_0123401 | Ga0501041_0123401_577_1578 | 332 |
| 437 | 3300049578 | Ga0501042_0034026 | Ga0501042_0034026_1303_2349 | 332 |
| 438 | 3300049584 | Ga0501068_0000232 | Ga0501068_0000232_4598_5611 | 332 |
| 439 | 3300049587 | Ga0501071_0010642 | Ga0501071_0010642_3312_4313 | 332 |
| 440 | 3300049587 | Ga0501071_0055954 | Ga0501071_0055954_1453_2499 | 332 |
| 441 | 3300049588 | Ga0501072_0001017 | Ga0501072_0001017_1860_2864 | 332 |
| 442 | 3300049588 | Ga0501072_0112707 | Ga0501072_0112707_669_1670 | 332 |
| 443 | 3300049588 | Ga0501072_0115148 | Ga0501072_0115148_833_1879 | 332 |
| 444 | 3300049589 | Ga0501073_0000752 | Ga0501073_0000752_20459_21472 | 332 |
| 445 | 3300049590 | Ga0501074_0143724 | Ga0501074_0143724_604_1605 | 332 |
| 446 | 3300049591 | Ga0501075_0004661 | Ga0501075_0004661_7894_8940 | 332 |
| 447 | 3300049591 | Ga0501075_0059159 | Ga0501075_0059159_1507_2508 | 332 |
| 448 | 3300049592 | Ga0501076_0000948 | Ga0501076_0000948_14247_15293 | 332 |
| 449 | 3300049741 | Ga0501079_0000752 | Ga0501079_0000752_18908_19954 | 332 |
| 450 | 3300049742 | Ga0501080_0000996 | Ga0501080_0000996_20459_21472 | 332 |
| 451 | 3300049742 | Ga0501080_0052445 | Ga0501080_0052445_2219_3220 | 332 |
| 452 | 3300049742 | Ga0501080_0159439 | Ga0501080_0159439_713_1717 | 332 |
| 453 | 3300049743 | Ga0501081_0000928 | Ga0501081_0000928_6926_7972 | 332 |
| 454 | 3300049822 | Ga0501035_0046680 | Ga0501035_0046680_18_1064 | 332 |
| 455 | 3300049824 | Ga0501045_0008896 | Ga0501045_0008896_784_1830 | 332 |
| 456 | 3300054114 | Ga0501084_0158523 | Ga0501084_0158523_86_1099 | 332 |
| 457 | 3300060353 | Ga0501082_0005827 | Ga0501082_0005827_1173_2219 | 332 |
| 458 | 3300060353 | Ga0501082_0355212 | Ga0501082_0355212_52_1065 | 332 |
| 459 | 3300003322 | rootL2_10089033 | rootL2_100890332 | 333 |
| 460 | 3300003354 | JGI25160J50197_1000279 | JGI25160J50197_100027913 | 333 |
| 461 | 3300005335 | Ga0070666_10053867 | Ga0070666_100538672 | 333 |
| 462 | 3300005367 | Ga0070667_100019707 | Ga0070667_1000197072 | 333 |
| 463 | 3300005455 | Ga0070663_100003243 | Ga0070663_1000032433 | 333 |
| 464 | 3300006195 | Ga0075366_10037538 | Ga0075366_100375383 | 333 |
| 465 | 3300006846 | Ga0075430_100005239 | Ga0075430_1000052396 | 333 |
| 466 | 3300006847 | Ga0075431_100046537 | Ga0075431_1000465373 | 333 |
| 467 | 3300009011 | Ga0105251_10001210 | Ga0105251_100012102 | 333 |
| 468 | 3300009177 | Ga0105248_10037595 | Ga0105248_100375954 | 333 |
| 469 | 3300013105 | Ga0157369_10270331 | Ga0157369_102703311 | 333 |
| 470 | 3300013306 | Ga0163162_10000679 | Ga0163162_100006793 | 333 |
| 471 | 3300013308 | Ga0157375_10034066 | Ga0157375_100340663 | 333 |
| 472 | 3300016635 | Ga0183361_10009 | Ga0183361_10009116 | 333 |
| 473 | 3300025302 | Ga0207426_1006086 | Ga0207426_10060863 | 333 |
| 474 | 3300025735 | Ga0207713_1003216 | Ga0207713_10032168 | 333 |
| 475 | 3300025903 | Ga0207680_10039106 | Ga0207680_100391062 | 333 |
