F469262

General Info

Members Datasets Scaffolds Average Seq Length
613 243 613 101

Family's Representative Sequence

Representative Sequence 3300025916|Ga0207663_10340818|Ga0207663_103408182
Length 109
Sequence MSPSTVNSVFRRRRFTDLISRQLDLFEREHADVIVEAQERLDAYNRAERDEAEELYGDYVDAVETGTEILADLRDHYAASVEDADAYCAEFNRTVARRLPPFALEIENR

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
46 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
67 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
68 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
74 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
114 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
115 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
116 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
117 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
118 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
119 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
120 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
121 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
122 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
123 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
124 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
125 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
126 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
127 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
128 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
129 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
130 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
131 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
132 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
133 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
134 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
135 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
136 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
137 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
138 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
139 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
140 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
141 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
142 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
143 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
144 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
145 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
146 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
147 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
148 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
149 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
150 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
151 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
152 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
153 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
154 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
155 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
156 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
157 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
158 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
159 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
160 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
161 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
162 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
163 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
164 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
165 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
166 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
167 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
168 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
169 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
170 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
171 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
172 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
173 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
174 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
175 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
176 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
177 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
178 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
179 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
180 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
181 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
182 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
183 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
184 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
185 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
186 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
187 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
188 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
189 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
190 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
191 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
192 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
193 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
194 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
195 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
196 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
197 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
198 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
199 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
200 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
201 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
202 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
203 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
204 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
205 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
206 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
207 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
208 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
209 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
210 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
211 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
212 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
213 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
214 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
219 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
220 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
221 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
222 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
223 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
224 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
225 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
226 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
227 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
228 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
229 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
231 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
232 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
233 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
234 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
235 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
236 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
237 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
238 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
239 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
240 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
241 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
242 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
243 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.23
Metatranscriptomes 2.77
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 10.6
Rhizosphere 88.42
Stem 0
Stem Tuber 0
Unclassified 0.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10787730 3300005327 Bacteria 826
2 Ga0070658_10800708 3300005327 Bacteria 819
3 Ga0070683_100005942 3300005329 Bacteria 10214
4 Ga0070683_100015866 3300005329 Bacteria 6626
5 Ga0070683_100148123 3300005329 Bacteria 2225
6 Ga0070680_100030616 3300005336 Bacteria 4324
7 Ga0070680_100055832 3300005336 Bacteria 3228
8 Ga0070680_100073546 3300005336 Bacteria 2811
9 Ga0070680_100128359 3300005336 Bacteria 2120
10 Ga0070680_100784792 3300005336 Bacteria 821
11 Ga0070680_101741879 3300005336 Bacteria 540
12 Ga0070682_100261389 3300005337 Bacteria 1253
13 Ga0070682_100269637 3300005337 Bacteria 1236
14 Ga0070682_101285878 3300005337 Bacteria 621
15 Ga0070682_101316934 3300005337 Unclassified 614
16 Ga0068868_100101893 3300005338 Bacteria 2324
17 Ga0068868_101136974 3300005338 Bacteria 720
18 Ga0070660_100001517 3300005339 Bacteria 15917
19 Ga0070660_100050981 3300005339 Bacteria 3186
20 Ga0070660_100063653 3300005339 Bacteria 2867
21 Ga0070660_100143568 3300005339 Bacteria 1916
22 Ga0070660_100246169 3300005339 Bacteria 1457
23 Ga0070660_100292186 3300005339 Bacteria 1335
24 Ga0070660_101702169 3300005339 Bacteria 537
25 Ga0070661_100024554 3300005344 Bacteria 4323
26 Ga0070661_100167688 3300005344 Bacteria 1666
27 Ga0070661_100187106 3300005344 Bacteria 1578
28 Ga0070661_100506130 3300005344 Bacteria 967
29 Ga0070671_100267088 3300005355 Bacteria 1454
30 Ga0070659_100051475 3300005366 Bacteria 3238
31 Ga0070659_101850487 3300005366 Unclassified 541
32 Ga0070667_100003011 3300005367 Bacteria 14476
33 Ga0070709_10714107 3300005434 Unclassified 781
34 Ga0070714_100158768 3300005435 Bacteria 2044
35 Ga0070714_100433353 3300005435 Bacteria 1247
36 Ga0070714_100829828 3300005435 Unclassified 896
37 Ga0070713_100056890 3300005436 Bacteria 3254
38 Ga0070710_10087831 3300005437 Bacteria 1828
39 Ga0070710_10252161 3300005437 Unclassified 1135
40 Ga0070711_100034309 3300005439 Bacteria 3384
41 Ga0070711_100147974 3300005439 Bacteria 1768
42 Ga0070711_100434499 3300005439 Bacteria 1072
43 Ga0070711_100492029 3300005439 Bacteria 1010
44 Ga0070708_100428798 3300005445 Bacteria 1247
45 Ga0070708_101592164 3300005445 Bacteria 608
46 Ga0070663_101431074 3300005455 Bacteria 613
47 Ga0070678_100372555 3300005456 Unclassified 1233
48 Ga0070681_10013809 3300005458 Bacteria 8037
49 Ga0070681_10042506 3300005458 Bacteria 4553
50 Ga0070681_10099693 3300005458 Bacteria 2850
51 Ga0070681_10128982 3300005458 Bacteria 2461
52 Ga0070681_10165454 3300005458 Bacteria 2134
53 Ga0070681_10499280 3300005458 Bacteria 1130
54 Ga0070681_11244594 3300005458 Bacteria 666
55 Ga0068867_101619874 3300005459 Bacteria 605
56 Ga0070679_100036130 3300005530 Bacteria 4903
57 Ga0070679_100043391 3300005530 Bacteria 4479
58 Ga0070679_100048602 3300005530 Bacteria 4226
59 Ga0070679_100112087 3300005530 Bacteria 2714
60 Ga0070679_100213535 3300005530 Bacteria 1892
61 Ga0070679_100233060 3300005530 Bacteria 1800
62 Ga0070679_100256877 3300005530 Bacteria 1703
63 Ga0070679_100505694 3300005530 Bacteria 1152
64 Ga0070679_100654073 3300005530 Bacteria 994
65 Ga0070679_100711502 3300005530 Bacteria 947
66 Ga0070679_101601338 3300005530 Bacteria 599
67 Ga0070679_102025127 3300005530 Bacteria 525
68 Ga0070684_100030060 3300005535 Bacteria 4613
69 Ga0070684_100060050 3300005535 Bacteria 3325
70 Ga0070684_100105016 3300005535 Bacteria 2528
71 Ga0070684_100111559 3300005535 Bacteria 2452
72 Ga0070684_100403480 3300005535 Bacteria 1260
73 Ga0070684_100671593 3300005535 Bacteria 965
74 Ga0070697_100855287 3300005536 Unclassified 806
75 Ga0068853_100055073 3300005539 Bacteria 3428
76 Ga0068853_100250115 3300005539 Bacteria 1626
77 Ga0068853_101846474 3300005539 Bacteria 586
78 Ga0070696_100160715 3300005546 Unclassified 1655
79 Ga0070665_100034046 3300005548 Bacteria 5123
80 Ga0070665_101960765 3300005548 Bacteria 591
81 Ga0070665_102519313 3300005548 Bacteria 516
82 Ga0068855_100016384 3300005563 Bacteria 8910
83 Ga0068855_100063510 3300005563 Bacteria 4309
84 Ga0068855_100087624 3300005563 Bacteria 3597
85 Ga0068855_100255347 3300005563 Bacteria 1954
86 Ga0068855_100411399 3300005563 Bacteria 1481
87 Ga0068855_100769190 3300005563 Bacteria 1025
88 Ga0068855_101716402 3300005563 Bacteria 640
89 Ga0068857_100029189 3300005577 Bacteria 4867
90 Ga0068857_102147719 3300005577 Bacteria 548
91 Ga0068854_100232381 3300005578 Bacteria 1464
92 Ga0068856_100165285 3300005614 Unclassified 2224
93 Ga0068856_100802305 3300005614 Bacteria 961
94 Ga0068856_100922479 3300005614 Bacteria 892
95 Ga0068856_101027112 3300005614 Bacteria 842
96 Ga0068856_102643535 3300005614 Bacteria 508
97 Ga0068852_100179666 3300005616 Bacteria 1989
98 Ga0068852_100204256 3300005616 Bacteria 1871
99 Ga0068852_101089156 3300005616 Bacteria 819
100 Ga0068852_101461091 3300005616 Bacteria 706
101 Ga0068858_101426512 3300005842 Bacteria 682
102 Ga0068860_100924557 3300005843 Bacteria 889
103 Ga0081538_10010466 3300005981 Bacteria 7607
104 Ga0070717_10587493 3300006028 Bacteria 1010
105 Ga0070716_100745654 3300006173 Bacteria 753
106 Ga0070712_100069257 3300006175 Bacteria 2517
107 Ga0070712_100417845 3300006175 Bacteria 1111
108 Ga0070712_101068896 3300006175 Bacteria 700
109 Ga0070712_101967503 3300006175 Bacteria 512
110 Ga0097621_101137383 3300006237 Unclassified 734
111 Ga0068871_100411371 3300006358 Unclassified 1206
112 Ga0068871_101284739 3300006358 Unclassified 688
113 Ga0075428_100009861 3300006844 Bacteria 10614
114 Ga0075431_101075308 3300006847 Bacteria 770
115 Ga0075433_10138820 3300006852 Bacteria 2160
116 Ga0075434_100010410 3300006871 Bacteria 8717
117 Ga0075429_100839573 3300006880 Bacteria 804
118 Ga0075436_100370066 3300006914 Bacteria 1035
119 Ga0075435_100016982 3300007076 Bacteria 5497
120 Ga0105240_10053923 3300009093 Bacteria 5043
121 Ga0105240_10120145 3300009093 Bacteria 3165
122 Ga0105240_10120376 3300009093 Bacteria 3161
123 Ga0105240_10143064 3300009093 Bacteria 2857
124 Ga0105240_10247992 3300009093 Bacteria 2061
125 Ga0105240_10693310 3300009093 Bacteria 1112
126 Ga0105240_11524410 3300009093 Bacteria 700
127 Ga0111539_10482426 3300009094 Unclassified 1444
128 Ga0105245_10005489 3300009098 Bacteria 11140
129 Ga0105245_10245370 3300009098 Bacteria 1738
130 Ga0105245_10546408 3300009098 Bacteria 1180
131 Ga0105245_12210810 3300009098 Bacteria 604
132 Ga0105245_12246828 3300009098 Bacteria 599
133 Ga0114129_10005334 3300009147 Bacteria 18145
134 Ga0114129_12101196 3300009147 Bacteria 681
135 Ga0105241_10606446 3300009174 Bacteria 989
136 Ga0105241_11044786 3300009174 Bacteria 766
137 Ga0105242_11741843 3300009176 Bacteria 660
138 Ga0105248_11211769 3300009177 Unclassified 853
139 Ga0105237_10019405 3300009545 Bacteria 7021
140 Ga0105237_10034220 3300009545 Bacteria 5146
141 Ga0105237_10139637 3300009545 Bacteria 2417
142 Ga0105238_10019876 3300009551 Bacteria 6836
143 Ga0105238_10047475 3300009551 Bacteria 4329
144 Ga0105238_11941955 3300009551 Bacteria 622
145 Ga0105249_10042223 3300009553 Bacteria 4147
146 Ga0105239_10066207 3300010375 Bacteria 3969
147 Ga0105239_11395985 3300010375 Bacteria 808
148 Ga0105239_12970559 3300010375 Bacteria 553
149 Ga0157373_10030526 3300013100 Bacteria 3879
150 Ga0157373_10462957 3300013100 Bacteria 913
151 Ga0157370_10008703 3300013104 Bacteria 10922
152 Ga0157370_10008884 3300013104 Bacteria 10799
153 Ga0157370_10074275 3300013104 Bacteria 3207
154 Ga0157370_10339226 3300013104 Bacteria 1385
155 Ga0157370_11075063 3300013104 Bacteria 727
156 Ga0157369_10003170 3300013105 Bacteria 19626
157 Ga0157369_10021481 3300013105 Bacteria 7220
158 Ga0157369_10079566 3300013105 Bacteria 3510
159 Ga0157369_10209123 3300013105 Bacteria 2046
160 Ga0157369_10413168 3300013105 Bacteria 1399
161 Ga0157369_10424350 3300013105 Bacteria 1379
162 Ga0157369_10659443 3300013105 Unclassified 1079
163 Ga0157369_10750883 3300013105 Bacteria 1004
164 Ga0157374_10113216 3300013296 Bacteria 2611
165 Ga0157374_11128889 3300013296 Bacteria 804
166 Ga0157374_11854936 3300013296 Bacteria 628
167 Ga0157378_10518701 3300013297 Bacteria 1193
168 Ga0157378_10830372 3300013297 Bacteria 951
169 Ga0157378_12869537 3300013297 Bacteria 534
170 Ga0157372_10064426 3300013307 Bacteria 4112
171 Ga0157372_10080130 3300013307 Bacteria 3693
172 Ga0157372_10205945 3300013307 Bacteria 2279
173 Ga0157372_10534068 3300013307 Bacteria 1367
174 Ga0157372_10917620 3300013307 Bacteria 1016
175 Ga0157372_11165457 3300013307 Bacteria 891
176 Ga0157375_10493086 3300013308 Unclassified 1389
177 Ga0157375_10523948 3300013308 Bacteria 1348
178 Ga0157375_11244684 3300013308 Bacteria 874
179 Ga0157376_10597810 3300014969 Bacteria 1098
180 Ga0157376_11120158 3300014969 Bacteria 813
181 Ga0182006_1174381 3300015261 Bacteria 719
182 Ga0182007_10237935 3300015262 Unclassified 649
183 Ga0197907_10555821 3300020069 Unclassified 780
184 Ga0206356_10199074 3300020070 Bacteria 536
185 Ga0206356_10213960 3300020070 Bacteria 1565
186 Ga0206356_10906256 3300020070 Unclassified 589
187 Ga0206356_11007588 3300020070 Bacteria 1920
188 Ga0206356_11532121 3300020070 Bacteria 1317
189 Ga0206350_11658887 3300020080 Bacteria 658
190 Ga0206354_10372290 3300020081 Unclassified 773
191 Ga0206354_10434998 3300020081 Bacteria 790
192 Ga0206354_10791054 3300020081 Bacteria 1103
193 Ga0206354_11344677 3300020081 Bacteria 2220
194 Ga0206353_10418390 3300020082 Bacteria 2717
195 Ga0206353_10987184 3300020082 Bacteria 10455
196 Ga0206353_11646033 3300020082 Bacteria 2560
197 Ga0206353_11798682 3300020082 Bacteria 2763
198 Ga0206353_11896535 3300020082 Bacteria 1814
199 Ga0213876_10362658 3300021384 Bacteria 771
200 Ga0207692_10135577 3300025898 Unclassified 1395
201 Ga0207692_10643612 3300025898 Bacteria 684
202 Ga0207699_10788796 3300025906 Unclassified 698
203 Ga0207699_10985817 3300025906 Bacteria 623
204 Ga0207705_10061210 3300025909 Bacteria 2719
205 Ga0207705_10086718 3300025909 Bacteria 2288
206 Ga0207705_10168217 3300025909 Bacteria 1650
207 Ga0207705_10176595 3300025909 Bacteria 1610
208 Ga0207705_10261425 3300025909 Bacteria 1322
209 Ga0207654_10653030 3300025911 Bacteria 753
210 Ga0207707_10028530 3300025912 Bacteria 4878
211 Ga0207707_10063643 3300025912 Bacteria 3210
212 Ga0207707_10068650 3300025912 Bacteria 3089
213 Ga0207707_10095190 3300025912 Bacteria 2603
214 Ga0207707_10395371 3300025912 Bacteria 1187
215 Ga0207695_10118469 3300025913 Bacteria 2619
216 Ga0207695_10307743 3300025913 Bacteria 1475
217 Ga0207695_11296545 3300025913 Bacteria 609
218 Ga0207671_10027983 3300025914 Bacteria 4213
219 Ga0207671_10041739 3300025914 Bacteria 3396
220 Ga0207693_10027294 3300025915 Bacteria 4514
221 Ga0207663_10022190 3300025916 Bacteria 3626
222 Ga0207663_10129207 3300025916 Bacteria 1743
223 Ga0207663_10268048 3300025916 Unclassified 1264
224 Ga0207663_10340818 3300025916 Bacteria 1132
225 Ga0207663_11654477 3300025916 Bacteria 515
226 Ga0207660_10033916 3300025917 Bacteria 3534
227 Ga0207660_10073040 3300025917 Bacteria 2500
228 Ga0207660_10123762 3300025917 Bacteria 1962
229 Ga0207660_10157622 3300025917 Bacteria 1749
230 Ga0207660_10242730 3300025917 Bacteria 1420
231 Ga0207660_10472920 3300025917 Bacteria 1015