| 476 | 3300025904 | Ga0207647_10063243 | Ga0207647_100632433 | 333 |
| 477 | 3300026067 | Ga0207678_10007848 | Ga0207678_100078483 | 333 |
| 478 | 3300028800 | Ga0265338_10001217 | Ga0265338_1000121721 | 333 |
| 479 | 3300030521 | Ga0307511_10000108 | Ga0307511_1000010818 | 333 |
| 480 | 3300031251 | Ga0265327_10014887 | Ga0265327_100148874 | 333 |
| 481 | 3300033179 | Ga0307507_10038968 | Ga0307507_100389684 | 333 |
| 482 | 3300039438 | Ga0436360_0400716 | Ga0436360_0400716_23_1027 | 333 |
| 483 | 3300042001 | Ga0439441_001631 | Ga0439441_001631_563_1633 | 333 |
| 484 | 3300042876 | Ga0451577_0205479 | Ga0451577_0205479_426_1430 | 333 |
| 485 | 3300044765 | Ga0466970_0102432 | Ga0466970_0102432_476_1483 | 333 |
| 486 | 3300046455 | Ga0495603_0033367 | Ga0495603_0033367_810_1814 | 333 |
| 487 | 3300046457 | Ga0495590_0000630 | Ga0495590_0000630_911_1912 | 333 |
| 488 | 3300046457 | Ga0495590_0022510 | Ga0495590_0022510_99_1109 | 333 |
| 489 | 3300046459 | Ga0495629_0172360 | Ga0495629_0172360_357_1358 | 333 |
| 490 | 3300046474 | Ga0495605_0021878 | Ga0495605_0021878_1298_2305 | 333 |
| 491 | 3300046507 | Ga0495606_0063944 | Ga0495606_0063944_369_1370 | 333 |
| 492 | 3300046507 | Ga0495606_0086766 | Ga0495606_0086766_314_1321 | 333 |
| 493 | 3300046515 | Ga0495620_0018493 | Ga0495620_0018493_2169_3170 | 333 |
| 494 | 3300046516 | Ga0495628_0072664 | Ga0495628_0072664_526_1527 | 333 |
| 495 | 3300046528 | Ga0495642_0010968 | Ga0495642_0010968_1590_2597 | 333 |
| 496 | 3300046529 | Ga0495652_0071319 | Ga0495652_0071319_1046_2047 | 333 |
| 497 | 3300046531 | Ga0495665_0014916 | Ga0495665_0014916_3012_4013 | 333 |
| 498 | 3300046542 | Ga0495597_0007513 | Ga0495597_0007513_1067_2068 | 333 |
| 499 | 3300046543 | Ga0495645_0163772 | Ga0495645_0163772_459_1460 | 333 |
| 500 | 3300046679 | Ga0495623_0024279 | Ga0495623_0024279_2237_3238 | 333 |
| 501 | 3300046684 | Ga0495669_0015535 | Ga0495669_0015535_1159_2166 | 333 |
| 502 | 3300046691 | Ga0495670_0007900 | Ga0495670_0007900_1288_2295 | 333 |
| 503 | 3300046694 | Ga0495649_0021009 | Ga0495649_0021009_1754_2755 | 333 |
| 504 | 3300046794 | Ga0495589_0017714 | Ga0495589_0017714_2014_3021 | 333 |
| 505 | 3300046794 | Ga0495589_0094820 | Ga0495589_0094820_160_1161 | 333 |
| 506 | 3300047322 | Ga0495680_0078630 | Ga0495680_0078630_454_1455 | 333 |
| 507 | 3300047323 | Ga0495683_0001407 | Ga0495683_0001407_11088_12089 | 333 |
| 508 | 3300047323 | Ga0495683_0079052 | Ga0495683_0079052_220_1227 | 333 |
| 509 | 3300047443 | Ga0495687_000169 | Ga0495687_000169_62321_63328 | 333 |
| 510 | 3300047673 | Ga0495593_0115617 | Ga0495593_0115617_19_1020 | 333 |
| 511 | 3300048088 | Ga0495602_0016723 | Ga0495602_0016723_4784_5785 | 333 |
| 512 | 3300048903 | Ga0496100_0043465 | Ga0496100_0043465_591_1592 | 333 |
| 513 | 3300048903 | Ga0496100_0101744 | Ga0496100_0101744_735_1742 | 333 |
| 514 | 3300048904 | Ga0496101_0014626 | Ga0496101_0014626_3094_4095 | 333 |
| 515 | 3300048904 | Ga0496101_0024961 | Ga0496101_0024961_2660_3667 | 333 |