232 Ga0207660_10871611 3300025917 Bacteria 735
233 Ga0207660_11285700 3300025917 Bacteria 594
234 Ga0207660_11519715 3300025917 Bacteria 541
235 Ga0207657_10000054 3300025919 Bacteria 106767
236 Ga0207657_10000651 3300025919 Bacteria 36939
237 Ga0207657_10026684 3300025919 Bacteria 5301
238 Ga0207657_10094223 3300025919 Bacteria 2493
239 Ga0207657_10617865 3300025919 Bacteria 845
240 Ga0207649_10031801 3300025920 Bacteria 3140
241 Ga0207649_10172831 3300025920 Bacteria 1506
242 Ga0207649_11183285 3300025920 Bacteria 604
243 Ga0207652_10118461 3300025921 Bacteria 2353
244 Ga0207652_10136182 3300025921 Bacteria 2193
245 Ga0207652_10160515 3300025921 Bacteria 2015
246 Ga0207652_10249862 3300025921 Bacteria 1599
247 Ga0207652_10492662 3300025921 Bacteria 1104
248 Ga0207652_10842891 3300025921 Bacteria 812
249 Ga0207652_10939436 3300025921 Bacteria 762
250 Ga0207652_10956839 3300025921 Bacteria 754
251 Ga0207652_11055511 3300025921 Bacteria 712
252 Ga0207652_11172087 3300025921 Bacteria 670
253 Ga0207694_10020090 3300025924 Bacteria 5052
254 Ga0207694_10914020 3300025924 Bacteria 742
255 Ga0207687_10533173 3300025927 Bacteria 983
256 Ga0207687_10870535 3300025927 Bacteria 770
257 Ga0207687_11168188 3300025927 Bacteria 661
258 Ga0207687_11175915 3300025927 Bacteria 659
259 Ga0207700_10031432 3300025928 Bacteria 3772
260 Ga0207700_10472195 3300025928 Bacteria 1108
261 Ga0207700_10709310 3300025928 Bacteria 898
262 Ga0207664_10169838 3300025929 Bacteria 1866
263 Ga0207664_10237926 3300025929 Unclassified 1585
264 Ga0207664_11636295 3300025929 Bacteria 566
265 Ga0207644_10329837 3300025931 Unclassified 1235
266 Ga0207690_10010167 3300025932 Bacteria 5589
267 Ga0207690_10616053 3300025932 Bacteria 887
268 Ga0207706_11673395 3300025933 Unclassified 513
269 Ga0207686_11128603 3300025934 Bacteria 640
270 Ga0207709_11625002 3300025935 Bacteria 537
271 Ga0207665_10525454 3300025939 Bacteria 917
272 Ga0207711_11823254 3300025941 Bacteria 551
273 Ga0207661_10124155 3300025944 Bacteria 2203
274 Ga0207661_10124905 3300025944 Bacteria 2196
275 Ga0207661_10142813 3300025944 Bacteria 2062
276 Ga0207661_10261327 3300025944 Bacteria 1542
277 Ga0207661_10431280 3300025944 Bacteria 1198
278 Ga0207661_10469994 3300025944 Bacteria 1147
279 Ga0207661_10866301 3300025944 Bacteria 832
280 Ga0207667_10080044 3300025949 Bacteria 3385
281 Ga0207667_10143431 3300025949 Bacteria 2458
282 Ga0207667_10705488 3300025949 Unclassified 1011
283 Ga0207667_11158537 3300025949 Bacteria 754
284 Ga0207667_11812059 3300025949 Unclassified 574
285 Ga0207640_10361307 3300025981 Bacteria 1170
286 Ga0207640_10364956 3300025981 Bacteria 1165
287 Ga0207658_10004308 3300025986 Bacteria 9909
288 Ga0207677_10407891 3300026023 Bacteria 1154
289 Ga0207677_10924852 3300026023 Bacteria 787
290 Ga0207703_11452587 3300026035 Bacteria 660
291 Ga0207639_10037935 3300026041 Bacteria 3582
292 Ga0207639_11752269 3300026041 Bacteria 582
293 Ga0207678_10275632 3300026067 Bacteria 1443
294 Ga0207702_10052351 3300026078 Bacteria 3454
295 Ga0207702_10071171 3300026078 Bacteria 2994
296 Ga0207702_11512748 3300026078 Bacteria 665
297 Ga0207702_12472665 3300026078 Bacteria 506
298 Ga0207648_10315305 3300026089 Bacteria 1404
299 Ga0207648_11294753 3300026089 Bacteria 685
300 Ga0207674_10010978 3300026116 Bacteria 10193
301 Ga0207674_10492468 3300026116 Bacteria 1185
302 Ga0207674_11645151 3300026116 Bacteria 610
303 Ga0207683_10377027 3300026121 Unclassified 1304
304 Ga0207698_10116228 3300026142 Bacteria 2254
305 Ga0207698_10225077 3300026142 Bacteria 1698
306 Ga0207698_10228812 3300026142 Bacteria 1686
307 Ga0207698_10436355 3300026142 Bacteria 1261
308 Ga0207698_10690979 3300026142 Bacteria 1014
309 Ga0268266_10115483 3300028379 Bacteria 2383
310 Ga0268266_10933194 3300028379 Bacteria 840
311 Ga0268266_11058210 3300028379 Unclassified 785
312 Ga0268264_10255698 3300028381 Bacteria 1629
313 Ga0265331_10115676 3300031250 Unclassified 1228
314 Ga0265327_10015633 3300031251 Bacteria 4882
315 Ga0307408_100356479 3300031548 Bacteria 1243
316 Ga0307416_101733772 3300032002 Bacteria 729
317 Ga0373944_0006321 3300035089 Bacteria 3141
318 Ga0373944_0043716 3300035089 Bacteria 1393
319 Ga0373936_0008928 3300035113 Bacteria 3778
320 Ga0373936_0300579 3300035113 Unclassified 724
321 Ga0373936_0352033 3300035113 Bacteria 671
322 Ga0373945_0002165 3300035116 Bacteria 6128
323 Ga0373945_0014749 3300035116 Bacteria 2623
324 Ga0373956_0380699 3300035119 Bacteria 673
325 Ga0373957_0051723 3300035120 Bacteria 1572
326 Ga0373943_0000101 3300035170 Bacteria 31609
327 Ga0373943_0002380 3300035170 Bacteria 8526
328 Ga0373943_0019104 3300035170 Bacteria 3151
329 Ga0373946_0089985 3300035171 Bacteria 1359
330 Ga0373946_0494491 3300035171 Bacteria 627
331 Ga0373955_0006377 3300035172 Bacteria 5376
332 Ga0373924_0124279 3300035410 Unclassified 1121
333 Ga0373935_0003186 3300035692 Bacteria 9463
334 Ga0373935_0436657 3300035692 Bacteria 944
335 Ga0373935_0475622 3300035692 Bacteria 905
336 Ga0373927_0078714 3300035695 Bacteria 2135
337 Ga0373927_0104633 3300035695 Bacteria 1843
338 Ga0373927_0817063 3300035695 Bacteria 616
339 Ga0373933_0032010 3300035724 Bacteria 3055
340 Ga0373947_0002740 3300035725 Bacteria 10558
341 Ga0373947_0004984 3300035725 Bacteria 7772
342 Ga0373947_0942873 3300035725 Bacteria 589
343 Ga0373947_1228311 3300035725 Bacteria 510
344 Ga0373925_0001828 3300037068 Bacteria 17755
345 Ga0373925_0010452 3300037068 Bacteria 6730
346 Ga0373925_0019854 3300037068 Bacteria 4889
347 Ga0373925_1033958 3300037068 Bacteria 676
348 Ga0395899_0502132 3300037312 Unclassified 787
349 Ga0395900_0062931 3300037418 Bacteria 3813
350 Ga0395900_0118840 3300037418 Bacteria 2713
351 Ga0395900_0469456 3300037418 Bacteria 1212
352 Ga0395900_0675402 3300037418 Bacteria 968
353 Ga0395900_1046062 3300037418 Bacteria 735
354 Ga0395900_1455836 3300037418 Bacteria 597
355 Ga0395898_0001509 3300037466 Bacteria 32076
356 Ga0395898_0007850 3300037466 Bacteria 11324
357 Ga0395898_0342362 3300037466 Bacteria 1426
358 Ga0395898_0349215 3300037466 Bacteria 1411
359 Ga0395898_0493331 3300037466 Bacteria 1165
360 Ga0395898_0944284 3300037466 Bacteria 800
361 Ga0395905_0106669 3300037471 Bacteria 2630
362 Ga0395901_0001414 3300038443 Bacteria 25054
363 Ga0395901_0022116 3300038443 Bacteria 6515
364 Ga0395901_0111813 3300038443 Bacteria 2869
365 Ga0395901_0128104 3300038443 Bacteria 2668
366 Ga0395901_0248383 3300038443 Bacteria 1854
367 Ga0395901_0656177 3300038443 Unclassified 1052
368 Ga0395901_0713905 3300038443 Bacteria 999
369 Ga0395901_0780048 3300038443 Bacteria 946
370 Ga0436365_1571369 3300039437 Bacteria 894
371 Ga0436363_0074777 3300039450 Bacteria 515
372 Ga0436363_1532817 3300039450 Bacteria 632
373 Ga0451800_0466089 3300041459 Bacteria 612
374 Ga0451845_0612332 3300041501 Bacteria 719
375 Ga0451853_2492716 3300041512 Bacteria 1402
376 Ga0439448_0156574 3300042005 Bacteria 792
377 Ga0439454_084621 3300042011 Unclassified 579
378 Ga0466965_0106994 3300044683 Bacteria 1435
379 Ga0466966_0002588 3300044684 Bacteria 11853
380 Ga0466966_0032731 3300044684 Bacteria 3367
381 Ga0466963_0001732 3300044694 Bacteria 11878
382 Ga0466963_0023591 3300044694 Bacteria 3909
383 Ga0466963_0123435 3300044694 Bacteria 1784
384 Ga0466963_0664204 3300044694 Bacteria 736
385 Ga0466964_0004414 3300044706 Bacteria 5193
386 Ga0466964_0105488 3300044706 Bacteria 1249
387 Ga0466957_0505265 3300044842 Bacteria 838
388 Ga0466959_0015352 3300045049 Bacteria 5577
389 Ga0466959_0060933 3300045049 Bacteria 2745
390 Ga0466959_0721938 3300045049 Bacteria 667
391 Ga0466958_0667679 3300045836 Bacteria 677
392 Ga0466958_0705546 3300045836 Bacteria 657
393 Ga0466958_1008525 3300045836 Bacteria 543
394 Ga0466967_0007258 3300045976 Bacteria 7971
395 Ga0466967_0032999 3300045976 Bacteria 4378
396 Ga0466967_0044604 3300045976 Bacteria 3847
397 Ga0466967_0084219 3300045976 Bacteria 2877
398 Ga0466967_0231194 3300045976 Unclassified 1761
399 Ga0466967_0614351 3300045976 Bacteria 1073
400 Ga0466967_1037078 3300045976 Bacteria 817
401 Ga0495592_0067449 3300046454 Bacteria 2615
402 Ga0495603_0102425 3300046455 Bacteria 1671
403 Ga0495629_0000670 3300046459 Bacteria 27725
404 Ga0495629_0189887 3300046459 Bacteria 1422
405 Ga0495629_1071416 3300046459 Unclassified 522
406 Ga0495641_0000374 3300046461 Bacteria 37120
407 Ga0495641_0208812 3300046461 Bacteria 875
408 Ga0495651_0004871 3300046462 Bacteria 10268
409 Ga0495651_0022109 3300046462 Bacteria 4944
410 Ga0495651_0191781 3300046462 Bacteria 1437
411 Ga0495653_0011141 3300046463 Bacteria 7354
412 Ga0495653_0039537 3300046463 Bacteria 3694
413 Ga0495653_0064886 3300046463 Bacteria 2750
414 Ga0495580_0387117 3300046472 Bacteria 944
415 Ga0495582_0000124 3300046473 Bacteria 41197
416 Ga0495582_0579476 3300046473 Bacteria 649
417 Ga0495639_0000658 3300046475 Bacteria 15965
418 Ga0495662_0000898 3300046476 Bacteria 14537
419 Ga0495662_0031320 3300046476 Bacteria 2569
420 Ga0495664_0033006 3300046477 Bacteria 3041
421 Ga0495664_0070584 3300046477 Bacteria 2086
422 Ga0495596_0071042 3300046500 Bacteria 1352
423 Ga0495608_0005935 3300046511 Bacteria 8686
424 Ga0495608_0038097 3300046511 Bacteria 3231
425 Ga0495608_0050740 3300046511 Bacteria 2752
426 Ga0495618_0053992 3300046514 Bacteria 2541
427 Ga0495618_0201734 3300046514 Bacteria 1259
428 Ga0495628_0916762 3300046516 Unclassified 607
429 Ga0495630_0007417 3300046517 Bacteria 7836
430 Ga0495630_0021732 3300046517 Bacteria 4738
431 Ga0495630_0022236 3300046517 Bacteria 4686
432 Ga0495630_0059166 3300046517 Bacteria 2874