| 516 | 3300048905 | Ga0496102_0001320 | Ga0496102_0001320_592_1593 | 333 |
| 517 | 3300048905 | Ga0496102_0021149 | Ga0496102_0021149_4137_5144 | 333 |
| 518 | 3300048906 | Ga0496103_0007295 | Ga0496103_0007295_930_1931 | 333 |
| 519 | 3300048909 | Ga0496106_0017418 | Ga0496106_0017418_3475_4476 | 333 |
| 520 | 3300048909 | Ga0496106_0057379 | Ga0496106_0057379_884_1891 | 333 |
| 521 | 3300048910 | Ga0496107_0010544 | Ga0496107_0010544_2080_3081 | 333 |
| 522 | 3300048914 | Ga0496111_0023860 | Ga0496111_0023860_457_1458 | 333 |
| 523 | 3300048916 | Ga0496113_0017346 | Ga0496113_0017346_1077_2078 | 333 |
| 524 | 3300048918 | Ga0496115_0339750 | Ga0496115_0339750_171_1172 | 333 |
| 525 | 3300048919 | Ga0496116_0025650 | Ga0496116_0025650_3254_4255 | 333 |
| 526 | 3300048922 | Ga0496119_0078263 | Ga0496119_0078263_449_1450 | 333 |
| 527 | 3300048925 | Ga0496122_0007506 | Ga0496122_0007506_3998_4999 | 333 |
| 528 | 3300048926 | Ga0496123_0057060 | Ga0496123_0057060_1105_2106 | 333 |
| 529 | 3300048927 | Ga0496124_0016661 | Ga0496124_0016661_3781_4782 | 333 |
| 530 | 3300048927 | Ga0496124_0126888 | Ga0496124_0126888_71_1072 | 333 |
| 531 | 3300048928 | Ga0496125_0009210 | Ga0496125_0009210_5583_6584 | 333 |
| 532 | 3300048929 | Ga0496126_0006916 | Ga0496126_0006916_10718_11719 | 333 |
| 533 | 3300049571 | Ga0501034_0005666 | Ga0501034_0005666_1094_2101 | 333 |
| 534 | 3300050493 | nmdc:mga0k408_9059_c1 | nmdc:mga0k408_9059_c1_3891_4943 | 333 |
| 535 | 3300050509 | nmdc:mga0qj67_9124_c1 | nmdc:mga0qj67_9124_c1_1436_2440 | 333 |
| 536 | 3300050510 | nmdc:mga06r32_17414_c1 | nmdc:mga06r32_17414_c1_2906_3910 | 333 |
| 537 | 3300053118 | Ga0500594_0023518 | Ga0500594_0023518_446_1492 | 333 |
| 538 | 3300013297 | Ga0157378_10059116 | Ga0157378_100591162 | 334 |
| 539 | 3300035691 | Ga0373931_0129370 | Ga0373931_0129370_246_1271 | 334 |
| 540 | 3300042876 | Ga0451577_0365537 | Ga0451577_0365537_134_1144 | 334 |
| 541 | 3300044712 | Ga0453684_0272373 | Ga0453684_0272373_569_1579 | 334 |
| 542 | 3300049593 | Ga0501077_0016328 | Ga0501077_0016328_2020_3027 | 334 |
| 543 | 3300049743 | Ga0501081_0105433 | Ga0501081_0105433_616_1623 | 334 |
| 544 | 3300005328 | Ga0070676_10124668 | Ga0070676_101246682 | 335 |
| 545 | 3300005330 | Ga0070690_100009422 | Ga0070690_1000094224 | 335 |
| 546 | 3300005334 | Ga0068869_100002090 | Ga0068869_1000020902 | 335 |
| 547 | 3300005340 | Ga0070689_100087696 | Ga0070689_1000876962 | 335 |
| 548 | 3300005341 | Ga0070691_10015276 | Ga0070691_100152763 | 335 |
| 549 | 3300005438 | Ga0070701_10043994 | Ga0070701_100439942 | 335 |
| 550 | 3300005441 | Ga0070700_100003807 | Ga0070700_1000038072 | 335 |
| 551 | 3300005444 | Ga0070694_100081891 | Ga0070694_1000818912 | 335 |
| 552 | 3300005459 | Ga0068867_100041406 | Ga0068867_1000414063 | 335 |
| 553 | 3300005546 | Ga0070696_100010019 | Ga0070696_1000100196 | 335 |
| 554 | 3300005547 | Ga0070693_100031745 | Ga0070693_1000317452 | 335 |
| 555 | 3300005615 | Ga0070702_100030421 | Ga0070702_1000304213 | 335 |
| 556 | 3300005617 | Ga0068859_100061028 | Ga0068859_1000610283 | 335 |
| 557 | 3300005617 | Ga0068859_100147708 | Ga0068859_1001477082 | 335 |
| 558 | 3300005718 | Ga0068866_10003557 | Ga0068866_100035572 | 335 |
| 559 | 3300005719 | Ga0068861_100009150 | Ga0068861_1000091502 | 335 |
| 560 | 3300005840 | Ga0068870_10095534 | Ga0068870_100955342 | 335 |
| 561 | 3300005841 | Ga0068863_100006757 | Ga0068863_10000675710 | 335 |
| 562 | 3300005842 | Ga0068858_100037353 | Ga0068858_1000373533 | 335 |
| 563 | 3300005843 | Ga0068860_100064634 | Ga0068860_1000646342 | 335 |
| 564 | 3300005844 | Ga0068862_100069128 | Ga0068862_1000691282 | 335 |
| 565 | 3300006237 | Ga0097621_100040818 | Ga0097621_1000408182 | 335 |
| 566 | 3300006358 | Ga0068871_100019043 | Ga0068871_1000190434 | 335 |
| 567 | 3300006844 | Ga0075428_100023506 | Ga0075428_1000235062 | 335 |
| 568 | 3300006846 | Ga0075430_100023708 | Ga0075430_1000237089 | 335 |
| 569 | 3300006881 | Ga0068865_100009129 | Ga0068865_1000091293 | 335 |
| 570 | 3300006931 | Ga0097620_100061031 | Ga0097620_1000610312 | 335 |
| 571 | 3300006931 | Ga0097620_100147712 | Ga0097620_1001477122 | 335 |
| 572 | 3300009094 | Ga0111539_10005851 | Ga0111539_100058512 | 335 |
| 573 | 3300009098 | Ga0105245_10140163 | Ga0105245_101401632 | 335 |
| 574 | 3300009176 | Ga0105242_10015533 | Ga0105242_100155333 | 335 |
| 575 | 3300009545 | Ga0105237_10022420 | Ga0105237_100224206 | 335 |
| 576 | 3300009553 | Ga0105249_10339772 | Ga0105249_103397722 | 335 |
| 577 | 3300013297 | Ga0157378_10009009 | Ga0157378_100090096 | 335 |
| 578 | 3300014326 | Ga0157380_10008501 | Ga0157380_100085016 | 335 |
| 579 | 3300014968 | Ga0157379_10232100 | Ga0157379_102321002 | 335 |
| 580 | 3300025899 | Ga0207642_10017270 | Ga0207642_100172702 | 335 |
| 581 | 3300025925 | Ga0207650_10001780 | Ga0207650_1000178012 | 335 |
| 582 | 3300025926 | Ga0207659_10004000 | Ga0207659_100040005 | 335 |
| 583 | 3300025927 | Ga0207687_10030877 | Ga0207687_100308772 | 335 |
| 584 | 3300025934 | Ga0207686_10035164 | Ga0207686_100351643 | 335 |
| 585 | 3300025935 | Ga0207709_10008967 | Ga0207709_100089672 | 335 |
| 586 | 3300025936 | Ga0207670_10107510 | Ga0207670_101075102 | 335 |
| 587 | 3300025938 | Ga0207704_10007294 | Ga0207704_100072942 | 335 |
| 588 | 3300025942 | Ga0207689_10001838 | Ga0207689_1000183816 | 335 |
| 589 | 3300026041 | Ga0207639_10022045 | Ga0207639_100220453 | 335 |
| 590 | 3300026075 | Ga0207708_10001796 | Ga0207708_1000179614 | 335 |
| 591 | 3300026075 | Ga0207708_10014335 | Ga0207708_100143352 | 335 |
| 592 | 3300026088 | Ga0207641_10024724 | Ga0207641_100247243 | 335 |
| 593 | 3300026089 | Ga0207648_10002392 | Ga0207648_1000239217 | 335 |
| 594 | 3300026095 | Ga0207676_10003104 | Ga0207676_1000310411 | 335 |
| 595 | 3300026118 | Ga0207675_100012953 | Ga0207675_1000129536 | 335 |