433 Ga0495630_0354178 3300046517 Bacteria 1123
434 Ga0495666_0030819 3300046526 Bacteria 2630
435 Ga0495666_0487786 3300046526 Bacteria 551
436 Ga0495652_0026278 3300046529 Bacteria 5144
437 Ga0495652_0370780 3300046529 Bacteria 1020
438 Ga0495665_0000249 3300046531 Bacteria 27073
439 Ga0495665_0361968 3300046531 Unclassified 738
440 Ga0495640_0019459 3300046533 Bacteria 5010
441 Ga0495640_0023042 3300046533 Bacteria 4546
442 Ga0495640_0080149 3300046533 Bacteria 2172
443 Ga0495586_0039208 3300046535 Unclassified 2546
444 Ga0495587_0006779 3300046536 Bacteria 7455
445 Ga0495587_0341912 3300046536 Bacteria 835
446 Ga0495587_0641130 3300046536 Bacteria 584
447 Ga0495645_0015115 3300046543 Bacteria 5487
448 Ga0495645_0046298 3300046543 Bacteria 3170
449 Ga0495667_0012696 3300046559 Bacteria 5710
450 Ga0495667_0030058 3300046559 Bacteria 3653
451 Ga0495668_0474100 3300046616 Unclassified 689
452 Ga0495634_0038440 3300046642 Bacteria 3263
453 Ga0495634_0110312 3300046642 Bacteria 1769
454 Ga0495634_0329186 3300046642 Bacteria 918
455 Ga0495635_0009732 3300046663 Bacteria 6719
456 Ga0495635_0012567 3300046663 Bacteria 5934
457 Ga0495635_0126029 3300046663 Bacteria 1746
458 Ga0495657_0035371 3300046675 Bacteria 3462
459 Ga0495657_0108190 3300046675 Bacteria 1764
460 Ga0495657_0110282 3300046675 Bacteria 1744
461 Ga0495599_0009819 3300046678 Bacteria 5857
462 Ga0495599_0322865 3300046678 Unclassified 929
463 Ga0495623_0005346 3300046679 Bacteria 8407
464 Ga0495646_0112052 3300046680 Bacteria 1552
465 Ga0495646_0305794 3300046680 Unclassified 840
466 Ga0495647_0000689 3300046681 Bacteria 10082
467 Ga0495647_0601682 3300046681 Unclassified 516
468 Ga0495658_0000247 3300046683 Bacteria 30977
469 Ga0495658_0029776 3300046683 Bacteria 2958
470 Ga0495613_0001393 3300046689 Bacteria 18401
471 Ga0495613_0388861 3300046689 Bacteria 953
472 Ga0495624_0045682 3300046690 Bacteria 2787
473 Ga0495624_0144487 3300046690 Bacteria 1456
474 Ga0495589_0274977 3300046794 Unclassified 784
475 Ga0495600_0017263 3300046809 Bacteria 4588
476 Ga0495600_0398876 3300046809 Bacteria 856
477 Ga0495581_0004417 3300047315 Bacteria 8130
478 Ga0495604_0014213 3300047317 Bacteria 6345
479 Ga0495604_0096373 3300047317 Bacteria 2183
480 Ga0495604_0340699 3300047317 Bacteria 998
481 Ga0495674_0003941 3300047319 Bacteria 14400
482 Ga0495674_0011930 3300047319 Bacteria 8194
483 Ga0495674_0192128 3300047319 Bacteria 1696
484 Ga0495676_0001077 3300047321 Bacteria 23118
485 Ga0495676_0296886 3300047321 Bacteria 1090
486 Ga0495676_0493381 3300047321 Unclassified 804
487 Ga0495680_0003365 3300047322 Bacteria 15791
488 Ga0495680_0013880 3300047322 Bacteria 7008
489 Ga0495675_0000878 3300047444 Bacteria 18381
490 Ga0495684_0001855 3300047471 Bacteria 16919
491 Ga0495684_0036467 3300047471 Bacteria 3769
492 Ga0495593_0039086 3300047673 Bacteria 2560
493 Ga0495602_0028925 3300048088 Bacteria 5294
494 Ga0495602_0283502 3300048088 Bacteria 1219
495 Ga0495602_0628722 3300048088 Bacteria 735
496 Ga0495614_0009511 3300048089 Bacteria 4297
497 Ga0496100_0004628 3300048903 Bacteria 7318
498 Ga0496100_0064529 3300048903 Bacteria 2424
499 Ga0496100_0074714 3300048903 Bacteria 2271
500 Ga0496100_1455474 3300048903 Unclassified 541
501 Ga0496101_0009476 3300048904 Bacteria 6401
502 Ga0496101_0018810 3300048904 Bacteria 4704
503 Ga0496101_0071677 3300048904 Bacteria 2540
504 Ga0496101_0159973 3300048904 Bacteria 1727
505 Ga0496101_0272957 3300048904 Bacteria 1320
506 Ga0496102_0009451 3300048905 Bacteria 8378
507 Ga0496102_0019849 3300048905 Bacteria 5926
508 Ga0496102_0275326 3300048905 Bacteria 1586
509 Ga0496103_0053451 3300048906 Bacteria 2503
510 Ga0496103_0544672 3300048906 Unclassified 741
511 Ga0496103_0781227 3300048906 Bacteria 603
512 Ga0496104_0026632 3300048907 Bacteria 5342
513 Ga0496104_0047678 3300048907 Bacteria 4038
514 Ga0496104_0050582 3300048907 Bacteria 3921
515 Ga0496104_1611585 3300048907 Bacteria 552
516 Ga0496105_0002629 3300048908 Bacteria 13070
517 Ga0496105_0052163 3300048908 Bacteria 3377
518 Ga0496105_0128549 3300048908 Bacteria 2089
519 Ga0496106_0011636 3300048909 Bacteria 6504
520 Ga0496106_0947980 3300048909 Unclassified 678
521 Ga0496107_0006368 3300048910 Bacteria 8115
522 Ga0496107_0075266 3300048910 Bacteria 2457
523 Ga0496107_0339223 3300048910 Bacteria 1118
524 Ga0496107_0699935 3300048910 Unclassified 745
525 Ga0496108_0002961 3300048911 Bacteria 13659
526 Ga0496108_0836217 3300048911 Unclassified 793
527 Ga0496108_0977330 3300048911 Unclassified 724
528 Ga0496109_0002273 3300048912 Bacteria 15968
529 Ga0496109_0012523 3300048912 Bacteria 7322
530 Ga0496109_1191901 3300048912 Unclassified 698
531 Ga0496109_2005747 3300048912 Unclassified 511
532 Ga0496110_0030477 3300048913 Bacteria 4650
533 Ga0496110_0076879 3300048913 Bacteria 2969
534 Ga0496110_0208041 3300048913 Bacteria 1778
535 Ga0496110_0398523 3300048913 Bacteria 1255
536 Ga0496111_0008543 3300048914 Bacteria 6785
537 Ga0496111_0221288 3300048914 Bacteria 1406
538 Ga0496111_0780321 3300048914 Unclassified 692
539 Ga0496112_0006274 3300048915 Bacteria 10426
540 Ga0496112_0010827 3300048915 Bacteria 8297
541 Ga0496112_0026439 3300048915 Bacteria 5584
542 Ga0496112_0101324 3300048915 Bacteria 2850
543 Ga0496112_0177088 3300048915 Bacteria 2097
544 Ga0496112_1450759 3300048915 Bacteria 600
545 Ga0496113_0010642 3300048916 Bacteria 6091
546 Ga0496113_0275258 3300048916 Bacteria 1346
547 Ga0496114_0012160 3300048917 Bacteria 6888
548 Ga0496114_0024496 3300048917 Bacteria 4927
549 Ga0496114_0025411 3300048917 Bacteria 4841
550 Ga0496114_0627563 3300048917 Bacteria 946
551 Ga0496114_0859215 3300048917 Bacteria 788
552 Ga0496114_0980489 3300048917 Bacteria 728
553 Ga0496114_1255216 3300048917 Bacteria 627
554 Ga0496115_0002513 3300048918 Bacteria 13172
555 Ga0496115_0018662 3300048918 Bacteria 5331
556 Ga0496115_0113212 3300048918 Bacteria 2229
557 Ga0496115_0240251 3300048918 Bacteria 1493
558 Ga0496115_0283249 3300048918 Bacteria 1360
559 Ga0496115_1201506 3300048918 Bacteria 570
560 Ga0496115_1395858 3300048918 Unclassified 517
561 Ga0501034_0347104 3300049571 Bacteria 1413
562 Ga0501043_1272013 3300049579 Bacteria 514
563 Ga0501046_0525474 3300049580 Bacteria 846
564 Ga0501046_0574867 3300049580 Bacteria 801
565 Ga0501047_0030664 3300049581 Bacteria 5183
566 Ga0501047_0897287 3300049581 Bacteria 700
567 Ga0501067_0025573 3300049583 Bacteria 3272
568 Ga0501067_0251661 3300049583 Bacteria 983
569 Ga0501069_0212710 3300049585 Bacteria 1122
570 Ga0501069_0548386 3300049585 Bacteria 692
571 Ga0501070_0014526 3300049586 Bacteria 6625
572 Ga0501070_0104456 3300049586 Bacteria 2342
573 Ga0501070_0199843 3300049586 Bacteria 1642
574 Ga0501072_0006239 3300049588 Bacteria 9084
575 Ga0501073_0179515 3300049589 Bacteria 1465
576 Ga0501073_0225181 3300049589 Bacteria 1295
577 Ga0501074_0005182 3300049590 Bacteria 9364
578 Ga0501074_0006294 3300049590 Bacteria 8572
579 Ga0501074_0104417 3300049590 Bacteria 2028
580 Ga0501074_0432978 3300049590 Bacteria 933
581 Ga0501076_0558754 3300049592 Unclassified 944
582 Ga0501077_0512456 3300049593 Bacteria 769
583 Ga0501079_0027091 3300049741 Bacteria 4393
584 Ga0501079_0563910 3300049741 Bacteria 896
585 Ga0501079_1488724 3300049741 Bacteria 532
586 Ga0501080_0021753 3300049742 Bacteria 5941
587 Ga0501080_0318824 3300049742 Bacteria 1407
588 Ga0501083_0005259 3300049744 Bacteria 9155
589 Ga0501083_0844146 3300049744 Bacteria 596
590 Ga0501035_0909263 3300049822 Bacteria 697
591 Ga0501044_0584492 3300049823 Bacteria 1011
592 nmdc:mga05p37_8824_c2 3300050507 Bacteria 4147
593 nmdc:mga09592_766456_c1 3300050508 Bacteria 818
594 nmdc:mga06r32_119589_c1 3300050510 Bacteria 2597
595 nmdc:mga0n895_54375_c1 3300050512 Bacteria 3938
596 nmdc:mga0rr50_21866_c1 3300050513 Bacteria 4377
597 nmdc:mga0a205_33711_c2 3300050515 Bacteria 2166
598 Ga0495601_0010350 3300053077 Bacteria 5548
599 Ga0495601_0093841 3300053077 Bacteria 1933
600 Ga0495601_0720095 3300053077 Bacteria 636
601 Ga0495612_0050027 3300053078 Bacteria 1716
602 Ga0495612_0172221 3300053078 Bacteria 948
603 Ga0495595_0004822 3300053084 Bacteria 5431
604 Ga0495595_0008213 3300053084 Bacteria 4285
605 Ga0495595_0209849 3300053084 Bacteria 970
606 Ga0495619_0002878 3300053085 Bacteria 11188
607 Ga0495619_0004757 3300053085 Bacteria 8632
608 Ga0495619_0005166 3300053085 Bacteria 8284
609 Ga0495619_0587620 3300053085 Unclassified 762
610 Ga0501084_0204316 3300054114 Bacteria 1667
611 Ga0587091_184499 3300059511 Bacteria 551
612 Ga0466962_0152859 3300061719 Bacteria 1120
613 Ga0466962_0598635 3300061719 Bacteria 562

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005843 Ga0068860_100924557 Ga0068860_1009245572 76
2 3300028381 Ga0268264_10255698 Ga0268264_102556982 76
3 3300025935 Ga0207709_11625002 Ga0207709_116250022 78
4 3300026089 Ga0207648_10315305 Ga0207648_103153052 78
5 3300009553 Ga0105249_10042223 Ga0105249_100422234 85
6 3300026116 Ga0207674_11645151 Ga0207674_116451512 85
7 3300005439 Ga0070711_100492029 Ga0070711_1004920292 87
8 3300005546 Ga0070696_100160715 Ga0070696_1001607151 87
9 3300009098 Ga0105245_10005489 Ga0105245_1000548910 87
10 3300010375 Ga0105239_10066207 Ga0105239_100662073 87
11 3300013297 Ga0157378_10518701 Ga0157378_105187012 87
12 3300025916 Ga0207663_10268048 Ga0207663_102680482 87
13 3300037418 Ga0395900_0469456 Ga0395900_0469456_282_590 87
14 3300037466 Ga0395898_0342362 Ga0395898_0342362_956_1264 87
15 3300025898 Ga0207692_10135577 Ga0207692_101355772 88
16 3300038443 Ga0395901_0713905 Ga0395901_0713905_56_361 89
17 3300013104 Ga0157370_11075063 Ga0157370_110750632 92
18 3300035692 Ga0373935_0475622 Ga0373935_0475622_80_364 92
19 3300038443 Ga0395901_0248383 Ga0395901_0248383_1228_1512 92
20 3300046473 Ga0495582_0579476 Ga0495582_0579476_211_495 92
21 3300046533 Ga0495640_0080149 Ga0495640_0080149_1816_2094 92
22 3300046535 Ga0495586_0039208 Ga0495586_0039208_1686_1970 92
23 3300047319 Ga0495674_0011930 Ga0495674_0011930_359_643 92
24 3300048910 Ga0496107_0699935 Ga0496107_0699935_295_579 92
25 3300048914 Ga0496111_0780321 Ga0496111_0780321_138_422 92
26 3300053085 Ga0495619_0587620 Ga0495619_0587620_218_502 92
27 3300046455 Ga0495603_0102425 Ga0495603_0102425_1373_1657 94
28 3300045836 Ga0466958_1008525 Ga0466958_1008525_221_526 96
29 3300005981 Ga0081538_10010466 Ga0081538_100104665 98
30 3300042011 Ga0439454_084621 Ga0439454_084621_135_440 98
31 3300009551 Ga0105238_11941955 Ga0105238_119419551 99
32 3300025932 Ga0207690_10616053 Ga0207690_106160532 99
33 3300035113 Ga0373936_0008928 Ga0373936_0008928_2939_3244 99
34 3300035116 Ga0373945_0014749 Ga0373945_0014749_1804_2109 99
35 3300035170 Ga0373943_0002380 Ga0373943_0002380_6218_6523 99
36 3300035171 Ga0373946_0494491 Ga0373946_0494491_241_546 99
37 3300037068 Ga0373925_0010452 Ga0373925_0010452_6044_6349 99
38 3300037418 Ga0395900_0118840 Ga0395900_0118840_2203_2508 99
39 3300037466 Ga0395898_0493331 Ga0395898_0493331_42_347 99
40 3300046517 Ga0495630_0022236 Ga0495630_0022236_1364_1669 99
41 3300046683 Ga0495658_0029776 Ga0495658_0029776_2142_2447 99
42 3300047321 Ga0495676_0296886 Ga0495676_0296886_763_1068 99
43 3300005337 Ga0070682_101316934 Ga0070682_1013169341 100
44 3300006844 Ga0075428_100009861 Ga0075428_10000986117 100
45 3300006847 Ga0075431_101075308 Ga0075431_1010753082 100
46 3300006880 Ga0075429_100839573 Ga0075429_1008395731 100
47 3300009094 Ga0111539_10482426 Ga0111539_104824263 100
48 3300009147 Ga0114129_10005334 Ga0114129_1000533416 100
49 3300039450 Ga0436363_1532817 Ga0436363_1532817_138_446 100
50 3300046500 Ga0495596_0071042 Ga0495596_0071042_680_991 100
51 3300046616 Ga0495668_0474100 Ga0495668_0474100_213_524 100
52 3300046794 Ga0495589_0274977 Ga0495589_0274977_298_609 100
53 3300048903 Ga0496100_1455474 Ga0496100_1455474_105_413 100
54 3300048907 Ga0496104_1611585 Ga0496104_1611585_179_487 100
55 3300048911 Ga0496108_0836217 Ga0496108_0836217_37_345 100
56 3300048913 Ga0496110_0208041 Ga0496110_0208041_47_355 100
57 3300050507 nmdc:mga05p37_8824_c2 nmdc:mga05p37_8824_c2_2327_2635 100
58 3300050508 nmdc:mga09592_766456_c1 nmdc:mga09592_766456_c1_457_765 100
59 3300050510 nmdc:mga06r32_119589_c1 nmdc:mga06r32_119589_c1_130_438 100
60 3300005327 Ga0070658_10787730 Ga0070658_107877301 101
61 3300005327 Ga0070658_10800708 Ga0070658_108007082 101
62 3300005329 Ga0070683_100005942 Ga0070683_1000059425 101
63 3300005329 Ga0070683_100015866 Ga0070683_1000158664 101
64 3300005329 Ga0070683_100148123 Ga0070683_1001481232 101
65 3300005336 Ga0070680_100030616 Ga0070680_1000306164 101
66 3300005336 Ga0070680_100055832 Ga0070680_1000558324 101
67 3300005336 Ga0070680_100073546 Ga0070680_1000735463 101
68 3300005336 Ga0070680_100128359 Ga0070680_1001283592 101
69 3300005336 Ga0070680_100784792 Ga0070680_1007847922 101
70 3300005336 Ga0070680_101741879 Ga0070680_1017418792 101
71 3300005337 Ga0070682_100261389 Ga0070682_1002613892 101
72 3300005337 Ga0070682_100269637 Ga0070682_1002696372 101
73 3300005337 Ga0070682_101285878 Ga0070682_1012858781 101
74 3300005338 Ga0068868_100101893 Ga0068868_1001018932 101
75 3300005338 Ga0068868_101136974 Ga0068868_1011369742 101
76 3300005339 Ga0070660_100001517 Ga0070660_10000151710 101
77 3300005339 Ga0070660_100050981 Ga0070660_1000509813 101
78 3300005339 Ga0070660_100063653 Ga0070660_1000636532 101
79 3300005339 Ga0070660_100143568 Ga0070660_1001435683 101
80 3300005339 Ga0070660_100246169 Ga0070660_1002461692 101
81 3300005339 Ga0070660_100292186 Ga0070660_1002921862 101
82 3300005339 Ga0070660_101702169 Ga0070660_1017021692 101
83 3300005344 Ga0070661_100024554 Ga0070661_1000245543 101
84 3300005344 Ga0070661_100167688 Ga0070661_1001676882 101
85 3300005344 Ga0070661_100187106 Ga0070661_1001871062 101
86 3300005344 Ga0070661_100506130 Ga0070661_1005061302 101
87 3300005355 Ga0070671_100267088 Ga0070671_1002670882 101
88 3300005366 Ga0070659_100051475 Ga0070659_1000514752 101
89 3300005366 Ga0070659_101850487 Ga0070659_1018504871 101
90 3300005367 Ga0070667_100003011 Ga0070667_10000301118 101
91 3300005434 Ga0070709_10714107 Ga0070709_107141072 101
92 3300005435 Ga0070714_100158768 Ga0070714_1001587682 101
93 3300005435 Ga0070714_100433353 Ga0070714_1004333532 101
94 3300005435 Ga0070714_100829828 Ga0070714_1008298282 101
95 3300005436 Ga0070713_100056890 Ga0070713_1000568902 101
96 3300005437 Ga0070710_10087831 Ga0070710_100878312 101
97 3300005437 Ga0070710_10252161 Ga0070710_102521612 101
98 3300005439 Ga0070711_100034309 Ga0070711_1000343094 101
99 3300005439 Ga0070711_100147974 Ga0070711_1001479742 101
100 3300005439 Ga0070711_100434499 Ga0070711_1004344992 101
101 3300005445 Ga0070708_100428798 Ga0070708_1004287982 101
102 3300005445 Ga0070708_101592164 Ga0070708_1015921641 101
103 3300005455 Ga0070663_101431074 Ga0070663_1014310742 101
104 3300005456 Ga0070678_100372555 Ga0070678_1003725552 101
105 3300005458 Ga0070681_10013809 Ga0070681_100138093 101
106 3300005458 Ga0070681_10042506 Ga0070681_100425061 101
107 3300005458 Ga0070681_10099693 Ga0070681_100996932 101
108 3300005458 Ga0070681_10128982 Ga0070681_101289822 101
109 3300005458 Ga0070681_10165454 Ga0070681_101654542 101
110 3300005458 Ga0070681_10499280 Ga0070681_104992801 101
111 3300005458 Ga0070681_11244594 Ga0070681_112445942 101
112 3300005459 Ga0068867_101619874 Ga0068867_1016198741 101
113 3300005530 Ga0070679_100036130 Ga0070679_1000361303 101
114 3300005530 Ga0070679_100043391 Ga0070679_1000433913 101
115 3300005530 Ga0070679_100048602 Ga0070679_1000486022 101
116 3300005530 Ga0070679_100112087 Ga0070679_1001120874 101
117 3300005530 Ga0070679_100213535 Ga0070679_1002135352 101
118 3300005530 Ga0070679_100233060 Ga0070679_1002330603 101
119 3300005530 Ga0070679_100256877 Ga0070679_1002568772 101
120 3300005530 Ga0070679_100505694 Ga0070679_1005056942 101
121 3300005530 Ga0070679_100654073 Ga0070679_1006540732 101
122 3300005530 Ga0070679_100711502 Ga0070679_1007115022 101
123 3300005530 Ga0070679_101601338 Ga0070679_1016013382 101
124 3300005530 Ga0070679_102025127 Ga0070679_1020251271 101
125 3300005535 Ga0070684_100030060 Ga0070684_1000300603 101
126 3300005535 Ga0070684_100060050 Ga0070684_1000600504 101
127 3300005535 Ga0070684_100105016 Ga0070684_1001050162 101
128 3300005535 Ga0070684_100111559 Ga0070684_1001115592 101
129 3300005535 Ga0070684_100403480 Ga0070684_1004034802 101
130 3300005535 Ga0070684_100671593 Ga0070684_1006715932 101
131 3300005536 Ga0070697_100855287 Ga0070697_1008552871 101
132 3300005539 Ga0068853_100055073 Ga0068853_1000550732 101
133 3300005539 Ga0068853_100250115 Ga0068853_1002501152 101
134 3300005539 Ga0068853_101846474 Ga0068853_1018464741 101
135 3300005548 Ga0070665_100034046 Ga0070665_1000340462 101
136 3300005548 Ga0070665_101960765 Ga0070665_1019607652 101
137 3300005548 Ga0070665_102519313 Ga0070665_1025193131 101
138 3300005563 Ga0068855_100016384 Ga0068855_1000163842 101
139 3300005563 Ga0068855_100063510 Ga0068855_1000635102 101
140 3300005563 Ga0068855_100087624 Ga0068855_1000876243 101
141 3300005563 Ga0068855_100255347 Ga0068855_1002553472 101
142 3300005563 Ga0068855_100411399 Ga0068855_1004113992 101
143 3300005563 Ga0068855_100769190 Ga0068855_1007691902 101
144 3300005563 Ga0068855_101716402 Ga0068855_1017164022 101
145 3300005577 Ga0068857_100029189 Ga0068857_1000291893 101
146 3300005577 Ga0068857_102147719 Ga0068857_1021477192 101
147 3300005578 Ga0068854_100232381 Ga0068854_1002323812 101
148 3300005614 Ga0068856_100165285 Ga0068856_1001652852 101
149 3300005614 Ga0068856_100802305 Ga0068856_1008023051 101
150 3300005614 Ga0068856_100922479 Ga0068856_1009224792 101
151 3300005614 Ga0068856_101027112 Ga0068856_1010271122 101
152 3300005614 Ga0068856_102643535 Ga0068856_1026435351 101
153 3300005616 Ga0068852_100179666 Ga0068852_1001796662 101
154 3300005616 Ga0068852_100204256 Ga0068852_1002042562 101
155 3300005616 Ga0068852_101089156 Ga0068852_1010891562 101
156 3300005616 Ga0068852_101461091 Ga0068852_1014610912 101
157 3300005842 Ga0068858_101426512 Ga0068858_1014265122 101
158 3300006028 Ga0070717_10587493 Ga0070717_105874932 101
159 3300006173 Ga0070716_100745654 Ga0070716_1007456542 101
160 3300006175 Ga0070712_100069257 Ga0070712_1000692573 101
161 3300006175 Ga0070712_100417845 Ga0070712_1004178452 101
162 3300006175 Ga0070712_101068896 Ga0070712_1010688961 101
163 3300006175 Ga0070712_101967503 Ga0070712_1019675031 101
164 3300006237 Ga0097621_101137383 Ga0097621_1011373832 101
165 3300006358 Ga0068871_100411371 Ga0068871_1004113712 101
166 3300006358 Ga0068871_101284739 Ga0068871_1012847392 101
167 3300006852 Ga0075433_10138820 Ga0075433_101388202 101
168 3300006871 Ga0075434_100010410 Ga0075434_1000104105 101
169 3300006914 Ga0075436_100370066 Ga0075436_1003700662 101
170 3300007076 Ga0075435_100016982 Ga0075435_1000169822 101
171 3300009093 Ga0105240_10053923 Ga0105240_100539233 101
172 3300009093 Ga0105240_10120145 Ga0105240_101201452 101
173 3300009093 Ga0105240_10120376 Ga0105240_101203763 101
174 3300009093 Ga0105240_10143064 Ga0105240_101430642 101
175 3300009093 Ga0105240_10247992 Ga0105240_102479922 101
176 3300009093 Ga0105240_10693310 Ga0105240_106933102 101
177 3300009093 Ga0105240_11524410 Ga0105240_115244101 101
178 3300009098 Ga0105245_10245370 Ga0105245_102453702 101
179 3300009098 Ga0105245_10546408 Ga0105245_105464082 101
180 3300009098 Ga0105245_12210810 Ga0105245_122108102 101
181 3300009098 Ga0105245_12246828 Ga0105245_122468282 101
182 3300009147 Ga0114129_12101196 Ga0114129_121011962 101
183 3300009174 Ga0105241_10606446 Ga0105241_106064462 101
184 3300009174 Ga0105241_11044786 Ga0105241_110447862 101
185 3300009176 Ga0105242_11741843 Ga0105242_117418431 101
186 3300009177 Ga0105248_11211769 Ga0105248_112117692 101
187 3300009545 Ga0105237_10019405 Ga0105237_100194053 101
188 3300009545 Ga0105237_10034220 Ga0105237_100342202 101
189 3300009545 Ga0105237_10139637 Ga0105237_101396372 101
190 3300009551 Ga0105238_10019876 Ga0105238_100198766 101
191 3300009551 Ga0105238_10047475 Ga0105238_100474752 101
192 3300010375 Ga0105239_11395985 Ga0105239_113959852 101
193 3300010375 Ga0105239_12970559 Ga0105239_129705592 101
194 3300013100 Ga0157373_10030526 Ga0157373_100305263 101
195 3300013100 Ga0157373_10462957 Ga0157373_104629571 101
196 3300013104 Ga0157370_10008703 Ga0157370_100087038 101
197 3300013104 Ga0157370_10008884 Ga0157370_100088846 101
198 3300013104 Ga0157370_10074275 Ga0157370_100742753 101
199 3300013104 Ga0157370_10339226 Ga0157370_103392262 101
200 3300013105 Ga0157369_10003170 Ga0157369_100031705 101
201 3300013105 Ga0157369_10021481 Ga0157369_100214814 101
202 3300013105 Ga0157369_10079566 Ga0157369_100795664 101
203 3300013105 Ga0157369_10209123 Ga0157369_102091232 101
204 3300013105 Ga0157369_10413168 Ga0157369_104131682 101
205 3300013105 Ga0157369_10424350 Ga0157369_104243502 101
206 3300013105 Ga0157369_10659443 Ga0157369_106594432 101
207 3300013105 Ga0157369_10750883 Ga0157369_107508832 101
208 3300013296 Ga0157374_10113216 Ga0157374_101132162 101
209 3300013296 Ga0157374_11128889 Ga0157374_111288892 101
210 3300013296 Ga0157374_11854936 Ga0157374_118549362 101
211 3300013297 Ga0157378_10830372 Ga0157378_108303721 101
212 3300013297 Ga0157378_12869537 Ga0157378_128695372 101
213 3300013307 Ga0157372_10064426 Ga0157372_100644264 101
214 3300013307 Ga0157372_10080130 Ga0157372_100801304 101
215 3300013307 Ga0157372_10205945 Ga0157372_102059452 101
216 3300013307 Ga0157372_10534068 Ga0157372_105340683 101
217 3300013307 Ga0157372_10917620 Ga0157372_109176202 101
218 3300013307 Ga0157372_11165457 Ga0157372_111654572 101
219 3300013308 Ga0157375_10493086 Ga0157375_104930862 101
220 3300013308 Ga0157375_10523948 Ga0157375_105239481 101
221 3300013308 Ga0157375_11244684 Ga0157375_112446842 101
222 3300014969 Ga0157376_10597810 Ga0157376_105978102 101
223 3300014969 Ga0157376_11120158 Ga0157376_111201582 101
224 3300015261 Ga0182006_1174381 Ga0182006_11743812 101
225 3300015262 Ga0182007_10237935 Ga0182007_102379351 101
226 3300020069 Ga0197907_10555821 Ga0197907_105558212 101
227 3300020070 Ga0206356_10199074 Ga0206356_101990742 101
228 3300020070 Ga0206356_10213960 Ga0206356_102139602 101
229 3300020070 Ga0206356_10906256 Ga0206356_109062562 101
230 3300020070 Ga0206356_11007588 Ga0206356_110075882 101
231 3300020070 Ga0206356_11532121 Ga0206356_115321212 101
232 3300020080 Ga0206350_11658887 Ga0206350_116588871 101
233 3300020081 Ga0206354_10372290 Ga0206354_103722902 101
234 3300020081 Ga0206354_10434998 Ga0206354_104349981 101
235 3300020081 Ga0206354_10791054 Ga0206354_107910542 101
236 3300020081 Ga0206354_11344677 Ga0206354_113446772 101
237 3300020082 Ga0206353_10418390 Ga0206353_104183903 101
238 3300020082 Ga0206353_10987184 Ga0206353_109871846 101
239 3300020082 Ga0206353_11646033 Ga0206353_116460332 101
240 3300020082 Ga0206353_11798682 Ga0206353_117986822 101
241 3300020082 Ga0206353_11896535 Ga0206353_118965352 101
242 3300021384 Ga0213876_10362658 Ga0213876_103626581 101
243 3300025898 Ga0207692_10643612 Ga0207692_106436122 101
244 3300025906 Ga0207699_10788796 Ga0207699_107887962 101
245 3300025906 Ga0207699_10985817 Ga0207699_109858172 101
246 3300025909 Ga0207705_10061210 Ga0207705_100612102 101
247 3300025909 Ga0207705_10086718 Ga0207705_100867182 101
248 3300025909 Ga0207705_10168217 Ga0207705_101682172 101
249 3300025909 Ga0207705_10176595 Ga0207705_101765952 101
250 3300025909 Ga0207705_10261425 Ga0207705_102614252 101
251 3300025911 Ga0207654_10653030 Ga0207654_106530301 101
252 3300025912 Ga0207707_10028530 Ga0207707_100285303 101
253 3300025912 Ga0207707_10063643 Ga0207707_100636433 101
254 3300025912 Ga0207707_10068650 Ga0207707_100686503 101
255 3300025912 Ga0207707_10095190 Ga0207707_100951902 101
256 3300025912 Ga0207707_10395371 Ga0207707_103953712 101
257 3300025913 Ga0207695_10118469 Ga0207695_101184694 101
258 3300025913 Ga0207695_10307743 Ga0207695_103077432 101
259 3300025913 Ga0207695_11296545 Ga0207695_112965452 101
260 3300025914 Ga0207671_10027983 Ga0207671_100279834 101
261 3300025914 Ga0207671_10041739 Ga0207671_100417392 101
262 3300025915 Ga0207693_10027294 Ga0207693_100272944 101
263 3300025916 Ga0207663_10022190 Ga0207663_100221903 101
264 3300025916 Ga0207663_10129207 Ga0207663_101292072 101
265 3300025916 Ga0207663_10340818 Ga0207663_103408182 101
266 3300025916 Ga0207663_11654477 Ga0207663_116544771 101
267 3300025917 Ga0207660_10033916 Ga0207660_100339163 101
268 3300025917 Ga0207660_10073040 Ga0207660_100730402 101
269 3300025917 Ga0207660_10123762 Ga0207660_101237622 101
270 3300025917 Ga0207660_10157622 Ga0207660_101576222 101
271 3300025917 Ga0207660_10242730 Ga0207660_102427302 101
272 3300025917 Ga0207660_10472920 Ga0207660_104729202 101
273 3300025917 Ga0207660_10871611 Ga0207660_108716112 101
274 3300025917 Ga0207660_11285700 Ga0207660_112857002 101
275 3300025917 Ga0207660_11519715 Ga0207660_115197152 101
276 3300025919 Ga0207657_10000054 Ga0207657_1000005484 101
277 3300025919 Ga0207657_10000651 Ga0207657_100006516 101
278 3300025919 Ga0207657_10026684 Ga0207657_100266845 101
279 3300025919 Ga0207657_10094223 Ga0207657_100942232 101
280 3300025919 Ga0207657_10617865 Ga0207657_106178652 101
281 3300025920 Ga0207649_10031801 Ga0207649_100318013 101
282 3300025920 Ga0207649_10172831 Ga0207649_101728312 101
283 3300025920 Ga0207649_11183285 Ga0207649_111832852 101
284 3300025921 Ga0207652_10118461 Ga0207652_101184612 101
285 3300025921 Ga0207652_10136182 Ga0207652_101361821 101
286 3300025921 Ga0207652_10160515 Ga0207652_101605152 101
287 3300025921 Ga0207652_10249862 Ga0207652_102498622 101
288 3300025921 Ga0207652_10492662 Ga0207652_104926622 101
289 3300025921 Ga0207652_10842891 Ga0207652_108428911 101
290 3300025921 Ga0207652_10939436 Ga0207652_109394362 101
291 3300025921 Ga0207652_10956839 Ga0207652_109568392 101
292 3300025921 Ga0207652_11055511 Ga0207652_110555112 101
293 3300025921 Ga0207652_11172087 Ga0207652_111720872 101
294 3300025924 Ga0207694_10020090 Ga0207694_100200903 101
295 3300025924 Ga0207694_10914020 Ga0207694_109140202 101
296 3300025927 Ga0207687_10533173 Ga0207687_105331732 101
297 3300025927 Ga0207687_10870535 Ga0207687_108705352 101
298 3300025927 Ga0207687_11168188 Ga0207687_111681882 101
299 3300025927 Ga0207687_11175915 Ga0207687_111759151 101
300 3300025928 Ga0207700_10031432 Ga0207700_100314325 101
301 3300025928 Ga0207700_10472195 Ga0207700_104721952 101
302 3300025928 Ga0207700_10709310 Ga0207700_107093102 101
303 3300025929 Ga0207664_10169838 Ga0207664_101698382 101
304 3300025929 Ga0207664_10237926 Ga0207664_102379262 101
305 3300025929 Ga0207664_11636295 Ga0207664_116362952 101
306 3300025931 Ga0207644_10329837 Ga0207644_103298372 101
307 3300025932 Ga0207690_10010167 Ga0207690_100101672 101
308 3300025933 Ga0207706_11673395 Ga0207706_116733952 101
309 3300025934 Ga0207686_11128603 Ga0207686_111286032 101
310 3300025939 Ga0207665_10525454 Ga0207665_105254542 101
311 3300025941 Ga0207711_11823254 Ga0207711_118232542 101
312 3300025944 Ga0207661_10124155 Ga0207661_101241552 101
313 3300025944 Ga0207661_10124905 Ga0207661_101249052 101
314 3300025944 Ga0207661_10142813 Ga0207661_101428132 101
315 3300025944 Ga0207661_10261327 Ga0207661_102613272 101
316 3300025944 Ga0207661_10431280 Ga0207661_104312802 101
317 3300025944 Ga0207661_10469994 Ga0207661_104699942 101
318 3300025944 Ga0207661_10866301 Ga0207661_108663012 101
319 3300025949 Ga0207667_10080044 Ga0207667_100800442 101
320 3300025949 Ga0207667_10143431 Ga0207667_101434312 101
321 3300025949 Ga0207667_10705488 Ga0207667_107054882 101
322 3300025949 Ga0207667_11158537 Ga0207667_111585372 101
323 3300025949 Ga0207667_11812059 Ga0207667_118120592 101
324 3300025981 Ga0207640_10361307 Ga0207640_103613072 101
325 3300025981 Ga0207640_10364956 Ga0207640_103649562 101
326 3300025986 Ga0207658_10004308 Ga0207658_1000430810 101
327 3300026023 Ga0207677_10407891 Ga0207677_104078912 101
328 3300026023 Ga0207677_10924852 Ga0207677_109248522 101
329 3300026035 Ga0207703_11452587 Ga0207703_114525872 101
330 3300026041 Ga0207639_10037935 Ga0207639_100379353 101
331 3300026041 Ga0207639_11752269 Ga0207639_117522692 101
332 3300026067 Ga0207678_10275632 Ga0207678_102756322 101
333 3300026078 Ga0207702_10052351 Ga0207702_100523512 101
334 3300026078 Ga0207702_10071171 Ga0207702_100711712 101
335 3300026078 Ga0207702_11512748 Ga0207702_115127482 101
336 3300026078 Ga0207702_12472665 Ga0207702_124726651 101
337 3300026089 Ga0207648_11294753 Ga0207648_112947532 101
338 3300026116 Ga0207674_10010978 Ga0207674_100109785 101
339 3300026116 Ga0207674_10492468 Ga0207674_104924682 101
340 3300026121 Ga0207683_10377027 Ga0207683_103770272 101
341 3300026142 Ga0207698_10116228 Ga0207698_101162282 101
342 3300026142 Ga0207698_10225077 Ga0207698_102250772 101
343 3300026142 Ga0207698_10228812 Ga0207698_102288122 101
344 3300026142 Ga0207698_10436355 Ga0207698_104363552 101
345 3300026142 Ga0207698_10690979 Ga0207698_106909792 101
346 3300028379 Ga0268266_10115483 Ga0268266_101154832 101
347 3300028379 Ga0268266_10933194 Ga0268266_109331942 101
348 3300028379 Ga0268266_11058210 Ga0268266_110582101 101
349 3300031250 Ga0265331_10115676 Ga0265331_101156762 101
350 3300031251 Ga0265327_10015633 Ga0265327_100156334 101
351 3300031548 Ga0307408_100356479 Ga0307408_1003564791 101
352 3300032002 Ga0307416_101733772 Ga0307416_1017337722 101
353 3300035089 Ga0373944_0006321 Ga0373944_0006321_1319_1624 101
354 3300035089 Ga0373944_0043716 Ga0373944_0043716_574_885 101
355 3300035113 Ga0373936_0300579 Ga0373936_0300579_216_527 101
356 3300035113 Ga0373936_0352033 Ga0373936_0352033_225_536 101
357 3300035116 Ga0373945_0002165 Ga0373945_0002165_409_714 101
358 3300035119 Ga0373956_0380699 Ga0373956_0380699_167_472 101
359 3300035120 Ga0373957_0051723 Ga0373957_0051723_113_418 101
360 3300035170 Ga0373943_0000101 Ga0373943_0000101_17911_18216 101
361 3300035170 Ga0373943_0019104 Ga0373943_0019104_2389_2700 101
362 3300035171 Ga0373946_0089985 Ga0373946_0089985_384_689 101
363 3300035172 Ga0373955_0006377 Ga0373955_0006377_2185_2490 101
364 3300035410 Ga0373924_0124279 Ga0373924_0124279_722_1027 101
365 3300035692 Ga0373935_0003186 Ga0373935_0003186_2062_2367 101
366 3300035692 Ga0373935_0436657 Ga0373935_0436657_606_911 101
367 3300035695 Ga0373927_0078714 Ga0373927_0078714_110_415 101
368 3300035695 Ga0373927_0104633 Ga0373927_0104633_854_1165 101
369 3300035695 Ga0373927_0817063 Ga0373927_0817063_26_331 101
370 3300035724 Ga0373933_0032010 Ga0373933_0032010_1173_1478 101
371 3300035725 Ga0373947_0002740 Ga0373947_0002740_8543_8854 101
372 3300035725 Ga0373947_0004984 Ga0373947_0004984_4122_4427 101
373 3300035725 Ga0373947_0942873 Ga0373947_0942873_240_548 101
374 3300035725 Ga0373947_1228311 Ga0373947_1228311_83_388 101
375 3300037068 Ga0373925_0001828 Ga0373925_0001828_8292_8597 101
376 3300037068 Ga0373925_0019854 Ga0373925_0019854_2661_2972 101
377 3300037068 Ga0373925_1033958 Ga0373925_1033958_276_587 101
378 3300037312 Ga0395899_0502132 Ga0395899_0502132_101_406 101
379 3300037418 Ga0395900_0062931 Ga0395900_0062931_1267_1575 101
380 3300037418 Ga0395900_0675402 Ga0395900_0675402_95_400 101
381 3300037418 Ga0395900_1046062 Ga0395900_1046062_397_702 101
382 3300037418 Ga0395900_1455836 Ga0395900_1455836_253_558 101
383 3300037466 Ga0395898_0001509 Ga0395898_0001509_28618_28923 101
384 3300037466 Ga0395898_0007850 Ga0395898_0007850_1348_1656 101
385 3300037466 Ga0395898_0349215 Ga0395898_0349215_100_414 101
386 3300037466 Ga0395898_0944284 Ga0395898_0944284_226_531 101
387 3300037471 Ga0395905_0106669 Ga0395905_0106669_2078_2386 101
388 3300038443 Ga0395901_0001414 Ga0395901_0001414_23010_23318 101
389 3300038443 Ga0395901_0022116 Ga0395901_0022116_1677_1982 101
390 3300038443 Ga0395901_0111813 Ga0395901_0111813_1965_2279 101
391 3300038443 Ga0395901_0128104 Ga0395901_0128104_69_374 101
392 3300038443 Ga0395901_0656177 Ga0395901_0656177_606_917 101
393 3300038443 Ga0395901_0780048 Ga0395901_0780048_552_857 101
394 3300039437 Ga0436365_1571369 Ga0436365_1571369_111_416 101
395 3300039450 Ga0436363_0074777 Ga0436363_0074777_190_504 101
396 3300041459 Ga0451800_0466089 Ga0451800_0466089_16_324 101
397 3300041501 Ga0451845_0612332 Ga0451845_0612332_343_651 101
398 3300041512 Ga0451853_2492716 Ga0451853_2492716_342_650 101
399 3300042005 Ga0439448_0156574 Ga0439448_0156574_468_782 101
400 3300044683 Ga0466965_0106994 Ga0466965_0106994_1087_1392 101
401 3300044684 Ga0466966_0002588 Ga0466966_0002588_7247_7552 101
402 3300044684 Ga0466966_0032731 Ga0466966_0032731_1778_2083 101
403 3300044694 Ga0466963_0001732 Ga0466963_0001732_7335_7646 101
404 3300044694 Ga0466963_0023591 Ga0466963_0023591_1700_2008 101
405 3300044694 Ga0466963_0123435 Ga0466963_0123435_185_490 101
406 3300044694 Ga0466963_0664204 Ga0466963_0664204_345_659 101
407 3300044706 Ga0466964_0004414 Ga0466964_0004414_2765_3070 101
408 3300044706 Ga0466964_0105488 Ga0466964_0105488_329_634 101
409 3300044842 Ga0466957_0505265 Ga0466957_0505265_512_823 101
410 3300045049 Ga0466959_0015352 Ga0466959_0015352_49_354 101
411 3300045049 Ga0466959_0060933 Ga0466959_0060933_1598_1903 101
412 3300045049 Ga0466959_0721938 Ga0466959_0721938_352_657 101
413 3300045836 Ga0466958_0667679 Ga0466958_0667679_168_473 101
414 3300045836 Ga0466958_0705546 Ga0466958_0705546_20_331 101
415 3300045976 Ga0466967_0007258 Ga0466967_0007258_364_669 101
416 3300045976 Ga0466967_0032999 Ga0466967_0032999_2897_3202 101
417 3300045976 Ga0466967_0044604 Ga0466967_0044604_780_1085 101
418 3300045976 Ga0466967_0084219 Ga0466967_0084219_1326_1631 101
419 3300045976 Ga0466967_0231194 Ga0466967_0231194_1404_1709 101
420 3300045976 Ga0466967_0614351 Ga0466967_0614351_198_512 101
421 3300045976 Ga0466967_1037078 Ga0466967_1037078_493_801 101
422 3300046454 Ga0495592_0067449 Ga0495592_0067449_2000_2305 101
423 3300046459 Ga0495629_0000670 Ga0495629_0000670_4763_5068 101
424 3300046459 Ga0495629_0189887 Ga0495629_0189887_39_350 101
425 3300046459 Ga0495629_1071416 Ga0495629_1071416_72_383 101
426 3300046461 Ga0495641_0000374 Ga0495641_0000374_15241_15546 101
427 3300046461 Ga0495641_0208812 Ga0495641_0208812_428_733 101
428 3300046462 Ga0495651_0004871 Ga0495651_0004871_6900_7205 101
429 3300046462 Ga0495651_0022109 Ga0495651_0022109_4324_4629 101
430 3300046462 Ga0495651_0191781 Ga0495651_0191781_990_1295 101
431 3300046463 Ga0495653_0011141 Ga0495653_0011141_4097_4402 101
432 3300046463 Ga0495653_0039537 Ga0495653_0039537_93_398 101
433 3300046463 Ga0495653_0064886 Ga0495653_0064886_1367_1672 101
434 3300046472 Ga0495580_0387117 Ga0495580_0387117_73_384 101
435 3300046473 Ga0495582_0000124 Ga0495582_0000124_22447_22752 101
436 3300046475 Ga0495639_0000658 Ga0495639_0000658_15232_15537 101
437 3300046476 Ga0495662_0000898 Ga0495662_0000898_3360_3665 101
438 3300046476 Ga0495662_0031320 Ga0495662_0031320_165_470 101
439 3300046477 Ga0495664_0033006 Ga0495664_0033006_1005_1310 101
440 3300046477 Ga0495664_0070584 Ga0495664_0070584_1523_1828 101
441 3300046511 Ga0495608_0005935 Ga0495608_0005935_6901_7206 101
442 3300046511 Ga0495608_0038097 Ga0495608_0038097_899_1204 101
443 3300046511 Ga0495608_0050740 Ga0495608_0050740_463_768 101
444 3300046514 Ga0495618_0053992 Ga0495618_0053992_1849_2154 101
445 3300046514 Ga0495618_0201734 Ga0495618_0201734_804_1109 101
446 3300046516 Ga0495628_0916762 Ga0495628_0916762_210_515 101
447 3300046517 Ga0495630_0007417 Ga0495630_0007417_4796_5101 101
448 3300046517 Ga0495630_0021732 Ga0495630_0021732_4270_4581 101
449 3300046517 Ga0495630_0059166 Ga0495630_0059166_21_326 101
450 3300046517 Ga0495630_0354178 Ga0495630_0354178_554_865 101
451 3300046526 Ga0495666_0030819 Ga0495666_0030819_1588_1893 101
452 3300046526 Ga0495666_0487786 Ga0495666_0487786_11_316 101
453 3300046529 Ga0495652_0026278 Ga0495652_0026278_2293_2598 101
454 3300046529 Ga0495652_0370780 Ga0495652_0370780_444_749 101
455 3300046531 Ga0495665_0000249 Ga0495665_0000249_7770_8075 101
456 3300046531 Ga0495665_0361968 Ga0495665_0361968_256_567 101
457 3300046533 Ga0495640_0019459 Ga0495640_0019459_1983_2288 101
458 3300046533 Ga0495640_0023042 Ga0495640_0023042_1339_1644 101
459 3300046536 Ga0495587_0006779 Ga0495587_0006779_3319_3624 101
460 3300046536 Ga0495587_0341912 Ga0495587_0341912_508_813 101
461 3300046536 Ga0495587_0641130 Ga0495587_0641130_266_571 101
462 3300046543 Ga0495645_0015115 Ga0495645_0015115_1698_2003 101
463 3300046543 Ga0495645_0046298 Ga0495645_0046298_1735_2040 101
464 3300046559 Ga0495667_0012696 Ga0495667_0012696_3325_3630 101
465 3300046559 Ga0495667_0030058 Ga0495667_0030058_1448_1753 101
466 3300046642 Ga0495634_0038440 Ga0495634_0038440_2784_3089 101
467 3300046642 Ga0495634_0110312 Ga0495634_0110312_991_1296 101
468 3300046642 Ga0495634_0329186 Ga0495634_0329186_178_483 101
469 3300046663 Ga0495635_0009732 Ga0495635_0009732_3071_3376 101
470 3300046663 Ga0495635_0012567 Ga0495635_0012567_4689_4994 101
471 3300046663 Ga0495635_0126029 Ga0495635_0126029_452_757 101
472 3300046675 Ga0495657_0035371 Ga0495657_0035371_302_607 101
473 3300046675 Ga0495657_0108190 Ga0495657_0108190_366_671 101
474 3300046675 Ga0495657_0110282 Ga0495657_0110282_1193_1498 101
475 3300046678 Ga0495599_0009819 Ga0495599_0009819_3064_3369 101
476 3300046678 Ga0495599_0322865 Ga0495599_0322865_468_773 101
477 3300046679 Ga0495623_0005346 Ga0495623_0005346_4867_5172 101
478 3300046680 Ga0495646_0112052 Ga0495646_0112052_840_1145 101
479 3300046680 Ga0495646_0305794 Ga0495646_0305794_147_452 101
480 3300046681 Ga0495647_0000689 Ga0495647_0000689_1944_2249 101
481 3300046681 Ga0495647_0601682 Ga0495647_0601682_85_396 101
482 3300046683 Ga0495658_0000247 Ga0495658_0000247_18163_18468 101
483 3300046689 Ga0495613_0001393 Ga0495613_0001393_1711_2016 101
484 3300046689 Ga0495613_0388861 Ga0495613_0388861_301_606 101
485 3300046690 Ga0495624_0045682 Ga0495624_0045682_805_1110 101
486 3300046690 Ga0495624_0144487 Ga0495624_0144487_276_581 101
487 3300046809 Ga0495600_0017263 Ga0495600_0017263_3387_3692 101
488 3300046809 Ga0495600_0398876 Ga0495600_0398876_290_595 101
489 3300047315 Ga0495581_0004417 Ga0495581_0004417_3030_3335 101
490 3300047317 Ga0495604_0014213 Ga0495604_0014213_3366_3671 101
491 3300047317 Ga0495604_0096373 Ga0495604_0096373_522_827 101
492 3300047317 Ga0495604_0340699 Ga0495604_0340699_134_439 101
493 3300047319 Ga0495674_0003941 Ga0495674_0003941_2818_3123 101
494 3300047319 Ga0495674_0192128 Ga0495674_0192128_418_723 101
495 3300047321 Ga0495676_0001077 Ga0495676_0001077_17895_18200 101
496 3300047321 Ga0495676_0493381 Ga0495676_0493381_73_384 101
497 3300047322 Ga0495680_0003365 Ga0495680_0003365_5727_6032 101
498 3300047322 Ga0495680_0013880 Ga0495680_0013880_5498_5803 101
499 3300047444 Ga0495675_0000878 Ga0495675_0000878_12330_12635 101
500 3300047471 Ga0495684_0001855 Ga0495684_0001855_10561_10866 101
501 3300047471 Ga0495684_0036467 Ga0495684_0036467_979_1284 101
502 3300047673 Ga0495593_0039086 Ga0495593_0039086_990_1295 101
503 3300048088 Ga0495602_0028925 Ga0495602_0028925_3325_3630 101
504 3300048088 Ga0495602_0283502 Ga0495602_0283502_507_812 101
505 3300048088 Ga0495602_0628722 Ga0495602_0628722_240_545 101
506 3300048089 Ga0495614_0009511 Ga0495614_0009511_1809_2114 101
507 3300048903 Ga0496100_0004628 Ga0496100_0004628_4213_4521 101
508 3300048903 Ga0496100_0064529 Ga0496100_0064529_1781_2086 101
509 3300048903 Ga0496100_0074714 Ga0496100_0074714_410_715 101
510 3300048904 Ga0496101_0009476 Ga0496101_0009476_1264_1572 101
511 3300048904 Ga0496101_0018810 Ga0496101_0018810_213_518 101
512 3300048904 Ga0496101_0071677 Ga0496101_0071677_836_1144 101
513 3300048904 Ga0496101_0159973 Ga0496101_0159973_400_705 101
514 3300048904 Ga0496101_0272957 Ga0496101_0272957_754_1059 101
515 3300048905 Ga0496102_0009451 Ga0496102_0009451_4762_5070 101
516 3300048905 Ga0496102_0019849 Ga0496102_0019849_3008_3313 101
517 3300048905 Ga0496102_0275326 Ga0496102_0275326_687_992 101
518 3300048906 Ga0496103_0053451 Ga0496103_0053451_1665_1973 101
519 3300048906 Ga0496103_0544672 Ga0496103_0544672_151_465 101
520 3300048906 Ga0496103_0781227 Ga0496103_0781227_262_567 101
521 3300048907 Ga0496104_0026632 Ga0496104_0026632_2029_2337 101
522 3300048907 Ga0496104_0047678 Ga0496104_0047678_1252_1560 101
523 3300048907 Ga0496104_0050582 Ga0496104_0050582_1762_2070 101
524 3300048908 Ga0496105_0002629 Ga0496105_0002629_7502_7810 101
525 3300048908 Ga0496105_0052163 Ga0496105_0052163_2889_3197 101
526 3300048908 Ga0496105_0128549 Ga0496105_0128549_454_762 101
527 3300048909 Ga0496106_0011636 Ga0496106_0011636_1976_2284 101
528 3300048909 Ga0496106_0947980 Ga0496106_0947980_341_646 101
529 3300048910 Ga0496107_0006368 Ga0496107_0006368_503_811 101
530 3300048910 Ga0496107_0075266 Ga0496107_0075266_449_754 101
531 3300048910 Ga0496107_0339223 Ga0496107_0339223_661_966 101
532 3300048911 Ga0496108_0002961 Ga0496108_0002961_5989_6297 101
533 3300048911 Ga0496108_0977330 Ga0496108_0977330_335_643 101
534 3300048912 Ga0496109_0002273 Ga0496109_0002273_6263_6571 101
535 3300048912 Ga0496109_0012523 Ga0496109_0012523_1944_2252 101
536 3300048912 Ga0496109_1191901 Ga0496109_1191901_30_338 101
537 3300048912 Ga0496109_2005747 Ga0496109_2005747_102_407 101
538 3300048913 Ga0496110_0030477 Ga0496110_0030477_4232_4540 101
539 3300048913 Ga0496110_0076879 Ga0496110_0076879_1030_1338 101
540 3300048913 Ga0496110_0398523 Ga0496110_0398523_431_739 101
541 3300048914 Ga0496111_0008543 Ga0496111_0008543_4790_5098 101
542 3300048914 Ga0496111_0221288 Ga0496111_0221288_1027_1335 101
543 3300048915 Ga0496112_0006274 Ga0496112_0006274_6085_6393 101
544 3300048915 Ga0496112_0010827 Ga0496112_0010827_1070_1375 101
545 3300048915 Ga0496112_0026439 Ga0496112_0026439_4845_5150 101
546 3300048915 Ga0496112_0101324 Ga0496112_0101324_317_622 101
547 3300048915 Ga0496112_0177088 Ga0496112_0177088_1737_2042 101
548 3300048915 Ga0496112_1450759 Ga0496112_1450759_240_548 101
549 3300048916 Ga0496113_0010642 Ga0496113_0010642_948_1256 101
550 3300048916 Ga0496113_0275258 Ga0496113_0275258_174_479 101
551 3300048917 Ga0496114_0012160 Ga0496114_0012160_1327_1632 101
552 3300048917 Ga0496114_0024496 Ga0496114_0024496_3784_4092 101
553 3300048917 Ga0496114_0025411 Ga0496114_0025411_1277_1585 101
554 3300048917 Ga0496114_0627563 Ga0496114_0627563_52_360 101
555 3300048917 Ga0496114_0859215 Ga0496114_0859215_372_677 101
556 3300048917 Ga0496114_0980489 Ga0496114_0980489_62_367 101
557 3300048917 Ga0496114_1255216 Ga0496114_1255216_41_355 101
558 3300048918 Ga0496115_0002513 Ga0496115_0002513_8847_9155 101
559 3300048918 Ga0496115_0018662 Ga0496115_0018662_1121_1426 101
560 3300048918 Ga0496115_0113212 Ga0496115_0113212_1896_2201 101
561 3300048918 Ga0496115_0240251 Ga0496115_0240251_68_373 101
562 3300048918 Ga0496115_0283249 Ga0496115_0283249_728_1033 101
563 3300048918 Ga0496115_1201506 Ga0496115_1201506_203_511 101
564 3300048918 Ga0496115_1395858 Ga0496115_1395858_84_398 101
565 3300049571 Ga0501034_0347104 Ga0501034_0347104_891_1205 101
566 3300049579 Ga0501043_1272013 Ga0501043_1272013_12_326 101
567 3300049580 Ga0501046_0525474 Ga0501046_0525474_353_667 101
568 3300049580 Ga0501046_0574867 Ga0501046_0574867_345_650 101
569 3300049581 Ga0501047_0030664 Ga0501047_0030664_2245_2550 101
570 3300049581 Ga0501047_0897287 Ga0501047_0897287_281_592 101
571 3300049583 Ga0501067_0025573 Ga0501067_0025573_875_1189 101
572 3300049583 Ga0501067_0251661 Ga0501067_0251661_492_797 101
573 3300049585 Ga0501069_0212710 Ga0501069_0212710_356_661 101
574 3300049585 Ga0501069_0548386 Ga0501069_0548386_130_435 101
575 3300049586 Ga0501070_0014526 Ga0501070_0014526_227_541 101
576 3300049586 Ga0501070_0104456 Ga0501070_0104456_978_1283 101
577 3300049586 Ga0501070_0199843 Ga0501070_0199843_222_527 101
578 3300049588 Ga0501072_0006239 Ga0501072_0006239_3680_3994 101
579 3300049589 Ga0501073_0179515 Ga0501073_0179515_56_370 101
580 3300049589 Ga0501073_0225181 Ga0501073_0225181_694_1008 101
581 3300049590 Ga0501074_0005182 Ga0501074_0005182_7038_7352 101
582 3300049590 Ga0501074_0006294 Ga0501074_0006294_3543_3857 101
583 3300049590 Ga0501074_0104417 Ga0501074_0104417_1677_1982 101
584 3300049590 Ga0501074_0432978 Ga0501074_0432978_152_457 101
585 3300049592 Ga0501076_0558754 Ga0501076_0558754_467_781 101
586 3300049593 Ga0501077_0512456 Ga0501077_0512456_186_500 101
587 3300049741 Ga0501079_0027091 Ga0501079_0027091_2037_2351 101
588 3300049741 Ga0501079_0563910 Ga0501079_0563910_453_767 101
589 3300049741 Ga0501079_1488724 Ga0501079_1488724_188_502 101
590 3300049742 Ga0501080_0021753 Ga0501080_0021753_5417_5731 101
591 3300049742 Ga0501080_0318824 Ga0501080_0318824_695_1009 101
592 3300049744 Ga0501083_0005259 Ga0501083_0005259_510_824 101
593 3300049744 Ga0501083_0844146 Ga0501083_0844146_69_383 101
594 3300049822 Ga0501035_0909263 Ga0501035_0909263_239_544 101
595 3300049823 Ga0501044_0584492 Ga0501044_0584492_275_589 101
596 3300050512 nmdc:mga0n895_54375_c1 nmdc:mga0n895_54375_c1_2487_2792 101
597 3300050513 nmdc:mga0rr50_21866_c1 nmdc:mga0rr50_21866_c1_2168_2473 101
598 3300050515 nmdc:mga0a205_33711_c2 nmdc:mga0a205_33711_c2_837_1142 101
599 3300053077 Ga0495601_0010350 Ga0495601_0010350_2861_3166 101
600 3300053077 Ga0495601_0093841 Ga0495601_0093841_528_833 101
601 3300053077 Ga0495601_0720095 Ga0495601_0720095_293_598 101
602 3300053078 Ga0495612_0050027 Ga0495612_0050027_48_353 101
603 3300053078 Ga0495612_0172221 Ga0495612_0172221_562_867 101
604 3300053084 Ga0495595_0004822 Ga0495595_0004822_3064_3369 101
605 3300053084 Ga0495595_0008213 Ga0495595_0008213_1057_1362 101
606 3300053084 Ga0495595_0209849 Ga0495595_0209849_504_809 101
607 3300053085 Ga0495619_0002878 Ga0495619_0002878_3246_3551 101
608 3300053085 Ga0495619_0004757 Ga0495619_0004757_6716_7021 101
609 3300053085 Ga0495619_0005166 Ga0495619_0005166_4672_4977 101
610 3300054114 Ga0501084_0204316 Ga0501084_0204316_1013_1327 101
611 3300059511 Ga0587091_184499 Ga0587091_184499_16_321 101
612 3300061719 Ga0466962_0152859 Ga0466962_0152859_301_615 101
613 3300061719 Ga0466962_0598635 Ga0466962_0598635_72_377 101

Structural Annotation

Top 5 Hits

ID Description Score Start End
7upo-assembly1.cif.gz_A crystal structure of designed heterotrimeric assembly dht03 0.686 11 67
6v7u-assembly1.cif.gz_A structure of a phage-encoded quorum sensing anti-activator, aqs1 0.5746 13 65
8d2j-assembly2.cif.gz_C a novel insecticidal protein from ferns ipd113_cow. 0.5669 13 100
1vcs-assembly1.cif.gz_A solution structure of rsgi ruh-009, an n-terminal domain of vti1a [mus musculus] 0.5581 18 100
8d2j-assembly1.cif.gz_A a novel insecticidal protein from ferns ipd113_cow. 0.5569 13 101
ID Description Score Start End Superfamily
4javA01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Signal transduction histidine kinase, dimerisation/phosphotransfer (DHp) domain 0.6432 6 72 1.10.287.130
af_Q4D532_1_122_1.25.40.270 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Vacuolar protein sorting-associated protein vta1 0.6162 15 100 1.25.40.270
af_Q4E3R3_1_122_1.25.40.270 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Vacuolar protein sorting-associated protein vta1 0.6156 15 100 1.25.40.270
af_Q8S0N4_1_99_1.20.58.400 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;t-snare proteins 0.6049 16 100 1.20.58.400
af_A0A1D6NEE8_1_99_1.20.58.400 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;t-snare proteins 0.6008 16 100 1.20.58.400
ID Description Score Start End GO Terms
AF-A0A7W1N6L5-F1-model_v4 Uncharacterized protein 0.965 4 101
AF-A0A7W0NHV8-F1-model_v4 Uncharacterized protein 0.9567 2 93
AF-A0A7V9I497-F1-model_v4 Uncharacterized protein 0.9563 3 101
AF-A0A538HSN3-F1-model_v4 Uncharacterized protein 0.9556 4 98
AF-A0A537TPC9-F1-model_v4 Uncharacterized protein 0.9529 9 98

Feature Viewer

pLDDT pTM Quality
95.52 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map