| 596 | 3300026121 | Ga0207683_10019442 | Ga0207683_100194423 | 335 |
| 597 | 3300027907 | Ga0207428_10002806 | Ga0207428_1000280614 | 335 |
| 598 | 3300049571 | Ga0501034_0128677 | Ga0501034_0128677_253_1272 | 335 |
| 599 | 3300050509 | nmdc:mga0qj67_15521_c1 | nmdc:mga0qj67_15521_c1_964_2025 | 335 |
| 600 | 3300050511 | nmdc:mga08y16_2754_c1 | nmdc:mga08y16_2754_c1_3193_4227 | 335 |
| 601 | 3300041404 | Ga0439436_0006031 | Ga0439436_0006031_1432_2454 | 336 |
| 602 | 3300005364 | Ga0070673_100330176 | Ga0070673_1003301762 | 337 |
| 603 | 3300003187 | JGI25151J46595_10002509 | JGI25151J46595_100025097 | 339 |
| 604 | 3300003771 | Ga0055526_1008754 | Ga0055526_10087544 | 339 |
| 605 | 3300006948 | Ga0099826_10000018 | Ga0099826_1000001884 | 339 |
| 606 | 3300025284 | Ga0209130_1006067 | Ga0209130_10060671 | 339 |
| 607 | 3300025291 | Ga0209675_1000100 | Ga0209675_100010099 | 339 |
| 608 | 3300025292 | Ga0209676_1000012 | Ga0209676_1000012757 | 339 |
| 609 | 3300025294 | Ga0209025_1001877 | Ga0209025_100187716 | 339 |
| 610 | 3300025294 | Ga0209025_1032186 | Ga0209025_10321862 | 339 |
| 611 | 3300025295 | Ga0209564_1002674 | Ga0209564_10026745 | 339 |
| 612 | 3300025295 | Ga0209564_1002716 | Ga0209564_10027167 | 339 |
| 613 | 3300044656 | Ga0466969_0025156 | Ga0466969_0025156_1064_2095 | 339 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4us5-assembly2.cif.gz_C | crystal structure of apo-msno8 | 0.9311 | 8 | 337 |
| 4us5-assembly2.cif.gz_D | crystal structure of apo-msno8 | 0.9304 | 7 | 337 |
| 4us5-assembly1.cif.gz_A | crystal structure of apo-msno8 | 0.9301 | 8 | 337 |
| 4us5-assembly2.cif.gz_C | crystal structure of apo-msno8 | 0.9175 | 8 | 337 |
| 4us5-assembly1.cif.gz_A | crystal structure of apo-msno8 | 0.9165 | 8 | 337 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0ADV5_3_330_3.20.20.30 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.9393 | 8 | 334 | 3.20.20.30 |
| af_Q2G151_1_332_3.20.20.30 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.9256 | 8 | 335 | 3.20.20.30 |
| af_P0ADV5_3_330_3.20.20.30 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.9255 | 8 | 334 | 3.20.20.30 |
| 4us5A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.9133 | 8 | 337 | 3.20.20.30 |
| af_Q2G151_1_332_3.20.20.30 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.912 | 8 | 335 | 3.20.20.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4U1HNQ0-F1-model_v4 | LLM class flavin-dependent oxidoreductase | 0.9969 | 8 | 337 |
GO:0005829
GO:0016705 |
| AF-A0A0S8B8R0-F1-model_v4 | Luciferase | 0.9875 | 8 | 268 |
GO:0005829
GO:0016705 |
| AF-X8CPQ9-F1-model_v4 | Luciferase oxidoreductase, group 1 family protein (EC 1.-.-.-) | 0.9835 | 8 | 119 |
GO:0016705
GO:0071949 |
| AF-A0A2N5XJM8-F1-model_v4 | Alkanal monooxygenase | 0.9823 | 8 | 119 |
GO:0004497
GO:0005829 GO:0016705 |
| AF-A0A250JW90-F1-model_v4 | Luciferase | 0.9795 | 8 | 337 |
GO:0005829
GO:0016705 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar