F469262
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 613 | 243 | 613 | 101 |
Family's Representative Sequence
| Representative Sequence | 3300025916|Ga0207663_10340818|Ga0207663_103408182 |
| Length | 109 |
| Sequence | MSPSTVNSVFRRRRFTDLISRQLDLFEREHADVIVEAQERLDAYNRAERDEAEELYGDYVDAVETGTEILADLRDHYAASVEDADAYCAEFNRTVARRLPPFALEIENR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 4 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 6 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 21 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 25 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 28 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 29 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 30 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 31 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 32 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 33 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 34 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 35 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 40 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 41 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 42 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 43 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 44 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 45 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 46 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 47 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 67 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 68 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 69 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 70 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 71 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 72 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 73 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 74 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 114 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 115 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 116 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 117 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 118 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 119 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 120 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 121 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 122 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 123 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 124 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 125 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 126 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 127 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 128 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 129 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 130 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 131 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 132 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 133 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 134 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 135 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 136 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 137 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 138 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 139 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 140 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 141 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 142 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 143 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 144 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 145 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 146 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 147 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 148 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 149 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 150 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 151 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 199 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 200 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 201 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 202 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 203 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 204 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 205 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 206 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 207 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 208 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 209 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 210 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 211 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 212 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 213 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 214 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 215 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 216 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 217 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 218 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 219 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 220 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 221 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 222 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 226 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 227 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 228 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 229 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 232 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 233 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 234 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 235 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 236 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 237 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 243 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.23 |
| Metatranscriptomes | 2.77 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 10.6 |
| Rhizosphere | 88.42 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.98 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10787730 | 3300005327 | Bacteria | 826 |
| 2 | Ga0070658_10800708 | 3300005327 | Bacteria | 819 |
| 3 | Ga0070683_100005942 | 3300005329 | Bacteria | 10214 |
| 4 | Ga0070683_100015866 | 3300005329 | Bacteria | 6626 |
| 5 | Ga0070683_100148123 | 3300005329 | Bacteria | 2225 |
| 6 | Ga0070680_100030616 | 3300005336 | Bacteria | 4324 |
| 7 | Ga0070680_100055832 | 3300005336 | Bacteria | 3228 |
| 8 | Ga0070680_100073546 | 3300005336 | Bacteria | 2811 |
| 9 | Ga0070680_100128359 | 3300005336 | Bacteria | 2120 |
| 10 | Ga0070680_100784792 | 3300005336 | Bacteria | 821 |
| 11 | Ga0070680_101741879 | 3300005336 | Bacteria | 540 |
| 12 | Ga0070682_100261389 | 3300005337 | Bacteria | 1253 |
| 13 | Ga0070682_100269637 | 3300005337 | Bacteria | 1236 |
| 14 | Ga0070682_101285878 | 3300005337 | Bacteria | 621 |
| 15 | Ga0070682_101316934 | 3300005337 | Unclassified | 614 |
| 16 | Ga0068868_100101893 | 3300005338 | Bacteria | 2324 |
| 17 | Ga0068868_101136974 | 3300005338 | Bacteria | 720 |
| 18 | Ga0070660_100001517 | 3300005339 | Bacteria | 15917 |
| 19 | Ga0070660_100050981 | 3300005339 | Bacteria | 3186 |
| 20 | Ga0070660_100063653 | 3300005339 | Bacteria | 2867 |
| 21 | Ga0070660_100143568 | 3300005339 | Bacteria | 1916 |
| 22 | Ga0070660_100246169 | 3300005339 | Bacteria | 1457 |
| 23 | Ga0070660_100292186 | 3300005339 | Bacteria | 1335 |
| 24 | Ga0070660_101702169 | 3300005339 | Bacteria | 537 |
| 25 | Ga0070661_100024554 | 3300005344 | Bacteria | 4323 |
| 26 | Ga0070661_100167688 | 3300005344 | Bacteria | 1666 |
| 27 | Ga0070661_100187106 | 3300005344 | Bacteria | 1578 |
| 28 | Ga0070661_100506130 | 3300005344 | Bacteria | 967 |
| 29 | Ga0070671_100267088 | 3300005355 | Bacteria | 1454 |
| 30 | Ga0070659_100051475 | 3300005366 | Bacteria | 3238 |
| 31 | Ga0070659_101850487 | 3300005366 | Unclassified | 541 |
| 32 | Ga0070667_100003011 | 3300005367 | Bacteria | 14476 |
| 33 | Ga0070709_10714107 | 3300005434 | Unclassified | 781 |
| 34 | Ga0070714_100158768 | 3300005435 | Bacteria | 2044 |
| 35 | Ga0070714_100433353 | 3300005435 | Bacteria | 1247 |
| 36 | Ga0070714_100829828 | 3300005435 | Unclassified | 896 |
| 37 | Ga0070713_100056890 | 3300005436 | Bacteria | 3254 |
| 38 | Ga0070710_10087831 | 3300005437 | Bacteria | 1828 |
| 39 | Ga0070710_10252161 | 3300005437 | Unclassified | 1135 |
| 40 | Ga0070711_100034309 | 3300005439 | Bacteria | 3384 |
| 41 | Ga0070711_100147974 | 3300005439 | Bacteria | 1768 |
| 42 | Ga0070711_100434499 | 3300005439 | Bacteria | 1072 |
| 43 | Ga0070711_100492029 | 3300005439 | Bacteria | 1010 |
| 44 | Ga0070708_100428798 | 3300005445 | Bacteria | 1247 |
| 45 | Ga0070708_101592164 | 3300005445 | Bacteria | 608 |
| 46 | Ga0070663_101431074 | 3300005455 | Bacteria | 613 |
| 47 | Ga0070678_100372555 | 3300005456 | Unclassified | 1233 |
| 48 | Ga0070681_10013809 | 3300005458 | Bacteria | 8037 |
| 49 | Ga0070681_10042506 | 3300005458 | Bacteria | 4553 |
| 50 | Ga0070681_10099693 | 3300005458 | Bacteria | 2850 |
| 51 | Ga0070681_10128982 | 3300005458 | Bacteria | 2461 |
| 52 | Ga0070681_10165454 | 3300005458 | Bacteria | 2134 |
| 53 | Ga0070681_10499280 | 3300005458 | Bacteria | 1130 |
| 54 | Ga0070681_11244594 | 3300005458 | Bacteria | 666 |
| 55 | Ga0068867_101619874 | 3300005459 | Bacteria | 605 |
| 56 | Ga0070679_100036130 | 3300005530 | Bacteria | 4903 |
| 57 | Ga0070679_100043391 | 3300005530 | Bacteria | 4479 |
| 58 | Ga0070679_100048602 | 3300005530 | Bacteria | 4226 |
| 59 | Ga0070679_100112087 | 3300005530 | Bacteria | 2714 |
| 60 | Ga0070679_100213535 | 3300005530 | Bacteria | 1892 |
| 61 | Ga0070679_100233060 | 3300005530 | Bacteria | 1800 |
| 62 | Ga0070679_100256877 | 3300005530 | Bacteria | 1703 |
| 63 | Ga0070679_100505694 | 3300005530 | Bacteria | 1152 |
| 64 | Ga0070679_100654073 | 3300005530 | Bacteria | 994 |
| 65 | Ga0070679_100711502 | 3300005530 | Bacteria | 947 |
| 66 | Ga0070679_101601338 | 3300005530 | Bacteria | 599 |
| 67 | Ga0070679_102025127 | 3300005530 | Bacteria | 525 |
| 68 | Ga0070684_100030060 | 3300005535 | Bacteria | 4613 |
| 69 | Ga0070684_100060050 | 3300005535 | Bacteria | 3325 |
| 70 | Ga0070684_100105016 | 3300005535 | Bacteria | 2528 |
| 71 | Ga0070684_100111559 | 3300005535 | Bacteria | 2452 |
| 72 | Ga0070684_100403480 | 3300005535 | Bacteria | 1260 |
| 73 | Ga0070684_100671593 | 3300005535 | Bacteria | 965 |
| 74 | Ga0070697_100855287 | 3300005536 | Unclassified | 806 |
| 75 | Ga0068853_100055073 | 3300005539 | Bacteria | 3428 |
| 76 | Ga0068853_100250115 | 3300005539 | Bacteria | 1626 |
| 77 | Ga0068853_101846474 | 3300005539 | Bacteria | 586 |
| 78 | Ga0070696_100160715 | 3300005546 | Unclassified | 1655 |
| 79 | Ga0070665_100034046 | 3300005548 | Bacteria | 5123 |
| 80 | Ga0070665_101960765 | 3300005548 | Bacteria | 591 |
| 81 | Ga0070665_102519313 | 3300005548 | Bacteria | 516 |
| 82 | Ga0068855_100016384 | 3300005563 | Bacteria | 8910 |
| 83 | Ga0068855_100063510 | 3300005563 | Bacteria | 4309 |
| 84 | Ga0068855_100087624 | 3300005563 | Bacteria | 3597 |
| 85 | Ga0068855_100255347 | 3300005563 | Bacteria | 1954 |
| 86 | Ga0068855_100411399 | 3300005563 | Bacteria | 1481 |
| 87 | Ga0068855_100769190 | 3300005563 | Bacteria | 1025 |
| 88 | Ga0068855_101716402 | 3300005563 | Bacteria | 640 |
| 89 | Ga0068857_100029189 | 3300005577 | Bacteria | 4867 |
| 90 | Ga0068857_102147719 | 3300005577 | Bacteria | 548 |
| 91 | Ga0068854_100232381 | 3300005578 | Bacteria | 1464 |
| 92 | Ga0068856_100165285 | 3300005614 | Unclassified | 2224 |
| 93 | Ga0068856_100802305 | 3300005614 | Bacteria | 961 |
| 94 | Ga0068856_100922479 | 3300005614 | Bacteria | 892 |
| 95 | Ga0068856_101027112 | 3300005614 | Bacteria | 842 |
| 96 | Ga0068856_102643535 | 3300005614 | Bacteria | 508 |
| 97 | Ga0068852_100179666 | 3300005616 | Bacteria | 1989 |
| 98 | Ga0068852_100204256 | 3300005616 | Bacteria | 1871 |
| 99 | Ga0068852_101089156 | 3300005616 | Bacteria | 819 |
| 100 | Ga0068852_101461091 | 3300005616 | Bacteria | 706 |
| 101 | Ga0068858_101426512 | 3300005842 | Bacteria | 682 |
| 102 | Ga0068860_100924557 | 3300005843 | Bacteria | 889 |
| 103 | Ga0081538_10010466 | 3300005981 | Bacteria | 7607 |
| 104 | Ga0070717_10587493 | 3300006028 | Bacteria | 1010 |
| 105 | Ga0070716_100745654 | 3300006173 | Bacteria | 753 |
| 106 | Ga0070712_100069257 | 3300006175 | Bacteria | 2517 |
| 107 | Ga0070712_100417845 | 3300006175 | Bacteria | 1111 |
| 108 | Ga0070712_101068896 | 3300006175 | Bacteria | 700 |
| 109 | Ga0070712_101967503 | 3300006175 | Bacteria | 512 |
| 110 | Ga0097621_101137383 | 3300006237 | Unclassified | 734 |
| 111 | Ga0068871_100411371 | 3300006358 | Unclassified | 1206 |
| 112 | Ga0068871_101284739 | 3300006358 | Unclassified | 688 |
| 113 | Ga0075428_100009861 | 3300006844 | Bacteria | 10614 |
| 114 | Ga0075431_101075308 | 3300006847 | Bacteria | 770 |
| 115 | Ga0075433_10138820 | 3300006852 | Bacteria | 2160 |
| 116 | Ga0075434_100010410 | 3300006871 | Bacteria | 8717 |
| 117 | Ga0075429_100839573 | 3300006880 | Bacteria | 804 |
| 118 | Ga0075436_100370066 | 3300006914 | Bacteria | 1035 |
| 119 | Ga0075435_100016982 | 3300007076 | Bacteria | 5497 |
| 120 | Ga0105240_10053923 | 3300009093 | Bacteria | 5043 |
| 121 | Ga0105240_10120145 | 3300009093 | Bacteria | 3165 |
| 122 | Ga0105240_10120376 | 3300009093 | Bacteria | 3161 |
| 123 | Ga0105240_10143064 | 3300009093 | Bacteria | 2857 |
| 124 | Ga0105240_10247992 | 3300009093 | Bacteria | 2061 |
| 125 | Ga0105240_10693310 | 3300009093 | Bacteria | 1112 |
| 126 | Ga0105240_11524410 | 3300009093 | Bacteria | 700 |
| 127 | Ga0111539_10482426 | 3300009094 | Unclassified | 1444 |
| 128 | Ga0105245_10005489 | 3300009098 | Bacteria | 11140 |
| 129 | Ga0105245_10245370 | 3300009098 | Bacteria | 1738 |
| 130 | Ga0105245_10546408 | 3300009098 | Bacteria | 1180 |
| 131 | Ga0105245_12210810 | 3300009098 | Bacteria | 604 |
| 132 | Ga0105245_12246828 | 3300009098 | Bacteria | 599 |
| 133 | Ga0114129_10005334 | 3300009147 | Bacteria | 18145 |
| 134 | Ga0114129_12101196 | 3300009147 | Bacteria | 681 |
| 135 | Ga0105241_10606446 | 3300009174 | Bacteria | 989 |
| 136 | Ga0105241_11044786 | 3300009174 | Bacteria | 766 |
| 137 | Ga0105242_11741843 | 3300009176 | Bacteria | 660 |
| 138 | Ga0105248_11211769 | 3300009177 | Unclassified | 853 |
| 139 | Ga0105237_10019405 | 3300009545 | Bacteria | 7021 |
| 140 | Ga0105237_10034220 | 3300009545 | Bacteria | 5146 |
| 141 | Ga0105237_10139637 | 3300009545 | Bacteria | 2417 |
| 142 | Ga0105238_10019876 | 3300009551 | Bacteria | 6836 |
| 143 | Ga0105238_10047475 | 3300009551 | Bacteria | 4329 |
| 144 | Ga0105238_11941955 | 3300009551 | Bacteria | 622 |
| 145 | Ga0105249_10042223 | 3300009553 | Bacteria | 4147 |
| 146 | Ga0105239_10066207 | 3300010375 | Bacteria | 3969 |
| 147 | Ga0105239_11395985 | 3300010375 | Bacteria | 808 |
| 148 | Ga0105239_12970559 | 3300010375 | Bacteria | 553 |
| 149 | Ga0157373_10030526 | 3300013100 | Bacteria | 3879 |
| 150 | Ga0157373_10462957 | 3300013100 | Bacteria | 913 |
| 151 | Ga0157370_10008703 | 3300013104 | Bacteria | 10922 |
| 152 | Ga0157370_10008884 | 3300013104 | Bacteria | 10799 |
| 153 | Ga0157370_10074275 | 3300013104 | Bacteria | 3207 |
| 154 | Ga0157370_10339226 | 3300013104 | Bacteria | 1385 |
| 155 | Ga0157370_11075063 | 3300013104 | Bacteria | 727 |
| 156 | Ga0157369_10003170 | 3300013105 | Bacteria | 19626 |
| 157 | Ga0157369_10021481 | 3300013105 | Bacteria | 7220 |
| 158 | Ga0157369_10079566 | 3300013105 | Bacteria | 3510 |
| 159 | Ga0157369_10209123 | 3300013105 | Bacteria | 2046 |
| 160 | Ga0157369_10413168 | 3300013105 | Bacteria | 1399 |
| 161 | Ga0157369_10424350 | 3300013105 | Bacteria | 1379 |
| 162 | Ga0157369_10659443 | 3300013105 | Unclassified | 1079 |
| 163 | Ga0157369_10750883 | 3300013105 | Bacteria | 1004 |
| 164 | Ga0157374_10113216 | 3300013296 | Bacteria | 2611 |
| 165 | Ga0157374_11128889 | 3300013296 | Bacteria | 804 |
| 166 | Ga0157374_11854936 | 3300013296 | Bacteria | 628 |
| 167 | Ga0157378_10518701 | 3300013297 | Bacteria | 1193 |
| 168 | Ga0157378_10830372 | 3300013297 | Bacteria | 951 |
| 169 | Ga0157378_12869537 | 3300013297 | Bacteria | 534 |
| 170 | Ga0157372_10064426 | 3300013307 | Bacteria | 4112 |
| 171 | Ga0157372_10080130 | 3300013307 | Bacteria | 3693 |
| 172 | Ga0157372_10205945 | 3300013307 | Bacteria | 2279 |
| 173 | Ga0157372_10534068 | 3300013307 | Bacteria | 1367 |
| 174 | Ga0157372_10917620 | 3300013307 | Bacteria | 1016 |
| 175 | Ga0157372_11165457 | 3300013307 | Bacteria | 891 |
| 176 | Ga0157375_10493086 | 3300013308 | Unclassified | 1389 |
| 177 | Ga0157375_10523948 | 3300013308 | Bacteria | 1348 |
| 178 | Ga0157375_11244684 | 3300013308 | Bacteria | 874 |
| 179 | Ga0157376_10597810 | 3300014969 | Bacteria | 1098 |
| 180 | Ga0157376_11120158 | 3300014969 | Bacteria | 813 |
| 181 | Ga0182006_1174381 | 3300015261 | Bacteria | 719 |
| 182 | Ga0182007_10237935 | 3300015262 | Unclassified | 649 |
| 183 | Ga0197907_10555821 | 3300020069 | Unclassified | 780 |
| 184 | Ga0206356_10199074 | 3300020070 | Bacteria | 536 |
| 185 | Ga0206356_10213960 | 3300020070 | Bacteria | 1565 |
| 186 | Ga0206356_10906256 | 3300020070 | Unclassified | 589 |
| 187 | Ga0206356_11007588 | 3300020070 | Bacteria | 1920 |
| 188 | Ga0206356_11532121 | 3300020070 | Bacteria | 1317 |
| 189 | Ga0206350_11658887 | 3300020080 | Bacteria | 658 |
| 190 | Ga0206354_10372290 | 3300020081 | Unclassified | 773 |
| 191 | Ga0206354_10434998 | 3300020081 | Bacteria | 790 |
| 192 | Ga0206354_10791054 | 3300020081 | Bacteria | 1103 |
| 193 | Ga0206354_11344677 | 3300020081 | Bacteria | 2220 |
| 194 | Ga0206353_10418390 | 3300020082 | Bacteria | 2717 |
| 195 | Ga0206353_10987184 | 3300020082 | Bacteria | 10455 |
| 196 | Ga0206353_11646033 | 3300020082 | Bacteria | 2560 |
| 197 | Ga0206353_11798682 | 3300020082 | Bacteria | 2763 |
| 198 | Ga0206353_11896535 | 3300020082 | Bacteria | 1814 |
| 199 | Ga0213876_10362658 | 3300021384 | Bacteria | 771 |
| 200 | Ga0207692_10135577 | 3300025898 | Unclassified | 1395 |
| 201 | Ga0207692_10643612 | 3300025898 | Bacteria | 684 |
| 202 | Ga0207699_10788796 | 3300025906 | Unclassified | 698 |
| 203 | Ga0207699_10985817 | 3300025906 | Bacteria | 623 |
| 204 | Ga0207705_10061210 | 3300025909 | Bacteria | 2719 |
| 205 | Ga0207705_10086718 | 3300025909 | Bacteria | 2288 |
| 206 | Ga0207705_10168217 | 3300025909 | Bacteria | 1650 |
| 207 | Ga0207705_10176595 | 3300025909 | Bacteria | 1610 |
| 208 | Ga0207705_10261425 | 3300025909 | Bacteria | 1322 |
| 209 | Ga0207654_10653030 | 3300025911 | Bacteria | 753 |
| 210 | Ga0207707_10028530 | 3300025912 | Bacteria | 4878 |
| 211 | Ga0207707_10063643 | 3300025912 | Bacteria | 3210 |
| 212 | Ga0207707_10068650 | 3300025912 | Bacteria | 3089 |
| 213 | Ga0207707_10095190 | 3300025912 | Bacteria | 2603 |
| 214 | Ga0207707_10395371 | 3300025912 | Bacteria | 1187 |
| 215 | Ga0207695_10118469 | 3300025913 | Bacteria | 2619 |
| 216 | Ga0207695_10307743 | 3300025913 | Bacteria | 1475 |
| 217 | Ga0207695_11296545 | 3300025913 | Bacteria | 609 |
| 218 | Ga0207671_10027983 | 3300025914 | Bacteria | 4213 |
| 219 | Ga0207671_10041739 | 3300025914 | Bacteria | 3396 |
| 220 | Ga0207693_10027294 | 3300025915 | Bacteria | 4514 |
| 221 | Ga0207663_10022190 | 3300025916 | Bacteria | 3626 |
| 222 | Ga0207663_10129207 | 3300025916 | Bacteria | 1743 |
| 223 | Ga0207663_10268048 | 3300025916 | Unclassified | 1264 |
| 224 | Ga0207663_10340818 | 3300025916 | Bacteria | 1132 |
| 225 | Ga0207663_11654477 | 3300025916 | Bacteria | 515 |
| 226 | Ga0207660_10033916 | 3300025917 | Bacteria | 3534 |
| 227 | Ga0207660_10073040 | 3300025917 | Bacteria | 2500 |
| 228 | Ga0207660_10123762 | 3300025917 | Bacteria | 1962 |
| 229 | Ga0207660_10157622 | 3300025917 | Bacteria | 1749 |
| 230 | Ga0207660_10242730 | 3300025917 | Bacteria | 1420 |
| 231 | Ga0207660_10472920 | 3300025917 | Bacteria | 1015 |
| 232 | Ga0207660_10871611 | 3300025917 | Bacteria | 735 |
| 233 | Ga0207660_11285700 | 3300025917 | Bacteria | 594 |
| 234 | Ga0207660_11519715 | 3300025917 | Bacteria | 541 |
| 235 | Ga0207657_10000054 | 3300025919 | Bacteria | 106767 |
| 236 | Ga0207657_10000651 | 3300025919 | Bacteria | 36939 |
| 237 | Ga0207657_10026684 | 3300025919 | Bacteria | 5301 |
| 238 | Ga0207657_10094223 | 3300025919 | Bacteria | 2493 |
| 239 | Ga0207657_10617865 | 3300025919 | Bacteria | 845 |
| 240 | Ga0207649_10031801 | 3300025920 | Bacteria | 3140 |
| 241 | Ga0207649_10172831 | 3300025920 | Bacteria | 1506 |
| 242 | Ga0207649_11183285 | 3300025920 | Bacteria | 604 |
| 243 | Ga0207652_10118461 | 3300025921 | Bacteria | 2353 |
| 244 | Ga0207652_10136182 | 3300025921 | Bacteria | 2193 |
| 245 | Ga0207652_10160515 | 3300025921 | Bacteria | 2015 |
| 246 | Ga0207652_10249862 | 3300025921 | Bacteria | 1599 |
| 247 | Ga0207652_10492662 | 3300025921 | Bacteria | 1104 |
| 248 | Ga0207652_10842891 | 3300025921 | Bacteria | 812 |
| 249 | Ga0207652_10939436 | 3300025921 | Bacteria | 762 |
| 250 | Ga0207652_10956839 | 3300025921 | Bacteria | 754 |
| 251 | Ga0207652_11055511 | 3300025921 | Bacteria | 712 |
| 252 | Ga0207652_11172087 | 3300025921 | Bacteria | 670 |
| 253 | Ga0207694_10020090 | 3300025924 | Bacteria | 5052 |
| 254 | Ga0207694_10914020 | 3300025924 | Bacteria | 742 |
| 255 | Ga0207687_10533173 | 3300025927 | Bacteria | 983 |
| 256 | Ga0207687_10870535 | 3300025927 | Bacteria | 770 |
| 257 | Ga0207687_11168188 | 3300025927 | Bacteria | 661 |
| 258 | Ga0207687_11175915 | 3300025927 | Bacteria | 659 |
| 259 | Ga0207700_10031432 | 3300025928 | Bacteria | 3772 |
| 260 | Ga0207700_10472195 | 3300025928 | Bacteria | 1108 |
| 261 | Ga0207700_10709310 | 3300025928 | Bacteria | 898 |
| 262 | Ga0207664_10169838 | 3300025929 | Bacteria | 1866 |
| 263 | Ga0207664_10237926 | 3300025929 | Unclassified | 1585 |
| 264 | Ga0207664_11636295 | 3300025929 | Bacteria | 566 |
| 265 | Ga0207644_10329837 | 3300025931 | Unclassified | 1235 |
| 266 | Ga0207690_10010167 | 3300025932 | Bacteria | 5589 |
| 267 | Ga0207690_10616053 | 3300025932 | Bacteria | 887 |
| 268 | Ga0207706_11673395 | 3300025933 | Unclassified | 513 |
| 269 | Ga0207686_11128603 | 3300025934 | Bacteria | 640 |
| 270 | Ga0207709_11625002 | 3300025935 | Bacteria | 537 |
| 271 | Ga0207665_10525454 | 3300025939 | Bacteria | 917 |
| 272 | Ga0207711_11823254 | 3300025941 | Bacteria | 551 |
| 273 | Ga0207661_10124155 | 3300025944 | Bacteria | 2203 |
| 274 | Ga0207661_10124905 | 3300025944 | Bacteria | 2196 |
| 275 | Ga0207661_10142813 | 3300025944 | Bacteria | 2062 |
| 276 | Ga0207661_10261327 | 3300025944 | Bacteria | 1542 |
| 277 | Ga0207661_10431280 | 3300025944 | Bacteria | 1198 |
| 278 | Ga0207661_10469994 | 3300025944 | Bacteria | 1147 |
| 279 | Ga0207661_10866301 | 3300025944 | Bacteria | 832 |
| 280 | Ga0207667_10080044 | 3300025949 | Bacteria | 3385 |
| 281 | Ga0207667_10143431 | 3300025949 | Bacteria | 2458 |
| 282 | Ga0207667_10705488 | 3300025949 | Unclassified | 1011 |
| 283 | Ga0207667_11158537 | 3300025949 | Bacteria | 754 |
| 284 | Ga0207667_11812059 | 3300025949 | Unclassified | 574 |
| 285 | Ga0207640_10361307 | 3300025981 | Bacteria | 1170 |
| 286 | Ga0207640_10364956 | 3300025981 | Bacteria | 1165 |
| 287 | Ga0207658_10004308 | 3300025986 | Bacteria | 9909 |
| 288 | Ga0207677_10407891 | 3300026023 | Bacteria | 1154 |
| 289 | Ga0207677_10924852 | 3300026023 | Bacteria | 787 |
| 290 | Ga0207703_11452587 | 3300026035 | Bacteria | 660 |
| 291 | Ga0207639_10037935 | 3300026041 | Bacteria | 3582 |
| 292 | Ga0207639_11752269 | 3300026041 | Bacteria | 582 |
| 293 | Ga0207678_10275632 | 3300026067 | Bacteria | 1443 |
| 294 | Ga0207702_10052351 | 3300026078 | Bacteria | 3454 |
| 295 | Ga0207702_10071171 | 3300026078 | Bacteria | 2994 |
| 296 | Ga0207702_11512748 | 3300026078 | Bacteria | 665 |
| 297 | Ga0207702_12472665 | 3300026078 | Bacteria | 506 |
| 298 | Ga0207648_10315305 | 3300026089 | Bacteria | 1404 |
| 299 | Ga0207648_11294753 | 3300026089 | Bacteria | 685 |
| 300 | Ga0207674_10010978 | 3300026116 | Bacteria | 10193 |
| 301 | Ga0207674_10492468 | 3300026116 | Bacteria | 1185 |
| 302 | Ga0207674_11645151 | 3300026116 | Bacteria | 610 |
| 303 | Ga0207683_10377027 | 3300026121 | Unclassified | 1304 |
| 304 | Ga0207698_10116228 | 3300026142 | Bacteria | 2254 |
| 305 | Ga0207698_10225077 | 3300026142 | Bacteria | 1698 |
| 306 | Ga0207698_10228812 | 3300026142 | Bacteria | 1686 |
| 307 | Ga0207698_10436355 | 3300026142 | Bacteria | 1261 |
| 308 | Ga0207698_10690979 | 3300026142 | Bacteria | 1014 |
| 309 | Ga0268266_10115483 | 3300028379 | Bacteria | 2383 |
| 310 | Ga0268266_10933194 | 3300028379 | Bacteria | 840 |
| 311 | Ga0268266_11058210 | 3300028379 | Unclassified | 785 |
| 312 | Ga0268264_10255698 | 3300028381 | Bacteria | 1629 |
| 313 | Ga0265331_10115676 | 3300031250 | Unclassified | 1228 |
| 314 | Ga0265327_10015633 | 3300031251 | Bacteria | 4882 |
| 315 | Ga0307408_100356479 | 3300031548 | Bacteria | 1243 |
| 316 | Ga0307416_101733772 | 3300032002 | Bacteria | 729 |
| 317 | Ga0373944_0006321 | 3300035089 | Bacteria | 3141 |
| 318 | Ga0373944_0043716 | 3300035089 | Bacteria | 1393 |
| 319 | Ga0373936_0008928 | 3300035113 | Bacteria | 3778 |
| 320 | Ga0373936_0300579 | 3300035113 | Unclassified | 724 |
| 321 | Ga0373936_0352033 | 3300035113 | Bacteria | 671 |
| 322 | Ga0373945_0002165 | 3300035116 | Bacteria | 6128 |
| 323 | Ga0373945_0014749 | 3300035116 | Bacteria | 2623 |
| 324 | Ga0373956_0380699 | 3300035119 | Bacteria | 673 |
| 325 | Ga0373957_0051723 | 3300035120 | Bacteria | 1572 |
| 326 | Ga0373943_0000101 | 3300035170 | Bacteria | 31609 |
| 327 | Ga0373943_0002380 | 3300035170 | Bacteria | 8526 |
| 328 | Ga0373943_0019104 | 3300035170 | Bacteria | 3151 |
| 329 | Ga0373946_0089985 | 3300035171 | Bacteria | 1359 |
| 330 | Ga0373946_0494491 | 3300035171 | Bacteria | 627 |
| 331 | Ga0373955_0006377 | 3300035172 | Bacteria | 5376 |
| 332 | Ga0373924_0124279 | 3300035410 | Unclassified | 1121 |
| 333 | Ga0373935_0003186 | 3300035692 | Bacteria | 9463 |
| 334 | Ga0373935_0436657 | 3300035692 | Bacteria | 944 |
| 335 | Ga0373935_0475622 | 3300035692 | Bacteria | 905 |
| 336 | Ga0373927_0078714 | 3300035695 | Bacteria | 2135 |
| 337 | Ga0373927_0104633 | 3300035695 | Bacteria | 1843 |
| 338 | Ga0373927_0817063 | 3300035695 | Bacteria | 616 |
| 339 | Ga0373933_0032010 | 3300035724 | Bacteria | 3055 |
| 340 | Ga0373947_0002740 | 3300035725 | Bacteria | 10558 |
| 341 | Ga0373947_0004984 | 3300035725 | Bacteria | 7772 |
| 342 | Ga0373947_0942873 | 3300035725 | Bacteria | 589 |
| 343 | Ga0373947_1228311 | 3300035725 | Bacteria | 510 |
| 344 | Ga0373925_0001828 | 3300037068 | Bacteria | 17755 |
| 345 | Ga0373925_0010452 | 3300037068 | Bacteria | 6730 |
| 346 | Ga0373925_0019854 | 3300037068 | Bacteria | 4889 |
| 347 | Ga0373925_1033958 | 3300037068 | Bacteria | 676 |
| 348 | Ga0395899_0502132 | 3300037312 | Unclassified | 787 |
| 349 | Ga0395900_0062931 | 3300037418 | Bacteria | 3813 |
| 350 | Ga0395900_0118840 | 3300037418 | Bacteria | 2713 |
| 351 | Ga0395900_0469456 | 3300037418 | Bacteria | 1212 |
| 352 | Ga0395900_0675402 | 3300037418 | Bacteria | 968 |
| 353 | Ga0395900_1046062 | 3300037418 | Bacteria | 735 |
| 354 | Ga0395900_1455836 | 3300037418 | Bacteria | 597 |
| 355 | Ga0395898_0001509 | 3300037466 | Bacteria | 32076 |
| 356 | Ga0395898_0007850 | 3300037466 | Bacteria | 11324 |
| 357 | Ga0395898_0342362 | 3300037466 | Bacteria | 1426 |
| 358 | Ga0395898_0349215 | 3300037466 | Bacteria | 1411 |
| 359 | Ga0395898_0493331 | 3300037466 | Bacteria | 1165 |
| 360 | Ga0395898_0944284 | 3300037466 | Bacteria | 800 |
| 361 | Ga0395905_0106669 | 3300037471 | Bacteria | 2630 |
| 362 | Ga0395901_0001414 | 3300038443 | Bacteria | 25054 |
| 363 | Ga0395901_0022116 | 3300038443 | Bacteria | 6515 |
| 364 | Ga0395901_0111813 | 3300038443 | Bacteria | 2869 |
| 365 | Ga0395901_0128104 | 3300038443 | Bacteria | 2668 |
| 366 | Ga0395901_0248383 | 3300038443 | Bacteria | 1854 |
| 367 | Ga0395901_0656177 | 3300038443 | Unclassified | 1052 |
| 368 | Ga0395901_0713905 | 3300038443 | Bacteria | 999 |
| 369 | Ga0395901_0780048 | 3300038443 | Bacteria | 946 |
| 370 | Ga0436365_1571369 | 3300039437 | Bacteria | 894 |
| 371 | Ga0436363_0074777 | 3300039450 | Bacteria | 515 |
| 372 | Ga0436363_1532817 | 3300039450 | Bacteria | 632 |
| 373 | Ga0451800_0466089 | 3300041459 | Bacteria | 612 |
| 374 | Ga0451845_0612332 | 3300041501 | Bacteria | 719 |
| 375 | Ga0451853_2492716 | 3300041512 | Bacteria | 1402 |
| 376 | Ga0439448_0156574 | 3300042005 | Bacteria | 792 |
| 377 | Ga0439454_084621 | 3300042011 | Unclassified | 579 |
| 378 | Ga0466965_0106994 | 3300044683 | Bacteria | 1435 |
| 379 | Ga0466966_0002588 | 3300044684 | Bacteria | 11853 |
| 380 | Ga0466966_0032731 | 3300044684 | Bacteria | 3367 |
| 381 | Ga0466963_0001732 | 3300044694 | Bacteria | 11878 |
| 382 | Ga0466963_0023591 | 3300044694 | Bacteria | 3909 |
| 383 | Ga0466963_0123435 | 3300044694 | Bacteria | 1784 |
| 384 | Ga0466963_0664204 | 3300044694 | Bacteria | 736 |
| 385 | Ga0466964_0004414 | 3300044706 | Bacteria | 5193 |
| 386 | Ga0466964_0105488 | 3300044706 | Bacteria | 1249 |
| 387 | Ga0466957_0505265 | 3300044842 | Bacteria | 838 |
| 388 | Ga0466959_0015352 | 3300045049 | Bacteria | 5577 |
| 389 | Ga0466959_0060933 | 3300045049 | Bacteria | 2745 |
| 390 | Ga0466959_0721938 | 3300045049 | Bacteria | 667 |
| 391 | Ga0466958_0667679 | 3300045836 | Bacteria | 677 |
| 392 | Ga0466958_0705546 | 3300045836 | Bacteria | 657 |
| 393 | Ga0466958_1008525 | 3300045836 | Bacteria | 543 |
| 394 | Ga0466967_0007258 | 3300045976 | Bacteria | 7971 |
| 395 | Ga0466967_0032999 | 3300045976 | Bacteria | 4378 |
| 396 | Ga0466967_0044604 | 3300045976 | Bacteria | 3847 |
| 397 | Ga0466967_0084219 | 3300045976 | Bacteria | 2877 |
| 398 | Ga0466967_0231194 | 3300045976 | Unclassified | 1761 |
| 399 | Ga0466967_0614351 | 3300045976 | Bacteria | 1073 |
| 400 | Ga0466967_1037078 | 3300045976 | Bacteria | 817 |
| 401 | Ga0495592_0067449 | 3300046454 | Bacteria | 2615 |
| 402 | Ga0495603_0102425 | 3300046455 | Bacteria | 1671 |
| 403 | Ga0495629_0000670 | 3300046459 | Bacteria | 27725 |
| 404 | Ga0495629_0189887 | 3300046459 | Bacteria | 1422 |
| 405 | Ga0495629_1071416 | 3300046459 | Unclassified | 522 |
| 406 | Ga0495641_0000374 | 3300046461 | Bacteria | 37120 |
| 407 | Ga0495641_0208812 | 3300046461 | Bacteria | 875 |
| 408 | Ga0495651_0004871 | 3300046462 | Bacteria | 10268 |
| 409 | Ga0495651_0022109 | 3300046462 | Bacteria | 4944 |
| 410 | Ga0495651_0191781 | 3300046462 | Bacteria | 1437 |
| 411 | Ga0495653_0011141 | 3300046463 | Bacteria | 7354 |
| 412 | Ga0495653_0039537 | 3300046463 | Bacteria | 3694 |
| 413 | Ga0495653_0064886 | 3300046463 | Bacteria | 2750 |
| 414 | Ga0495580_0387117 | 3300046472 | Bacteria | 944 |
| 415 | Ga0495582_0000124 | 3300046473 | Bacteria | 41197 |
| 416 | Ga0495582_0579476 | 3300046473 | Bacteria | 649 |
| 417 | Ga0495639_0000658 | 3300046475 | Bacteria | 15965 |
| 418 | Ga0495662_0000898 | 3300046476 | Bacteria | 14537 |
| 419 | Ga0495662_0031320 | 3300046476 | Bacteria | 2569 |
| 420 | Ga0495664_0033006 | 3300046477 | Bacteria | 3041 |
| 421 | Ga0495664_0070584 | 3300046477 | Bacteria | 2086 |
| 422 | Ga0495596_0071042 | 3300046500 | Bacteria | 1352 |
| 423 | Ga0495608_0005935 | 3300046511 | Bacteria | 8686 |
| 424 | Ga0495608_0038097 | 3300046511 | Bacteria | 3231 |
| 425 | Ga0495608_0050740 | 3300046511 | Bacteria | 2752 |
| 426 | Ga0495618_0053992 | 3300046514 | Bacteria | 2541 |
| 427 | Ga0495618_0201734 | 3300046514 | Bacteria | 1259 |
| 428 | Ga0495628_0916762 | 3300046516 | Unclassified | 607 |
| 429 | Ga0495630_0007417 | 3300046517 | Bacteria | 7836 |
| 430 | Ga0495630_0021732 | 3300046517 | Bacteria | 4738 |
| 431 | Ga0495630_0022236 | 3300046517 | Bacteria | 4686 |
| 432 | Ga0495630_0059166 | 3300046517 | Bacteria | 2874 |
| 433 | Ga0495630_0354178 | 3300046517 | Bacteria | 1123 |
| 434 | Ga0495666_0030819 | 3300046526 | Bacteria | 2630 |
| 435 | Ga0495666_0487786 | 3300046526 | Bacteria | 551 |
| 436 | Ga0495652_0026278 | 3300046529 | Bacteria | 5144 |
| 437 | Ga0495652_0370780 | 3300046529 | Bacteria | 1020 |
| 438 | Ga0495665_0000249 | 3300046531 | Bacteria | 27073 |
| 439 | Ga0495665_0361968 | 3300046531 | Unclassified | 738 |
| 440 | Ga0495640_0019459 | 3300046533 | Bacteria | 5010 |
| 441 | Ga0495640_0023042 | 3300046533 | Bacteria | 4546 |
| 442 | Ga0495640_0080149 | 3300046533 | Bacteria | 2172 |
| 443 | Ga0495586_0039208 | 3300046535 | Unclassified | 2546 |
| 444 | Ga0495587_0006779 | 3300046536 | Bacteria | 7455 |
| 445 | Ga0495587_0341912 | 3300046536 | Bacteria | 835 |
| 446 | Ga0495587_0641130 | 3300046536 | Bacteria | 584 |
| 447 | Ga0495645_0015115 | 3300046543 | Bacteria | 5487 |
| 448 | Ga0495645_0046298 | 3300046543 | Bacteria | 3170 |
| 449 | Ga0495667_0012696 | 3300046559 | Bacteria | 5710 |
| 450 | Ga0495667_0030058 | 3300046559 | Bacteria | 3653 |
| 451 | Ga0495668_0474100 | 3300046616 | Unclassified | 689 |
| 452 | Ga0495634_0038440 | 3300046642 | Bacteria | 3263 |
| 453 | Ga0495634_0110312 | 3300046642 | Bacteria | 1769 |
| 454 | Ga0495634_0329186 | 3300046642 | Bacteria | 918 |
| 455 | Ga0495635_0009732 | 3300046663 | Bacteria | 6719 |
| 456 | Ga0495635_0012567 | 3300046663 | Bacteria | 5934 |
| 457 | Ga0495635_0126029 | 3300046663 | Bacteria | 1746 |
| 458 | Ga0495657_0035371 | 3300046675 | Bacteria | 3462 |
| 459 | Ga0495657_0108190 | 3300046675 | Bacteria | 1764 |
| 460 | Ga0495657_0110282 | 3300046675 | Bacteria | 1744 |
| 461 | Ga0495599_0009819 | 3300046678 | Bacteria | 5857 |
| 462 | Ga0495599_0322865 | 3300046678 | Unclassified | 929 |
| 463 | Ga0495623_0005346 | 3300046679 | Bacteria | 8407 |
| 464 | Ga0495646_0112052 | 3300046680 | Bacteria | 1552 |
| 465 | Ga0495646_0305794 | 3300046680 | Unclassified | 840 |
| 466 | Ga0495647_0000689 | 3300046681 | Bacteria | 10082 |
| 467 | Ga0495647_0601682 | 3300046681 | Unclassified | 516 |
| 468 | Ga0495658_0000247 | 3300046683 | Bacteria | 30977 |
| 469 | Ga0495658_0029776 | 3300046683 | Bacteria | 2958 |
| 470 | Ga0495613_0001393 | 3300046689 | Bacteria | 18401 |
| 471 | Ga0495613_0388861 | 3300046689 | Bacteria | 953 |
| 472 | Ga0495624_0045682 | 3300046690 | Bacteria | 2787 |
| 473 | Ga0495624_0144487 | 3300046690 | Bacteria | 1456 |
| 474 | Ga0495589_0274977 | 3300046794 | Unclassified | 784 |
| 475 | Ga0495600_0017263 | 3300046809 | Bacteria | 4588 |
| 476 | Ga0495600_0398876 | 3300046809 | Bacteria | 856 |
| 477 | Ga0495581_0004417 | 3300047315 | Bacteria | 8130 |
| 478 | Ga0495604_0014213 | 3300047317 | Bacteria | 6345 |
| 479 | Ga0495604_0096373 | 3300047317 | Bacteria | 2183 |
| 480 | Ga0495604_0340699 | 3300047317 | Bacteria | 998 |
| 481 | Ga0495674_0003941 | 3300047319 | Bacteria | 14400 |
| 482 | Ga0495674_0011930 | 3300047319 | Bacteria | 8194 |
| 483 | Ga0495674_0192128 | 3300047319 | Bacteria | 1696 |
| 484 | Ga0495676_0001077 | 3300047321 | Bacteria | 23118 |
| 485 | Ga0495676_0296886 | 3300047321 | Bacteria | 1090 |
| 486 | Ga0495676_0493381 | 3300047321 | Unclassified | 804 |
| 487 | Ga0495680_0003365 | 3300047322 | Bacteria | 15791 |
| 488 | Ga0495680_0013880 | 3300047322 | Bacteria | 7008 |
| 489 | Ga0495675_0000878 | 3300047444 | Bacteria | 18381 |
| 490 | Ga0495684_0001855 | 3300047471 | Bacteria | 16919 |
| 491 | Ga0495684_0036467 | 3300047471 | Bacteria | 3769 |
| 492 | Ga0495593_0039086 | 3300047673 | Bacteria | 2560 |
| 493 | Ga0495602_0028925 | 3300048088 | Bacteria | 5294 |
| 494 | Ga0495602_0283502 | 3300048088 | Bacteria | 1219 |
| 495 | Ga0495602_0628722 | 3300048088 | Bacteria | 735 |
| 496 | Ga0495614_0009511 | 3300048089 | Bacteria | 4297 |
| 497 | Ga0496100_0004628 | 3300048903 | Bacteria | 7318 |
| 498 | Ga0496100_0064529 | 3300048903 | Bacteria | 2424 |
| 499 | Ga0496100_0074714 | 3300048903 | Bacteria | 2271 |
| 500 | Ga0496100_1455474 | 3300048903 | Unclassified | 541 |
| 501 | Ga0496101_0009476 | 3300048904 | Bacteria | 6401 |
| 502 | Ga0496101_0018810 | 3300048904 | Bacteria | 4704 |
| 503 | Ga0496101_0071677 | 3300048904 | Bacteria | 2540 |
| 504 | Ga0496101_0159973 | 3300048904 | Bacteria | 1727 |
| 505 | Ga0496101_0272957 | 3300048904 | Bacteria | 1320 |
| 506 | Ga0496102_0009451 | 3300048905 | Bacteria | 8378 |
| 507 | Ga0496102_0019849 | 3300048905 | Bacteria | 5926 |
| 508 | Ga0496102_0275326 | 3300048905 | Bacteria | 1586 |
| 509 | Ga0496103_0053451 | 3300048906 | Bacteria | 2503 |
| 510 | Ga0496103_0544672 | 3300048906 | Unclassified | 741 |
| 511 | Ga0496103_0781227 | 3300048906 | Bacteria | 603 |
| 512 | Ga0496104_0026632 | 3300048907 | Bacteria | 5342 |
| 513 | Ga0496104_0047678 | 3300048907 | Bacteria | 4038 |
| 514 | Ga0496104_0050582 | 3300048907 | Bacteria | 3921 |
| 515 | Ga0496104_1611585 | 3300048907 | Bacteria | 552 |
| 516 | Ga0496105_0002629 | 3300048908 | Bacteria | 13070 |
| 517 | Ga0496105_0052163 | 3300048908 | Bacteria | 3377 |
| 518 | Ga0496105_0128549 | 3300048908 | Bacteria | 2089 |
| 519 | Ga0496106_0011636 | 3300048909 | Bacteria | 6504 |
| 520 | Ga0496106_0947980 | 3300048909 | Unclassified | 678 |
| 521 | Ga0496107_0006368 | 3300048910 | Bacteria | 8115 |
| 522 | Ga0496107_0075266 | 3300048910 | Bacteria | 2457 |
| 523 | Ga0496107_0339223 | 3300048910 | Bacteria | 1118 |
| 524 | Ga0496107_0699935 | 3300048910 | Unclassified | 745 |
| 525 | Ga0496108_0002961 | 3300048911 | Bacteria | 13659 |
| 526 | Ga0496108_0836217 | 3300048911 | Unclassified | 793 |
| 527 | Ga0496108_0977330 | 3300048911 | Unclassified | 724 |
| 528 | Ga0496109_0002273 | 3300048912 | Bacteria | 15968 |
| 529 | Ga0496109_0012523 | 3300048912 | Bacteria | 7322 |
| 530 | Ga0496109_1191901 | 3300048912 | Unclassified | 698 |
| 531 | Ga0496109_2005747 | 3300048912 | Unclassified | 511 |
| 532 | Ga0496110_0030477 | 3300048913 | Bacteria | 4650 |
| 533 | Ga0496110_0076879 | 3300048913 | Bacteria | 2969 |
| 534 | Ga0496110_0208041 | 3300048913 | Bacteria | 1778 |
| 535 | Ga0496110_0398523 | 3300048913 | Bacteria | 1255 |
| 536 | Ga0496111_0008543 | 3300048914 | Bacteria | 6785 |
| 537 | Ga0496111_0221288 | 3300048914 | Bacteria | 1406 |
| 538 | Ga0496111_0780321 | 3300048914 | Unclassified | 692 |
| 539 | Ga0496112_0006274 | 3300048915 | Bacteria | 10426 |
| 540 | Ga0496112_0010827 | 3300048915 | Bacteria | 8297 |
| 541 | Ga0496112_0026439 | 3300048915 | Bacteria | 5584 |
| 542 | Ga0496112_0101324 | 3300048915 | Bacteria | 2850 |
| 543 | Ga0496112_0177088 | 3300048915 | Bacteria | 2097 |
| 544 | Ga0496112_1450759 | 3300048915 | Bacteria | 600 |
| 545 | Ga0496113_0010642 | 3300048916 | Bacteria | 6091 |
| 546 | Ga0496113_0275258 | 3300048916 | Bacteria | 1346 |
| 547 | Ga0496114_0012160 | 3300048917 | Bacteria | 6888 |
| 548 | Ga0496114_0024496 | 3300048917 | Bacteria | 4927 |
| 549 | Ga0496114_0025411 | 3300048917 | Bacteria | 4841 |
| 550 | Ga0496114_0627563 | 3300048917 | Bacteria | 946 |
| 551 | Ga0496114_0859215 | 3300048917 | Bacteria | 788 |
| 552 | Ga0496114_0980489 | 3300048917 | Bacteria | 728 |
| 553 | Ga0496114_1255216 | 3300048917 | Bacteria | 627 |
| 554 | Ga0496115_0002513 | 3300048918 | Bacteria | 13172 |
| 555 | Ga0496115_0018662 | 3300048918 | Bacteria | 5331 |
| 556 | Ga0496115_0113212 | 3300048918 | Bacteria | 2229 |
| 557 | Ga0496115_0240251 | 3300048918 | Bacteria | 1493 |
| 558 | Ga0496115_0283249 | 3300048918 | Bacteria | 1360 |
| 559 | Ga0496115_1201506 | 3300048918 | Bacteria | 570 |
| 560 | Ga0496115_1395858 | 3300048918 | Unclassified | 517 |
| 561 | Ga0501034_0347104 | 3300049571 | Bacteria | 1413 |
| 562 | Ga0501043_1272013 | 3300049579 | Bacteria | 514 |
| 563 | Ga0501046_0525474 | 3300049580 | Bacteria | 846 |
| 564 | Ga0501046_0574867 | 3300049580 | Bacteria | 801 |
| 565 | Ga0501047_0030664 | 3300049581 | Bacteria | 5183 |
| 566 | Ga0501047_0897287 | 3300049581 | Bacteria | 700 |
| 567 | Ga0501067_0025573 | 3300049583 | Bacteria | 3272 |
| 568 | Ga0501067_0251661 | 3300049583 | Bacteria | 983 |
| 569 | Ga0501069_0212710 | 3300049585 | Bacteria | 1122 |
| 570 | Ga0501069_0548386 | 3300049585 | Bacteria | 692 |
| 571 | Ga0501070_0014526 | 3300049586 | Bacteria | 6625 |
| 572 | Ga0501070_0104456 | 3300049586 | Bacteria | 2342 |
| 573 | Ga0501070_0199843 | 3300049586 | Bacteria | 1642 |
| 574 | Ga0501072_0006239 | 3300049588 | Bacteria | 9084 |
| 575 | Ga0501073_0179515 | 3300049589 | Bacteria | 1465 |
| 576 | Ga0501073_0225181 | 3300049589 | Bacteria | 1295 |
| 577 | Ga0501074_0005182 | 3300049590 | Bacteria | 9364 |
| 578 | Ga0501074_0006294 | 3300049590 | Bacteria | 8572 |
| 579 | Ga0501074_0104417 | 3300049590 | Bacteria | 2028 |
| 580 | Ga0501074_0432978 | 3300049590 | Bacteria | 933 |
| 581 | Ga0501076_0558754 | 3300049592 | Unclassified | 944 |
| 582 | Ga0501077_0512456 | 3300049593 | Bacteria | 769 |
| 583 | Ga0501079_0027091 | 3300049741 | Bacteria | 4393 |
| 584 | Ga0501079_0563910 | 3300049741 | Bacteria | 896 |
| 585 | Ga0501079_1488724 | 3300049741 | Bacteria | 532 |
| 586 | Ga0501080_0021753 | 3300049742 | Bacteria | 5941 |
| 587 | Ga0501080_0318824 | 3300049742 | Bacteria | 1407 |
| 588 | Ga0501083_0005259 | 3300049744 | Bacteria | 9155 |
| 589 | Ga0501083_0844146 | 3300049744 | Bacteria | 596 |
| 590 | Ga0501035_0909263 | 3300049822 | Bacteria | 697 |
| 591 | Ga0501044_0584492 | 3300049823 | Bacteria | 1011 |
| 592 | nmdc:mga05p37_8824_c2 | 3300050507 | Bacteria | 4147 |
| 593 | nmdc:mga09592_766456_c1 | 3300050508 | Bacteria | 818 |
| 594 | nmdc:mga06r32_119589_c1 | 3300050510 | Bacteria | 2597 |
| 595 | nmdc:mga0n895_54375_c1 | 3300050512 | Bacteria | 3938 |
| 596 | nmdc:mga0rr50_21866_c1 | 3300050513 | Bacteria | 4377 |
| 597 | nmdc:mga0a205_33711_c2 | 3300050515 | Bacteria | 2166 |
| 598 | Ga0495601_0010350 | 3300053077 | Bacteria | 5548 |
| 599 | Ga0495601_0093841 | 3300053077 | Bacteria | 1933 |
| 600 | Ga0495601_0720095 | 3300053077 | Bacteria | 636 |
| 601 | Ga0495612_0050027 | 3300053078 | Bacteria | 1716 |
| 602 | Ga0495612_0172221 | 3300053078 | Bacteria | 948 |
| 603 | Ga0495595_0004822 | 3300053084 | Bacteria | 5431 |
| 604 | Ga0495595_0008213 | 3300053084 | Bacteria | 4285 |
| 605 | Ga0495595_0209849 | 3300053084 | Bacteria | 970 |
| 606 | Ga0495619_0002878 | 3300053085 | Bacteria | 11188 |
| 607 | Ga0495619_0004757 | 3300053085 | Bacteria | 8632 |
| 608 | Ga0495619_0005166 | 3300053085 | Bacteria | 8284 |
| 609 | Ga0495619_0587620 | 3300053085 | Unclassified | 762 |
| 610 | Ga0501084_0204316 | 3300054114 | Bacteria | 1667 |
| 611 | Ga0587091_184499 | 3300059511 | Bacteria | 551 |
| 612 | Ga0466962_0152859 | 3300061719 | Bacteria | 1120 |
| 613 | Ga0466962_0598635 | 3300061719 | Bacteria | 562 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005843 | Ga0068860_100924557 | Ga0068860_1009245572 | 76 |
| 2 | 3300028381 | Ga0268264_10255698 | Ga0268264_102556982 | 76 |
| 3 | 3300025935 | Ga0207709_11625002 | Ga0207709_116250022 | 78 |
| 4 | 3300026089 | Ga0207648_10315305 | Ga0207648_103153052 | 78 |
| 5 | 3300009553 | Ga0105249_10042223 | Ga0105249_100422234 | 85 |
| 6 | 3300026116 | Ga0207674_11645151 | Ga0207674_116451512 | 85 |
| 7 | 3300005439 | Ga0070711_100492029 | Ga0070711_1004920292 | 87 |
| 8 | 3300005546 | Ga0070696_100160715 | Ga0070696_1001607151 | 87 |
| 9 | 3300009098 | Ga0105245_10005489 | Ga0105245_1000548910 | 87 |
| 10 | 3300010375 | Ga0105239_10066207 | Ga0105239_100662073 | 87 |
| 11 | 3300013297 | Ga0157378_10518701 | Ga0157378_105187012 | 87 |
| 12 | 3300025916 | Ga0207663_10268048 | Ga0207663_102680482 | 87 |
| 13 | 3300037418 | Ga0395900_0469456 | Ga0395900_0469456_282_590 | 87 |
| 14 | 3300037466 | Ga0395898_0342362 | Ga0395898_0342362_956_1264 | 87 |
| 15 | 3300025898 | Ga0207692_10135577 | Ga0207692_101355772 | 88 |
| 16 | 3300038443 | Ga0395901_0713905 | Ga0395901_0713905_56_361 | 89 |
| 17 | 3300013104 | Ga0157370_11075063 | Ga0157370_110750632 | 92 |
| 18 | 3300035692 | Ga0373935_0475622 | Ga0373935_0475622_80_364 | 92 |
| 19 | 3300038443 | Ga0395901_0248383 | Ga0395901_0248383_1228_1512 | 92 |
| 20 | 3300046473 | Ga0495582_0579476 | Ga0495582_0579476_211_495 | 92 |
| 21 | 3300046533 | Ga0495640_0080149 | Ga0495640_0080149_1816_2094 | 92 |
| 22 | 3300046535 | Ga0495586_0039208 | Ga0495586_0039208_1686_1970 | 92 |
| 23 | 3300047319 | Ga0495674_0011930 | Ga0495674_0011930_359_643 | 92 |
| 24 | 3300048910 | Ga0496107_0699935 | Ga0496107_0699935_295_579 | 92 |
| 25 | 3300048914 | Ga0496111_0780321 | Ga0496111_0780321_138_422 | 92 |
| 26 | 3300053085 | Ga0495619_0587620 | Ga0495619_0587620_218_502 | 92 |
| 27 | 3300046455 | Ga0495603_0102425 | Ga0495603_0102425_1373_1657 | 94 |
| 28 | 3300045836 | Ga0466958_1008525 | Ga0466958_1008525_221_526 | 96 |
| 29 | 3300005981 | Ga0081538_10010466 | Ga0081538_100104665 | 98 |
| 30 | 3300042011 | Ga0439454_084621 | Ga0439454_084621_135_440 | 98 |
| 31 | 3300009551 | Ga0105238_11941955 | Ga0105238_119419551 | 99 |
| 32 | 3300025932 | Ga0207690_10616053 | Ga0207690_106160532 | 99 |
| 33 | 3300035113 | Ga0373936_0008928 | Ga0373936_0008928_2939_3244 | 99 |
| 34 | 3300035116 | Ga0373945_0014749 | Ga0373945_0014749_1804_2109 | 99 |
| 35 | 3300035170 | Ga0373943_0002380 | Ga0373943_0002380_6218_6523 | 99 |
| 36 | 3300035171 | Ga0373946_0494491 | Ga0373946_0494491_241_546 | 99 |
| 37 | 3300037068 | Ga0373925_0010452 | Ga0373925_0010452_6044_6349 | 99 |
| 38 | 3300037418 | Ga0395900_0118840 | Ga0395900_0118840_2203_2508 | 99 |
| 39 | 3300037466 | Ga0395898_0493331 | Ga0395898_0493331_42_347 | 99 |
| 40 | 3300046517 | Ga0495630_0022236 | Ga0495630_0022236_1364_1669 | 99 |
| 41 | 3300046683 | Ga0495658_0029776 | Ga0495658_0029776_2142_2447 | 99 |
| 42 | 3300047321 | Ga0495676_0296886 | Ga0495676_0296886_763_1068 | 99 |
| 43 | 3300005337 | Ga0070682_101316934 | Ga0070682_1013169341 | 100 |
| 44 | 3300006844 | Ga0075428_100009861 | Ga0075428_10000986117 | 100 |
| 45 | 3300006847 | Ga0075431_101075308 | Ga0075431_1010753082 | 100 |
| 46 | 3300006880 | Ga0075429_100839573 | Ga0075429_1008395731 | 100 |
| 47 | 3300009094 | Ga0111539_10482426 | Ga0111539_104824263 | 100 |
| 48 | 3300009147 | Ga0114129_10005334 | Ga0114129_1000533416 | 100 |
| 49 | 3300039450 | Ga0436363_1532817 | Ga0436363_1532817_138_446 | 100 |
| 50 | 3300046500 | Ga0495596_0071042 | Ga0495596_0071042_680_991 | 100 |
| 51 | 3300046616 | Ga0495668_0474100 | Ga0495668_0474100_213_524 | 100 |
| 52 | 3300046794 | Ga0495589_0274977 | Ga0495589_0274977_298_609 | 100 |
| 53 | 3300048903 | Ga0496100_1455474 | Ga0496100_1455474_105_413 | 100 |
| 54 | 3300048907 | Ga0496104_1611585 | Ga0496104_1611585_179_487 | 100 |
| 55 | 3300048911 | Ga0496108_0836217 | Ga0496108_0836217_37_345 | 100 |
| 56 | 3300048913 | Ga0496110_0208041 | Ga0496110_0208041_47_355 | 100 |
| 57 | 3300050507 | nmdc:mga05p37_8824_c2 | nmdc:mga05p37_8824_c2_2327_2635 | 100 |
| 58 | 3300050508 | nmdc:mga09592_766456_c1 | nmdc:mga09592_766456_c1_457_765 | 100 |
| 59 | 3300050510 | nmdc:mga06r32_119589_c1 | nmdc:mga06r32_119589_c1_130_438 | 100 |
| 60 | 3300005327 | Ga0070658_10787730 | Ga0070658_107877301 | 101 |
| 61 | 3300005327 | Ga0070658_10800708 | Ga0070658_108007082 | 101 |
| 62 | 3300005329 | Ga0070683_100005942 | Ga0070683_1000059425 | 101 |
| 63 | 3300005329 | Ga0070683_100015866 | Ga0070683_1000158664 | 101 |
| 64 | 3300005329 | Ga0070683_100148123 | Ga0070683_1001481232 | 101 |
| 65 | 3300005336 | Ga0070680_100030616 | Ga0070680_1000306164 | 101 |
| 66 | 3300005336 | Ga0070680_100055832 | Ga0070680_1000558324 | 101 |
| 67 | 3300005336 | Ga0070680_100073546 | Ga0070680_1000735463 | 101 |
| 68 | 3300005336 | Ga0070680_100128359 | Ga0070680_1001283592 | 101 |
| 69 | 3300005336 | Ga0070680_100784792 | Ga0070680_1007847922 | 101 |
| 70 | 3300005336 | Ga0070680_101741879 | Ga0070680_1017418792 | 101 |
| 71 | 3300005337 | Ga0070682_100261389 | Ga0070682_1002613892 | 101 |
| 72 | 3300005337 | Ga0070682_100269637 | Ga0070682_1002696372 | 101 |
| 73 | 3300005337 | Ga0070682_101285878 | Ga0070682_1012858781 | 101 |
| 74 | 3300005338 | Ga0068868_100101893 | Ga0068868_1001018932 | 101 |
| 75 | 3300005338 | Ga0068868_101136974 | Ga0068868_1011369742 | 101 |
| 76 | 3300005339 | Ga0070660_100001517 | Ga0070660_10000151710 | 101 |
| 77 | 3300005339 | Ga0070660_100050981 | Ga0070660_1000509813 | 101 |
| 78 | 3300005339 | Ga0070660_100063653 | Ga0070660_1000636532 | 101 |
| 79 | 3300005339 | Ga0070660_100143568 | Ga0070660_1001435683 | 101 |
| 80 | 3300005339 | Ga0070660_100246169 | Ga0070660_1002461692 | 101 |
| 81 | 3300005339 | Ga0070660_100292186 | Ga0070660_1002921862 | 101 |
| 82 | 3300005339 | Ga0070660_101702169 | Ga0070660_1017021692 | 101 |
| 83 | 3300005344 | Ga0070661_100024554 | Ga0070661_1000245543 | 101 |
| 84 | 3300005344 | Ga0070661_100167688 | Ga0070661_1001676882 | 101 |
| 85 | 3300005344 | Ga0070661_100187106 | Ga0070661_1001871062 | 101 |
| 86 | 3300005344 | Ga0070661_100506130 | Ga0070661_1005061302 | 101 |
| 87 | 3300005355 | Ga0070671_100267088 | Ga0070671_1002670882 | 101 |
| 88 | 3300005366 | Ga0070659_100051475 | Ga0070659_1000514752 | 101 |
| 89 | 3300005366 | Ga0070659_101850487 | Ga0070659_1018504871 | 101 |
| 90 | 3300005367 | Ga0070667_100003011 | Ga0070667_10000301118 | 101 |
| 91 | 3300005434 | Ga0070709_10714107 | Ga0070709_107141072 | 101 |
| 92 | 3300005435 | Ga0070714_100158768 | Ga0070714_1001587682 | 101 |
| 93 | 3300005435 | Ga0070714_100433353 | Ga0070714_1004333532 | 101 |
| 94 | 3300005435 | Ga0070714_100829828 | Ga0070714_1008298282 | 101 |
| 95 | 3300005436 | Ga0070713_100056890 | Ga0070713_1000568902 | 101 |
| 96 | 3300005437 | Ga0070710_10087831 | Ga0070710_100878312 | 101 |
| 97 | 3300005437 | Ga0070710_10252161 | Ga0070710_102521612 | 101 |
| 98 | 3300005439 | Ga0070711_100034309 | Ga0070711_1000343094 | 101 |
| 99 | 3300005439 | Ga0070711_100147974 | Ga0070711_1001479742 | 101 |
| 100 | 3300005439 | Ga0070711_100434499 | Ga0070711_1004344992 | 101 |
| 101 | 3300005445 | Ga0070708_100428798 | Ga0070708_1004287982 | 101 |
| 102 | 3300005445 | Ga0070708_101592164 | Ga0070708_1015921641 | 101 |
| 103 | 3300005455 | Ga0070663_101431074 | Ga0070663_1014310742 | 101 |
| 104 | 3300005456 | Ga0070678_100372555 | Ga0070678_1003725552 | 101 |
| 105 | 3300005458 | Ga0070681_10013809 | Ga0070681_100138093 | 101 |
| 106 | 3300005458 | Ga0070681_10042506 | Ga0070681_100425061 | 101 |
| 107 | 3300005458 | Ga0070681_10099693 | Ga0070681_100996932 | 101 |
| 108 | 3300005458 | Ga0070681_10128982 | Ga0070681_101289822 | 101 |
| 109 | 3300005458 | Ga0070681_10165454 | Ga0070681_101654542 | 101 |
| 110 | 3300005458 | Ga0070681_10499280 | Ga0070681_104992801 | 101 |
| 111 | 3300005458 | Ga0070681_11244594 | Ga0070681_112445942 | 101 |
| 112 | 3300005459 | Ga0068867_101619874 | Ga0068867_1016198741 | 101 |
| 113 | 3300005530 | Ga0070679_100036130 | Ga0070679_1000361303 | 101 |
| 114 | 3300005530 | Ga0070679_100043391 | Ga0070679_1000433913 | 101 |
| 115 | 3300005530 | Ga0070679_100048602 | Ga0070679_1000486022 | 101 |
| 116 | 3300005530 | Ga0070679_100112087 | Ga0070679_1001120874 | 101 |
| 117 | 3300005530 | Ga0070679_100213535 | Ga0070679_1002135352 | 101 |
| 118 | 3300005530 | Ga0070679_100233060 | Ga0070679_1002330603 | 101 |
| 119 | 3300005530 | Ga0070679_100256877 | Ga0070679_1002568772 | 101 |
| 120 | 3300005530 | Ga0070679_100505694 | Ga0070679_1005056942 | 101 |
| 121 | 3300005530 | Ga0070679_100654073 | Ga0070679_1006540732 | 101 |
| 122 | 3300005530 | Ga0070679_100711502 | Ga0070679_1007115022 | 101 |
| 123 | 3300005530 | Ga0070679_101601338 | Ga0070679_1016013382 | 101 |
| 124 | 3300005530 | Ga0070679_102025127 | Ga0070679_1020251271 | 101 |
| 125 | 3300005535 | Ga0070684_100030060 | Ga0070684_1000300603 | 101 |
| 126 | 3300005535 | Ga0070684_100060050 | Ga0070684_1000600504 | 101 |
| 127 | 3300005535 | Ga0070684_100105016 | Ga0070684_1001050162 | 101 |
| 128 | 3300005535 | Ga0070684_100111559 | Ga0070684_1001115592 | 101 |
| 129 | 3300005535 | Ga0070684_100403480 | Ga0070684_1004034802 | 101 |
| 130 | 3300005535 | Ga0070684_100671593 | Ga0070684_1006715932 | 101 |
| 131 | 3300005536 | Ga0070697_100855287 | Ga0070697_1008552871 | 101 |
| 132 | 3300005539 | Ga0068853_100055073 | Ga0068853_1000550732 | 101 |
| 133 | 3300005539 | Ga0068853_100250115 | Ga0068853_1002501152 | 101 |
| 134 | 3300005539 | Ga0068853_101846474 | Ga0068853_1018464741 | 101 |
| 135 | 3300005548 | Ga0070665_100034046 | Ga0070665_1000340462 | 101 |
| 136 | 3300005548 | Ga0070665_101960765 | Ga0070665_1019607652 | 101 |
| 137 | 3300005548 | Ga0070665_102519313 | Ga0070665_1025193131 | 101 |
| 138 | 3300005563 | Ga0068855_100016384 | Ga0068855_1000163842 | 101 |
| 139 | 3300005563 | Ga0068855_100063510 | Ga0068855_1000635102 | 101 |
| 140 | 3300005563 | Ga0068855_100087624 | Ga0068855_1000876243 | 101 |
| 141 | 3300005563 | Ga0068855_100255347 | Ga0068855_1002553472 | 101 |
| 142 | 3300005563 | Ga0068855_100411399 | Ga0068855_1004113992 | 101 |
| 143 | 3300005563 | Ga0068855_100769190 | Ga0068855_1007691902 | 101 |
| 144 | 3300005563 | Ga0068855_101716402 | Ga0068855_1017164022 | 101 |
| 145 | 3300005577 | Ga0068857_100029189 | Ga0068857_1000291893 | 101 |
| 146 | 3300005577 | Ga0068857_102147719 | Ga0068857_1021477192 | 101 |
| 147 | 3300005578 | Ga0068854_100232381 | Ga0068854_1002323812 | 101 |
| 148 | 3300005614 | Ga0068856_100165285 | Ga0068856_1001652852 | 101 |
| 149 | 3300005614 | Ga0068856_100802305 | Ga0068856_1008023051 | 101 |
| 150 | 3300005614 | Ga0068856_100922479 | Ga0068856_1009224792 | 101 |
| 151 | 3300005614 | Ga0068856_101027112 | Ga0068856_1010271122 | 101 |
| 152 | 3300005614 | Ga0068856_102643535 | Ga0068856_1026435351 | 101 |
| 153 | 3300005616 | Ga0068852_100179666 | Ga0068852_1001796662 | 101 |
| 154 | 3300005616 | Ga0068852_100204256 | Ga0068852_1002042562 | 101 |
| 155 | 3300005616 | Ga0068852_101089156 | Ga0068852_1010891562 | 101 |
| 156 | 3300005616 | Ga0068852_101461091 | Ga0068852_1014610912 | 101 |
| 157 | 3300005842 | Ga0068858_101426512 | Ga0068858_1014265122 | 101 |
| 158 | 3300006028 | Ga0070717_10587493 | Ga0070717_105874932 | 101 |
| 159 | 3300006173 | Ga0070716_100745654 | Ga0070716_1007456542 | 101 |
| 160 | 3300006175 | Ga0070712_100069257 | Ga0070712_1000692573 | 101 |
| 161 | 3300006175 | Ga0070712_100417845 | Ga0070712_1004178452 | 101 |
| 162 | 3300006175 | Ga0070712_101068896 | Ga0070712_1010688961 | 101 |
| 163 | 3300006175 | Ga0070712_101967503 | Ga0070712_1019675031 | 101 |
| 164 | 3300006237 | Ga0097621_101137383 | Ga0097621_1011373832 | 101 |
| 165 | 3300006358 | Ga0068871_100411371 | Ga0068871_1004113712 | 101 |
| 166 | 3300006358 | Ga0068871_101284739 | Ga0068871_1012847392 | 101 |
| 167 | 3300006852 | Ga0075433_10138820 | Ga0075433_101388202 | 101 |
| 168 | 3300006871 | Ga0075434_100010410 | Ga0075434_1000104105 | 101 |
| 169 | 3300006914 | Ga0075436_100370066 | Ga0075436_1003700662 | 101 |
| 170 | 3300007076 | Ga0075435_100016982 | Ga0075435_1000169822 | 101 |
| 171 | 3300009093 | Ga0105240_10053923 | Ga0105240_100539233 | 101 |
| 172 | 3300009093 | Ga0105240_10120145 | Ga0105240_101201452 | 101 |
| 173 | 3300009093 | Ga0105240_10120376 | Ga0105240_101203763 | 101 |
| 174 | 3300009093 | Ga0105240_10143064 | Ga0105240_101430642 | 101 |
| 175 | 3300009093 | Ga0105240_10247992 | Ga0105240_102479922 | 101 |
| 176 | 3300009093 | Ga0105240_10693310 | Ga0105240_106933102 | 101 |
| 177 | 3300009093 | Ga0105240_11524410 | Ga0105240_115244101 | 101 |
| 178 | 3300009098 | Ga0105245_10245370 | Ga0105245_102453702 | 101 |
| 179 | 3300009098 | Ga0105245_10546408 | Ga0105245_105464082 | 101 |
| 180 | 3300009098 | Ga0105245_12210810 | Ga0105245_122108102 | 101 |
| 181 | 3300009098 | Ga0105245_12246828 | Ga0105245_122468282 | 101 |
| 182 | 3300009147 | Ga0114129_12101196 | Ga0114129_121011962 | 101 |
| 183 | 3300009174 | Ga0105241_10606446 | Ga0105241_106064462 | 101 |
| 184 | 3300009174 | Ga0105241_11044786 | Ga0105241_110447862 | 101 |
| 185 | 3300009176 | Ga0105242_11741843 | Ga0105242_117418431 | 101 |
| 186 | 3300009177 | Ga0105248_11211769 | Ga0105248_112117692 | 101 |
| 187 | 3300009545 | Ga0105237_10019405 | Ga0105237_100194053 | 101 |
| 188 | 3300009545 | Ga0105237_10034220 | Ga0105237_100342202 | 101 |
| 189 | 3300009545 | Ga0105237_10139637 | Ga0105237_101396372 | 101 |
| 190 | 3300009551 | Ga0105238_10019876 | Ga0105238_100198766 | 101 |
| 191 | 3300009551 | Ga0105238_10047475 | Ga0105238_100474752 | 101 |
| 192 | 3300010375 | Ga0105239_11395985 | Ga0105239_113959852 | 101 |
| 193 | 3300010375 | Ga0105239_12970559 | Ga0105239_129705592 | 101 |
| 194 | 3300013100 | Ga0157373_10030526 | Ga0157373_100305263 | 101 |
| 195 | 3300013100 | Ga0157373_10462957 | Ga0157373_104629571 | 101 |
| 196 | 3300013104 | Ga0157370_10008703 | Ga0157370_100087038 | 101 |
| 197 | 3300013104 | Ga0157370_10008884 | Ga0157370_100088846 | 101 |
| 198 | 3300013104 | Ga0157370_10074275 | Ga0157370_100742753 | 101 |
| 199 | 3300013104 | Ga0157370_10339226 | Ga0157370_103392262 | 101 |
| 200 | 3300013105 | Ga0157369_10003170 | Ga0157369_100031705 | 101 |
| 201 | 3300013105 | Ga0157369_10021481 | Ga0157369_100214814 | 101 |
| 202 | 3300013105 | Ga0157369_10079566 | Ga0157369_100795664 | 101 |
| 203 | 3300013105 | Ga0157369_10209123 | Ga0157369_102091232 | 101 |
| 204 | 3300013105 | Ga0157369_10413168 | Ga0157369_104131682 | 101 |
| 205 | 3300013105 | Ga0157369_10424350 | Ga0157369_104243502 | 101 |
| 206 | 3300013105 | Ga0157369_10659443 | Ga0157369_106594432 | 101 |
| 207 | 3300013105 | Ga0157369_10750883 | Ga0157369_107508832 | 101 |
| 208 | 3300013296 | Ga0157374_10113216 | Ga0157374_101132162 | 101 |
| 209 | 3300013296 | Ga0157374_11128889 | Ga0157374_111288892 | 101 |
| 210 | 3300013296 | Ga0157374_11854936 | Ga0157374_118549362 | 101 |
| 211 | 3300013297 | Ga0157378_10830372 | Ga0157378_108303721 | 101 |
| 212 | 3300013297 | Ga0157378_12869537 | Ga0157378_128695372 | 101 |
| 213 | 3300013307 | Ga0157372_10064426 | Ga0157372_100644264 | 101 |
| 214 | 3300013307 | Ga0157372_10080130 | Ga0157372_100801304 | 101 |
| 215 | 3300013307 | Ga0157372_10205945 | Ga0157372_102059452 | 101 |
| 216 | 3300013307 | Ga0157372_10534068 | Ga0157372_105340683 | 101 |
| 217 | 3300013307 | Ga0157372_10917620 | Ga0157372_109176202 | 101 |
| 218 | 3300013307 | Ga0157372_11165457 | Ga0157372_111654572 | 101 |
| 219 | 3300013308 | Ga0157375_10493086 | Ga0157375_104930862 | 101 |
| 220 | 3300013308 | Ga0157375_10523948 | Ga0157375_105239481 | 101 |
| 221 | 3300013308 | Ga0157375_11244684 | Ga0157375_112446842 | 101 |
| 222 | 3300014969 | Ga0157376_10597810 | Ga0157376_105978102 | 101 |
| 223 | 3300014969 | Ga0157376_11120158 | Ga0157376_111201582 | 101 |
| 224 | 3300015261 | Ga0182006_1174381 | Ga0182006_11743812 | 101 |
| 225 | 3300015262 | Ga0182007_10237935 | Ga0182007_102379351 | 101 |
| 226 | 3300020069 | Ga0197907_10555821 | Ga0197907_105558212 | 101 |
| 227 | 3300020070 | Ga0206356_10199074 | Ga0206356_101990742 | 101 |
| 228 | 3300020070 | Ga0206356_10213960 | Ga0206356_102139602 | 101 |
| 229 | 3300020070 | Ga0206356_10906256 | Ga0206356_109062562 | 101 |
| 230 | 3300020070 | Ga0206356_11007588 | Ga0206356_110075882 | 101 |
| 231 | 3300020070 | Ga0206356_11532121 | Ga0206356_115321212 | 101 |
| 232 | 3300020080 | Ga0206350_11658887 | Ga0206350_116588871 | 101 |
| 233 | 3300020081 | Ga0206354_10372290 | Ga0206354_103722902 | 101 |
| 234 | 3300020081 | Ga0206354_10434998 | Ga0206354_104349981 | 101 |
| 235 | 3300020081 | Ga0206354_10791054 | Ga0206354_107910542 | 101 |
| 236 | 3300020081 | Ga0206354_11344677 | Ga0206354_113446772 | 101 |
| 237 | 3300020082 | Ga0206353_10418390 | Ga0206353_104183903 | 101 |
| 238 | 3300020082 | Ga0206353_10987184 | Ga0206353_109871846 | 101 |
| 239 | 3300020082 | Ga0206353_11646033 | Ga0206353_116460332 | 101 |
| 240 | 3300020082 | Ga0206353_11798682 | Ga0206353_117986822 | 101 |
| 241 | 3300020082 | Ga0206353_11896535 | Ga0206353_118965352 | 101 |
| 242 | 3300021384 | Ga0213876_10362658 | Ga0213876_103626581 | 101 |
| 243 | 3300025898 | Ga0207692_10643612 | Ga0207692_106436122 | 101 |
| 244 | 3300025906 | Ga0207699_10788796 | Ga0207699_107887962 | 101 |
| 245 | 3300025906 | Ga0207699_10985817 | Ga0207699_109858172 | 101 |
| 246 | 3300025909 | Ga0207705_10061210 | Ga0207705_100612102 | 101 |
| 247 | 3300025909 | Ga0207705_10086718 | Ga0207705_100867182 | 101 |
| 248 | 3300025909 | Ga0207705_10168217 | Ga0207705_101682172 | 101 |
| 249 | 3300025909 | Ga0207705_10176595 | Ga0207705_101765952 | 101 |
| 250 | 3300025909 | Ga0207705_10261425 | Ga0207705_102614252 | 101 |
| 251 | 3300025911 | Ga0207654_10653030 | Ga0207654_106530301 | 101 |
| 252 | 3300025912 | Ga0207707_10028530 | Ga0207707_100285303 | 101 |
| 253 | 3300025912 | Ga0207707_10063643 | Ga0207707_100636433 | 101 |
| 254 | 3300025912 | Ga0207707_10068650 | Ga0207707_100686503 | 101 |
| 255 | 3300025912 | Ga0207707_10095190 | Ga0207707_100951902 | 101 |
| 256 | 3300025912 | Ga0207707_10395371 | Ga0207707_103953712 | 101 |
| 257 | 3300025913 | Ga0207695_10118469 | Ga0207695_101184694 | 101 |
| 258 | 3300025913 | Ga0207695_10307743 | Ga0207695_103077432 | 101 |
| 259 | 3300025913 | Ga0207695_11296545 | Ga0207695_112965452 | 101 |
| 260 | 3300025914 | Ga0207671_10027983 | Ga0207671_100279834 | 101 |
| 261 | 3300025914 | Ga0207671_10041739 | Ga0207671_100417392 | 101 |
| 262 | 3300025915 | Ga0207693_10027294 | Ga0207693_100272944 | 101 |
| 263 | 3300025916 | Ga0207663_10022190 | Ga0207663_100221903 | 101 |
| 264 | 3300025916 | Ga0207663_10129207 | Ga0207663_101292072 | 101 |
| 265 | 3300025916 | Ga0207663_10340818 | Ga0207663_103408182 | 101 |
| 266 | 3300025916 | Ga0207663_11654477 | Ga0207663_116544771 | 101 |
| 267 | 3300025917 | Ga0207660_10033916 | Ga0207660_100339163 | 101 |
| 268 | 3300025917 | Ga0207660_10073040 | Ga0207660_100730402 | 101 |
| 269 | 3300025917 | Ga0207660_10123762 | Ga0207660_101237622 | 101 |
| 270 | 3300025917 | Ga0207660_10157622 | Ga0207660_101576222 | 101 |
| 271 | 3300025917 | Ga0207660_10242730 | Ga0207660_102427302 | 101 |
| 272 | 3300025917 | Ga0207660_10472920 | Ga0207660_104729202 | 101 |
| 273 | 3300025917 | Ga0207660_10871611 | Ga0207660_108716112 | 101 |
| 274 | 3300025917 | Ga0207660_11285700 | Ga0207660_112857002 | 101 |
| 275 | 3300025917 | Ga0207660_11519715 | Ga0207660_115197152 | 101 |
| 276 | 3300025919 | Ga0207657_10000054 | Ga0207657_1000005484 | 101 |
| 277 | 3300025919 | Ga0207657_10000651 | Ga0207657_100006516 | 101 |
| 278 | 3300025919 | Ga0207657_10026684 | Ga0207657_100266845 | 101 |
| 279 | 3300025919 | Ga0207657_10094223 | Ga0207657_100942232 | 101 |
| 280 | 3300025919 | Ga0207657_10617865 | Ga0207657_106178652 | 101 |
| 281 | 3300025920 | Ga0207649_10031801 | Ga0207649_100318013 | 101 |
| 282 | 3300025920 | Ga0207649_10172831 | Ga0207649_101728312 | 101 |
| 283 | 3300025920 | Ga0207649_11183285 | Ga0207649_111832852 | 101 |
| 284 | 3300025921 | Ga0207652_10118461 | Ga0207652_101184612 | 101 |
| 285 | 3300025921 | Ga0207652_10136182 | Ga0207652_101361821 | 101 |
| 286 | 3300025921 | Ga0207652_10160515 | Ga0207652_101605152 | 101 |
| 287 | 3300025921 | Ga0207652_10249862 | Ga0207652_102498622 | 101 |
| 288 | 3300025921 | Ga0207652_10492662 | Ga0207652_104926622 | 101 |
| 289 | 3300025921 | Ga0207652_10842891 | Ga0207652_108428911 | 101 |
| 290 | 3300025921 | Ga0207652_10939436 | Ga0207652_109394362 | 101 |
| 291 | 3300025921 | Ga0207652_10956839 | Ga0207652_109568392 | 101 |
| 292 | 3300025921 | Ga0207652_11055511 | Ga0207652_110555112 | 101 |
| 293 | 3300025921 | Ga0207652_11172087 | Ga0207652_111720872 | 101 |
| 294 | 3300025924 | Ga0207694_10020090 | Ga0207694_100200903 | 101 |
| 295 | 3300025924 | Ga0207694_10914020 | Ga0207694_109140202 | 101 |
| 296 | 3300025927 | Ga0207687_10533173 | Ga0207687_105331732 | 101 |
| 297 | 3300025927 | Ga0207687_10870535 | Ga0207687_108705352 | 101 |
| 298 | 3300025927 | Ga0207687_11168188 | Ga0207687_111681882 | 101 |
| 299 | 3300025927 | Ga0207687_11175915 | Ga0207687_111759151 | 101 |
| 300 | 3300025928 | Ga0207700_10031432 | Ga0207700_100314325 | 101 |
| 301 | 3300025928 | Ga0207700_10472195 | Ga0207700_104721952 | 101 |
| 302 | 3300025928 | Ga0207700_10709310 | Ga0207700_107093102 | 101 |
| 303 | 3300025929 | Ga0207664_10169838 | Ga0207664_101698382 | 101 |
| 304 | 3300025929 | Ga0207664_10237926 | Ga0207664_102379262 | 101 |
| 305 | 3300025929 | Ga0207664_11636295 | Ga0207664_116362952 | 101 |
| 306 | 3300025931 | Ga0207644_10329837 | Ga0207644_103298372 | 101 |
| 307 | 3300025932 | Ga0207690_10010167 | Ga0207690_100101672 | 101 |
| 308 | 3300025933 | Ga0207706_11673395 | Ga0207706_116733952 | 101 |
| 309 | 3300025934 | Ga0207686_11128603 | Ga0207686_111286032 | 101 |
| 310 | 3300025939 | Ga0207665_10525454 | Ga0207665_105254542 | 101 |
| 311 | 3300025941 | Ga0207711_11823254 | Ga0207711_118232542 | 101 |
| 312 | 3300025944 | Ga0207661_10124155 | Ga0207661_101241552 | 101 |
| 313 | 3300025944 | Ga0207661_10124905 | Ga0207661_101249052 | 101 |
| 314 | 3300025944 | Ga0207661_10142813 | Ga0207661_101428132 | 101 |
| 315 | 3300025944 | Ga0207661_10261327 | Ga0207661_102613272 | 101 |
| 316 | 3300025944 | Ga0207661_10431280 | Ga0207661_104312802 | 101 |
| 317 | 3300025944 | Ga0207661_10469994 | Ga0207661_104699942 | 101 |
| 318 | 3300025944 | Ga0207661_10866301 | Ga0207661_108663012 | 101 |
| 319 | 3300025949 | Ga0207667_10080044 | Ga0207667_100800442 | 101 |
| 320 | 3300025949 | Ga0207667_10143431 | Ga0207667_101434312 | 101 |
| 321 | 3300025949 | Ga0207667_10705488 | Ga0207667_107054882 | 101 |
| 322 | 3300025949 | Ga0207667_11158537 | Ga0207667_111585372 | 101 |
| 323 | 3300025949 | Ga0207667_11812059 | Ga0207667_118120592 | 101 |
| 324 | 3300025981 | Ga0207640_10361307 | Ga0207640_103613072 | 101 |
| 325 | 3300025981 | Ga0207640_10364956 | Ga0207640_103649562 | 101 |
| 326 | 3300025986 | Ga0207658_10004308 | Ga0207658_1000430810 | 101 |
| 327 | 3300026023 | Ga0207677_10407891 | Ga0207677_104078912 | 101 |
| 328 | 3300026023 | Ga0207677_10924852 | Ga0207677_109248522 | 101 |
| 329 | 3300026035 | Ga0207703_11452587 | Ga0207703_114525872 | 101 |
| 330 | 3300026041 | Ga0207639_10037935 | Ga0207639_100379353 | 101 |
| 331 | 3300026041 | Ga0207639_11752269 | Ga0207639_117522692 | 101 |
| 332 | 3300026067 | Ga0207678_10275632 | Ga0207678_102756322 | 101 |
| 333 | 3300026078 | Ga0207702_10052351 | Ga0207702_100523512 | 101 |
| 334 | 3300026078 | Ga0207702_10071171 | Ga0207702_100711712 | 101 |
| 335 | 3300026078 | Ga0207702_11512748 | Ga0207702_115127482 | 101 |
| 336 | 3300026078 | Ga0207702_12472665 | Ga0207702_124726651 | 101 |
| 337 | 3300026089 | Ga0207648_11294753 | Ga0207648_112947532 | 101 |
| 338 | 3300026116 | Ga0207674_10010978 | Ga0207674_100109785 | 101 |
| 339 | 3300026116 | Ga0207674_10492468 | Ga0207674_104924682 | 101 |
| 340 | 3300026121 | Ga0207683_10377027 | Ga0207683_103770272 | 101 |
| 341 | 3300026142 | Ga0207698_10116228 | Ga0207698_101162282 | 101 |
| 342 | 3300026142 | Ga0207698_10225077 | Ga0207698_102250772 | 101 |
| 343 | 3300026142 | Ga0207698_10228812 | Ga0207698_102288122 | 101 |
| 344 | 3300026142 | Ga0207698_10436355 | Ga0207698_104363552 | 101 |
| 345 | 3300026142 | Ga0207698_10690979 | Ga0207698_106909792 | 101 |
| 346 | 3300028379 | Ga0268266_10115483 | Ga0268266_101154832 | 101 |
| 347 | 3300028379 | Ga0268266_10933194 | Ga0268266_109331942 | 101 |
| 348 | 3300028379 | Ga0268266_11058210 | Ga0268266_110582101 | 101 |
| 349 | 3300031250 | Ga0265331_10115676 | Ga0265331_101156762 | 101 |
| 350 | 3300031251 | Ga0265327_10015633 | Ga0265327_100156334 | 101 |
| 351 | 3300031548 | Ga0307408_100356479 | Ga0307408_1003564791 | 101 |
| 352 | 3300032002 | Ga0307416_101733772 | Ga0307416_1017337722 | 101 |
| 353 | 3300035089 | Ga0373944_0006321 | Ga0373944_0006321_1319_1624 | 101 |
| 354 | 3300035089 | Ga0373944_0043716 | Ga0373944_0043716_574_885 | 101 |
| 355 | 3300035113 | Ga0373936_0300579 | Ga0373936_0300579_216_527 | 101 |
| 356 | 3300035113 | Ga0373936_0352033 | Ga0373936_0352033_225_536 | 101 |
| 357 | 3300035116 | Ga0373945_0002165 | Ga0373945_0002165_409_714 | 101 |
| 358 | 3300035119 | Ga0373956_0380699 | Ga0373956_0380699_167_472 | 101 |
| 359 | 3300035120 | Ga0373957_0051723 | Ga0373957_0051723_113_418 | 101 |
| 360 | 3300035170 | Ga0373943_0000101 | Ga0373943_0000101_17911_18216 | 101 |
| 361 | 3300035170 | Ga0373943_0019104 | Ga0373943_0019104_2389_2700 | 101 |
| 362 | 3300035171 | Ga0373946_0089985 | Ga0373946_0089985_384_689 | 101 |
| 363 | 3300035172 | Ga0373955_0006377 | Ga0373955_0006377_2185_2490 | 101 |
| 364 | 3300035410 | Ga0373924_0124279 | Ga0373924_0124279_722_1027 | 101 |
| 365 | 3300035692 | Ga0373935_0003186 | Ga0373935_0003186_2062_2367 | 101 |
| 366 | 3300035692 | Ga0373935_0436657 | Ga0373935_0436657_606_911 | 101 |
| 367 | 3300035695 | Ga0373927_0078714 | Ga0373927_0078714_110_415 | 101 |
| 368 | 3300035695 | Ga0373927_0104633 | Ga0373927_0104633_854_1165 | 101 |
| 369 | 3300035695 | Ga0373927_0817063 | Ga0373927_0817063_26_331 | 101 |
| 370 | 3300035724 | Ga0373933_0032010 | Ga0373933_0032010_1173_1478 | 101 |
| 371 | 3300035725 | Ga0373947_0002740 | Ga0373947_0002740_8543_8854 | 101 |
| 372 | 3300035725 | Ga0373947_0004984 | Ga0373947_0004984_4122_4427 | 101 |
| 373 | 3300035725 | Ga0373947_0942873 | Ga0373947_0942873_240_548 | 101 |
| 374 | 3300035725 | Ga0373947_1228311 | Ga0373947_1228311_83_388 | 101 |
| 375 | 3300037068 | Ga0373925_0001828 | Ga0373925_0001828_8292_8597 | 101 |
| 376 | 3300037068 | Ga0373925_0019854 | Ga0373925_0019854_2661_2972 | 101 |
| 377 | 3300037068 | Ga0373925_1033958 | Ga0373925_1033958_276_587 | 101 |
| 378 | 3300037312 | Ga0395899_0502132 | Ga0395899_0502132_101_406 | 101 |
| 379 | 3300037418 | Ga0395900_0062931 | Ga0395900_0062931_1267_1575 | 101 |
| 380 | 3300037418 | Ga0395900_0675402 | Ga0395900_0675402_95_400 | 101 |
| 381 | 3300037418 | Ga0395900_1046062 | Ga0395900_1046062_397_702 | 101 |
| 382 | 3300037418 | Ga0395900_1455836 | Ga0395900_1455836_253_558 | 101 |
| 383 | 3300037466 | Ga0395898_0001509 | Ga0395898_0001509_28618_28923 | 101 |
| 384 | 3300037466 | Ga0395898_0007850 | Ga0395898_0007850_1348_1656 | 101 |
| 385 | 3300037466 | Ga0395898_0349215 | Ga0395898_0349215_100_414 | 101 |
| 386 | 3300037466 | Ga0395898_0944284 | Ga0395898_0944284_226_531 | 101 |
| 387 | 3300037471 | Ga0395905_0106669 | Ga0395905_0106669_2078_2386 | 101 |
| 388 | 3300038443 | Ga0395901_0001414 | Ga0395901_0001414_23010_23318 | 101 |
| 389 | 3300038443 | Ga0395901_0022116 | Ga0395901_0022116_1677_1982 | 101 |
| 390 | 3300038443 | Ga0395901_0111813 | Ga0395901_0111813_1965_2279 | 101 |
| 391 | 3300038443 | Ga0395901_0128104 | Ga0395901_0128104_69_374 | 101 |
| 392 | 3300038443 | Ga0395901_0656177 | Ga0395901_0656177_606_917 | 101 |
| 393 | 3300038443 | Ga0395901_0780048 | Ga0395901_0780048_552_857 | 101 |
| 394 | 3300039437 | Ga0436365_1571369 | Ga0436365_1571369_111_416 | 101 |
| 395 | 3300039450 | Ga0436363_0074777 | Ga0436363_0074777_190_504 | 101 |
| 396 | 3300041459 | Ga0451800_0466089 | Ga0451800_0466089_16_324 | 101 |
| 397 | 3300041501 | Ga0451845_0612332 | Ga0451845_0612332_343_651 | 101 |
| 398 | 3300041512 | Ga0451853_2492716 | Ga0451853_2492716_342_650 | 101 |
| 399 | 3300042005 | Ga0439448_0156574 | Ga0439448_0156574_468_782 | 101 |
| 400 | 3300044683 | Ga0466965_0106994 | Ga0466965_0106994_1087_1392 | 101 |
| 401 | 3300044684 | Ga0466966_0002588 | Ga0466966_0002588_7247_7552 | 101 |
| 402 | 3300044684 | Ga0466966_0032731 | Ga0466966_0032731_1778_2083 | 101 |
| 403 | 3300044694 | Ga0466963_0001732 | Ga0466963_0001732_7335_7646 | 101 |
| 404 | 3300044694 | Ga0466963_0023591 | Ga0466963_0023591_1700_2008 | 101 |
| 405 | 3300044694 | Ga0466963_0123435 | Ga0466963_0123435_185_490 | 101 |
| 406 | 3300044694 | Ga0466963_0664204 | Ga0466963_0664204_345_659 | 101 |
| 407 | 3300044706 | Ga0466964_0004414 | Ga0466964_0004414_2765_3070 | 101 |
| 408 | 3300044706 | Ga0466964_0105488 | Ga0466964_0105488_329_634 | 101 |
| 409 | 3300044842 | Ga0466957_0505265 | Ga0466957_0505265_512_823 | 101 |
| 410 | 3300045049 | Ga0466959_0015352 | Ga0466959_0015352_49_354 | 101 |
| 411 | 3300045049 | Ga0466959_0060933 | Ga0466959_0060933_1598_1903 | 101 |
| 412 | 3300045049 | Ga0466959_0721938 | Ga0466959_0721938_352_657 | 101 |
| 413 | 3300045836 | Ga0466958_0667679 | Ga0466958_0667679_168_473 | 101 |
| 414 | 3300045836 | Ga0466958_0705546 | Ga0466958_0705546_20_331 | 101 |
| 415 | 3300045976 | Ga0466967_0007258 | Ga0466967_0007258_364_669 | 101 |
| 416 | 3300045976 | Ga0466967_0032999 | Ga0466967_0032999_2897_3202 | 101 |
| 417 | 3300045976 | Ga0466967_0044604 | Ga0466967_0044604_780_1085 | 101 |
| 418 | 3300045976 | Ga0466967_0084219 | Ga0466967_0084219_1326_1631 | 101 |
| 419 | 3300045976 | Ga0466967_0231194 | Ga0466967_0231194_1404_1709 | 101 |
| 420 | 3300045976 | Ga0466967_0614351 | Ga0466967_0614351_198_512 | 101 |
| 421 | 3300045976 | Ga0466967_1037078 | Ga0466967_1037078_493_801 | 101 |
| 422 | 3300046454 | Ga0495592_0067449 | Ga0495592_0067449_2000_2305 | 101 |
| 423 | 3300046459 | Ga0495629_0000670 | Ga0495629_0000670_4763_5068 | 101 |
| 424 | 3300046459 | Ga0495629_0189887 | Ga0495629_0189887_39_350 | 101 |
| 425 | 3300046459 | Ga0495629_1071416 | Ga0495629_1071416_72_383 | 101 |
| 426 | 3300046461 | Ga0495641_0000374 | Ga0495641_0000374_15241_15546 | 101 |
| 427 | 3300046461 | Ga0495641_0208812 | Ga0495641_0208812_428_733 | 101 |
| 428 | 3300046462 | Ga0495651_0004871 | Ga0495651_0004871_6900_7205 | 101 |
| 429 | 3300046462 | Ga0495651_0022109 | Ga0495651_0022109_4324_4629 | 101 |
| 430 | 3300046462 | Ga0495651_0191781 | Ga0495651_0191781_990_1295 | 101 |
| 431 | 3300046463 | Ga0495653_0011141 | Ga0495653_0011141_4097_4402 | 101 |
| 432 | 3300046463 | Ga0495653_0039537 | Ga0495653_0039537_93_398 | 101 |
| 433 | 3300046463 | Ga0495653_0064886 | Ga0495653_0064886_1367_1672 | 101 |
| 434 | 3300046472 | Ga0495580_0387117 | Ga0495580_0387117_73_384 | 101 |
| 435 | 3300046473 | Ga0495582_0000124 | Ga0495582_0000124_22447_22752 | 101 |
| 436 | 3300046475 | Ga0495639_0000658 | Ga0495639_0000658_15232_15537 | 101 |
| 437 | 3300046476 | Ga0495662_0000898 | Ga0495662_0000898_3360_3665 | 101 |
| 438 | 3300046476 | Ga0495662_0031320 | Ga0495662_0031320_165_470 | 101 |
| 439 | 3300046477 | Ga0495664_0033006 | Ga0495664_0033006_1005_1310 | 101 |
| 440 | 3300046477 | Ga0495664_0070584 | Ga0495664_0070584_1523_1828 | 101 |
| 441 | 3300046511 | Ga0495608_0005935 | Ga0495608_0005935_6901_7206 | 101 |
| 442 | 3300046511 | Ga0495608_0038097 | Ga0495608_0038097_899_1204 | 101 |
| 443 | 3300046511 | Ga0495608_0050740 | Ga0495608_0050740_463_768 | 101 |
| 444 | 3300046514 | Ga0495618_0053992 | Ga0495618_0053992_1849_2154 | 101 |
| 445 | 3300046514 | Ga0495618_0201734 | Ga0495618_0201734_804_1109 | 101 |
| 446 | 3300046516 | Ga0495628_0916762 | Ga0495628_0916762_210_515 | 101 |
| 447 | 3300046517 | Ga0495630_0007417 | Ga0495630_0007417_4796_5101 | 101 |
| 448 | 3300046517 | Ga0495630_0021732 | Ga0495630_0021732_4270_4581 | 101 |
| 449 | 3300046517 | Ga0495630_0059166 | Ga0495630_0059166_21_326 | 101 |
| 450 | 3300046517 | Ga0495630_0354178 | Ga0495630_0354178_554_865 | 101 |
| 451 | 3300046526 | Ga0495666_0030819 | Ga0495666_0030819_1588_1893 | 101 |
| 452 | 3300046526 | Ga0495666_0487786 | Ga0495666_0487786_11_316 | 101 |
| 453 | 3300046529 | Ga0495652_0026278 | Ga0495652_0026278_2293_2598 | 101 |
| 454 | 3300046529 | Ga0495652_0370780 | Ga0495652_0370780_444_749 | 101 |
| 455 | 3300046531 | Ga0495665_0000249 | Ga0495665_0000249_7770_8075 | 101 |
| 456 | 3300046531 | Ga0495665_0361968 | Ga0495665_0361968_256_567 | 101 |
| 457 | 3300046533 | Ga0495640_0019459 | Ga0495640_0019459_1983_2288 | 101 |
| 458 | 3300046533 | Ga0495640_0023042 | Ga0495640_0023042_1339_1644 | 101 |
| 459 | 3300046536 | Ga0495587_0006779 | Ga0495587_0006779_3319_3624 | 101 |
| 460 | 3300046536 | Ga0495587_0341912 | Ga0495587_0341912_508_813 | 101 |
| 461 | 3300046536 | Ga0495587_0641130 | Ga0495587_0641130_266_571 | 101 |
| 462 | 3300046543 | Ga0495645_0015115 | Ga0495645_0015115_1698_2003 | 101 |
| 463 | 3300046543 | Ga0495645_0046298 | Ga0495645_0046298_1735_2040 | 101 |
| 464 | 3300046559 | Ga0495667_0012696 | Ga0495667_0012696_3325_3630 | 101 |
| 465 | 3300046559 | Ga0495667_0030058 | Ga0495667_0030058_1448_1753 | 101 |
| 466 | 3300046642 | Ga0495634_0038440 | Ga0495634_0038440_2784_3089 | 101 |
| 467 | 3300046642 | Ga0495634_0110312 | Ga0495634_0110312_991_1296 | 101 |
| 468 | 3300046642 | Ga0495634_0329186 | Ga0495634_0329186_178_483 | 101 |
| 469 | 3300046663 | Ga0495635_0009732 | Ga0495635_0009732_3071_3376 | 101 |
| 470 | 3300046663 | Ga0495635_0012567 | Ga0495635_0012567_4689_4994 | 101 |
| 471 | 3300046663 | Ga0495635_0126029 | Ga0495635_0126029_452_757 | 101 |
| 472 | 3300046675 | Ga0495657_0035371 | Ga0495657_0035371_302_607 | 101 |
| 473 | 3300046675 | Ga0495657_0108190 | Ga0495657_0108190_366_671 | 101 |
| 474 | 3300046675 | Ga0495657_0110282 | Ga0495657_0110282_1193_1498 | 101 |
| 475 | 3300046678 | Ga0495599_0009819 | Ga0495599_0009819_3064_3369 | 101 |
| 476 | 3300046678 | Ga0495599_0322865 | Ga0495599_0322865_468_773 | 101 |
| 477 | 3300046679 | Ga0495623_0005346 | Ga0495623_0005346_4867_5172 | 101 |
| 478 | 3300046680 | Ga0495646_0112052 | Ga0495646_0112052_840_1145 | 101 |
| 479 | 3300046680 | Ga0495646_0305794 | Ga0495646_0305794_147_452 | 101 |
| 480 | 3300046681 | Ga0495647_0000689 | Ga0495647_0000689_1944_2249 | 101 |
| 481 | 3300046681 | Ga0495647_0601682 | Ga0495647_0601682_85_396 | 101 |
| 482 | 3300046683 | Ga0495658_0000247 | Ga0495658_0000247_18163_18468 | 101 |
| 483 | 3300046689 | Ga0495613_0001393 | Ga0495613_0001393_1711_2016 | 101 |
| 484 | 3300046689 | Ga0495613_0388861 | Ga0495613_0388861_301_606 | 101 |
| 485 | 3300046690 | Ga0495624_0045682 | Ga0495624_0045682_805_1110 | 101 |
| 486 | 3300046690 | Ga0495624_0144487 | Ga0495624_0144487_276_581 | 101 |
| 487 | 3300046809 | Ga0495600_0017263 | Ga0495600_0017263_3387_3692 | 101 |
| 488 | 3300046809 | Ga0495600_0398876 | Ga0495600_0398876_290_595 | 101 |
| 489 | 3300047315 | Ga0495581_0004417 | Ga0495581_0004417_3030_3335 | 101 |
| 490 | 3300047317 | Ga0495604_0014213 | Ga0495604_0014213_3366_3671 | 101 |
| 491 | 3300047317 | Ga0495604_0096373 | Ga0495604_0096373_522_827 | 101 |
| 492 | 3300047317 | Ga0495604_0340699 | Ga0495604_0340699_134_439 | 101 |
| 493 | 3300047319 | Ga0495674_0003941 | Ga0495674_0003941_2818_3123 | 101 |
| 494 | 3300047319 | Ga0495674_0192128 | Ga0495674_0192128_418_723 | 101 |
| 495 | 3300047321 | Ga0495676_0001077 | Ga0495676_0001077_17895_18200 | 101 |
| 496 | 3300047321 | Ga0495676_0493381 | Ga0495676_0493381_73_384 | 101 |
| 497 | 3300047322 | Ga0495680_0003365 | Ga0495680_0003365_5727_6032 | 101 |
| 498 | 3300047322 | Ga0495680_0013880 | Ga0495680_0013880_5498_5803 | 101 |
| 499 | 3300047444 | Ga0495675_0000878 | Ga0495675_0000878_12330_12635 | 101 |
| 500 | 3300047471 | Ga0495684_0001855 | Ga0495684_0001855_10561_10866 | 101 |
| 501 | 3300047471 | Ga0495684_0036467 | Ga0495684_0036467_979_1284 | 101 |
| 502 | 3300047673 | Ga0495593_0039086 | Ga0495593_0039086_990_1295 | 101 |
| 503 | 3300048088 | Ga0495602_0028925 | Ga0495602_0028925_3325_3630 | 101 |
| 504 | 3300048088 | Ga0495602_0283502 | Ga0495602_0283502_507_812 | 101 |
| 505 | 3300048088 | Ga0495602_0628722 | Ga0495602_0628722_240_545 | 101 |
| 506 | 3300048089 | Ga0495614_0009511 | Ga0495614_0009511_1809_2114 | 101 |
| 507 | 3300048903 | Ga0496100_0004628 | Ga0496100_0004628_4213_4521 | 101 |
| 508 | 3300048903 | Ga0496100_0064529 | Ga0496100_0064529_1781_2086 | 101 |
| 509 | 3300048903 | Ga0496100_0074714 | Ga0496100_0074714_410_715 | 101 |
| 510 | 3300048904 | Ga0496101_0009476 | Ga0496101_0009476_1264_1572 | 101 |
| 511 | 3300048904 | Ga0496101_0018810 | Ga0496101_0018810_213_518 | 101 |
| 512 | 3300048904 | Ga0496101_0071677 | Ga0496101_0071677_836_1144 | 101 |
| 513 | 3300048904 | Ga0496101_0159973 | Ga0496101_0159973_400_705 | 101 |
| 514 | 3300048904 | Ga0496101_0272957 | Ga0496101_0272957_754_1059 | 101 |
| 515 | 3300048905 | Ga0496102_0009451 | Ga0496102_0009451_4762_5070 | 101 |
| 516 | 3300048905 | Ga0496102_0019849 | Ga0496102_0019849_3008_3313 | 101 |
| 517 | 3300048905 | Ga0496102_0275326 | Ga0496102_0275326_687_992 | 101 |
| 518 | 3300048906 | Ga0496103_0053451 | Ga0496103_0053451_1665_1973 | 101 |
| 519 | 3300048906 | Ga0496103_0544672 | Ga0496103_0544672_151_465 | 101 |
| 520 | 3300048906 | Ga0496103_0781227 | Ga0496103_0781227_262_567 | 101 |
| 521 | 3300048907 | Ga0496104_0026632 | Ga0496104_0026632_2029_2337 | 101 |
| 522 | 3300048907 | Ga0496104_0047678 | Ga0496104_0047678_1252_1560 | 101 |
| 523 | 3300048907 | Ga0496104_0050582 | Ga0496104_0050582_1762_2070 | 101 |
| 524 | 3300048908 | Ga0496105_0002629 | Ga0496105_0002629_7502_7810 | 101 |
| 525 | 3300048908 | Ga0496105_0052163 | Ga0496105_0052163_2889_3197 | 101 |
| 526 | 3300048908 | Ga0496105_0128549 | Ga0496105_0128549_454_762 | 101 |
| 527 | 3300048909 | Ga0496106_0011636 | Ga0496106_0011636_1976_2284 | 101 |
| 528 | 3300048909 | Ga0496106_0947980 | Ga0496106_0947980_341_646 | 101 |
| 529 | 3300048910 | Ga0496107_0006368 | Ga0496107_0006368_503_811 | 101 |
| 530 | 3300048910 | Ga0496107_0075266 | Ga0496107_0075266_449_754 | 101 |
| 531 | 3300048910 | Ga0496107_0339223 | Ga0496107_0339223_661_966 | 101 |
| 532 | 3300048911 | Ga0496108_0002961 | Ga0496108_0002961_5989_6297 | 101 |
| 533 | 3300048911 | Ga0496108_0977330 | Ga0496108_0977330_335_643 | 101 |
| 534 | 3300048912 | Ga0496109_0002273 | Ga0496109_0002273_6263_6571 | 101 |
| 535 | 3300048912 | Ga0496109_0012523 | Ga0496109_0012523_1944_2252 | 101 |
| 536 | 3300048912 | Ga0496109_1191901 | Ga0496109_1191901_30_338 | 101 |
| 537 | 3300048912 | Ga0496109_2005747 | Ga0496109_2005747_102_407 | 101 |
| 538 | 3300048913 | Ga0496110_0030477 | Ga0496110_0030477_4232_4540 | 101 |
| 539 | 3300048913 | Ga0496110_0076879 | Ga0496110_0076879_1030_1338 | 101 |
| 540 | 3300048913 | Ga0496110_0398523 | Ga0496110_0398523_431_739 | 101 |
| 541 | 3300048914 | Ga0496111_0008543 | Ga0496111_0008543_4790_5098 | 101 |
| 542 | 3300048914 | Ga0496111_0221288 | Ga0496111_0221288_1027_1335 | 101 |
| 543 | 3300048915 | Ga0496112_0006274 | Ga0496112_0006274_6085_6393 | 101 |
| 544 | 3300048915 | Ga0496112_0010827 | Ga0496112_0010827_1070_1375 | 101 |
| 545 | 3300048915 | Ga0496112_0026439 | Ga0496112_0026439_4845_5150 | 101 |
| 546 | 3300048915 | Ga0496112_0101324 | Ga0496112_0101324_317_622 | 101 |
| 547 | 3300048915 | Ga0496112_0177088 | Ga0496112_0177088_1737_2042 | 101 |
| 548 | 3300048915 | Ga0496112_1450759 | Ga0496112_1450759_240_548 | 101 |
| 549 | 3300048916 | Ga0496113_0010642 | Ga0496113_0010642_948_1256 | 101 |
| 550 | 3300048916 | Ga0496113_0275258 | Ga0496113_0275258_174_479 | 101 |
| 551 | 3300048917 | Ga0496114_0012160 | Ga0496114_0012160_1327_1632 | 101 |
| 552 | 3300048917 | Ga0496114_0024496 | Ga0496114_0024496_3784_4092 | 101 |
| 553 | 3300048917 | Ga0496114_0025411 | Ga0496114_0025411_1277_1585 | 101 |
| 554 | 3300048917 | Ga0496114_0627563 | Ga0496114_0627563_52_360 | 101 |
| 555 | 3300048917 | Ga0496114_0859215 | Ga0496114_0859215_372_677 | 101 |
| 556 | 3300048917 | Ga0496114_0980489 | Ga0496114_0980489_62_367 | 101 |
| 557 | 3300048917 | Ga0496114_1255216 | Ga0496114_1255216_41_355 | 101 |
| 558 | 3300048918 | Ga0496115_0002513 | Ga0496115_0002513_8847_9155 | 101 |
| 559 | 3300048918 | Ga0496115_0018662 | Ga0496115_0018662_1121_1426 | 101 |
| 560 | 3300048918 | Ga0496115_0113212 | Ga0496115_0113212_1896_2201 | 101 |
| 561 | 3300048918 | Ga0496115_0240251 | Ga0496115_0240251_68_373 | 101 |
| 562 | 3300048918 | Ga0496115_0283249 | Ga0496115_0283249_728_1033 | 101 |
| 563 | 3300048918 | Ga0496115_1201506 | Ga0496115_1201506_203_511 | 101 |
| 564 | 3300048918 | Ga0496115_1395858 | Ga0496115_1395858_84_398 | 101 |
| 565 | 3300049571 | Ga0501034_0347104 | Ga0501034_0347104_891_1205 | 101 |
| 566 | 3300049579 | Ga0501043_1272013 | Ga0501043_1272013_12_326 | 101 |
| 567 | 3300049580 | Ga0501046_0525474 | Ga0501046_0525474_353_667 | 101 |
| 568 | 3300049580 | Ga0501046_0574867 | Ga0501046_0574867_345_650 | 101 |
| 569 | 3300049581 | Ga0501047_0030664 | Ga0501047_0030664_2245_2550 | 101 |
| 570 | 3300049581 | Ga0501047_0897287 | Ga0501047_0897287_281_592 | 101 |
| 571 | 3300049583 | Ga0501067_0025573 | Ga0501067_0025573_875_1189 | 101 |
| 572 | 3300049583 | Ga0501067_0251661 | Ga0501067_0251661_492_797 | 101 |
| 573 | 3300049585 | Ga0501069_0212710 | Ga0501069_0212710_356_661 | 101 |
| 574 | 3300049585 | Ga0501069_0548386 | Ga0501069_0548386_130_435 | 101 |
| 575 | 3300049586 | Ga0501070_0014526 | Ga0501070_0014526_227_541 | 101 |
| 576 | 3300049586 | Ga0501070_0104456 | Ga0501070_0104456_978_1283 | 101 |
| 577 | 3300049586 | Ga0501070_0199843 | Ga0501070_0199843_222_527 | 101 |
| 578 | 3300049588 | Ga0501072_0006239 | Ga0501072_0006239_3680_3994 | 101 |
| 579 | 3300049589 | Ga0501073_0179515 | Ga0501073_0179515_56_370 | 101 |
| 580 | 3300049589 | Ga0501073_0225181 | Ga0501073_0225181_694_1008 | 101 |
| 581 | 3300049590 | Ga0501074_0005182 | Ga0501074_0005182_7038_7352 | 101 |
| 582 | 3300049590 | Ga0501074_0006294 | Ga0501074_0006294_3543_3857 | 101 |
| 583 | 3300049590 | Ga0501074_0104417 | Ga0501074_0104417_1677_1982 | 101 |
| 584 | 3300049590 | Ga0501074_0432978 | Ga0501074_0432978_152_457 | 101 |
| 585 | 3300049592 | Ga0501076_0558754 | Ga0501076_0558754_467_781 | 101 |
| 586 | 3300049593 | Ga0501077_0512456 | Ga0501077_0512456_186_500 | 101 |
| 587 | 3300049741 | Ga0501079_0027091 | Ga0501079_0027091_2037_2351 | 101 |
| 588 | 3300049741 | Ga0501079_0563910 | Ga0501079_0563910_453_767 | 101 |
| 589 | 3300049741 | Ga0501079_1488724 | Ga0501079_1488724_188_502 | 101 |
| 590 | 3300049742 | Ga0501080_0021753 | Ga0501080_0021753_5417_5731 | 101 |
| 591 | 3300049742 | Ga0501080_0318824 | Ga0501080_0318824_695_1009 | 101 |
| 592 | 3300049744 | Ga0501083_0005259 | Ga0501083_0005259_510_824 | 101 |
| 593 | 3300049744 | Ga0501083_0844146 | Ga0501083_0844146_69_383 | 101 |
| 594 | 3300049822 | Ga0501035_0909263 | Ga0501035_0909263_239_544 | 101 |
| 595 | 3300049823 | Ga0501044_0584492 | Ga0501044_0584492_275_589 | 101 |
| 596 | 3300050512 | nmdc:mga0n895_54375_c1 | nmdc:mga0n895_54375_c1_2487_2792 | 101 |
| 597 | 3300050513 | nmdc:mga0rr50_21866_c1 | nmdc:mga0rr50_21866_c1_2168_2473 | 101 |
| 598 | 3300050515 | nmdc:mga0a205_33711_c2 | nmdc:mga0a205_33711_c2_837_1142 | 101 |
| 599 | 3300053077 | Ga0495601_0010350 | Ga0495601_0010350_2861_3166 | 101 |
| 600 | 3300053077 | Ga0495601_0093841 | Ga0495601_0093841_528_833 | 101 |
| 601 | 3300053077 | Ga0495601_0720095 | Ga0495601_0720095_293_598 | 101 |
| 602 | 3300053078 | Ga0495612_0050027 | Ga0495612_0050027_48_353 | 101 |
| 603 | 3300053078 | Ga0495612_0172221 | Ga0495612_0172221_562_867 | 101 |
| 604 | 3300053084 | Ga0495595_0004822 | Ga0495595_0004822_3064_3369 | 101 |
| 605 | 3300053084 | Ga0495595_0008213 | Ga0495595_0008213_1057_1362 | 101 |
| 606 | 3300053084 | Ga0495595_0209849 | Ga0495595_0209849_504_809 | 101 |
| 607 | 3300053085 | Ga0495619_0002878 | Ga0495619_0002878_3246_3551 | 101 |
| 608 | 3300053085 | Ga0495619_0004757 | Ga0495619_0004757_6716_7021 | 101 |
| 609 | 3300053085 | Ga0495619_0005166 | Ga0495619_0005166_4672_4977 | 101 |
| 610 | 3300054114 | Ga0501084_0204316 | Ga0501084_0204316_1013_1327 | 101 |
| 611 | 3300059511 | Ga0587091_184499 | Ga0587091_184499_16_321 | 101 |
| 612 | 3300061719 | Ga0466962_0152859 | Ga0466962_0152859_301_615 | 101 |
| 613 | 3300061719 | Ga0466962_0598635 | Ga0466962_0598635_72_377 | 101 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7upo-assembly1.cif.gz_A | crystal structure of designed heterotrimeric assembly dht03 | 0.686 | 11 | 67 |
| 6v7u-assembly1.cif.gz_A | structure of a phage-encoded quorum sensing anti-activator, aqs1 | 0.5746 | 13 | 65 |
| 8d2j-assembly2.cif.gz_C | a novel insecticidal protein from ferns ipd113_cow. | 0.5669 | 13 | 100 |
| 1vcs-assembly1.cif.gz_A | solution structure of rsgi ruh-009, an n-terminal domain of vti1a [mus musculus] | 0.5581 | 18 | 100 |
| 8d2j-assembly1.cif.gz_A | a novel insecticidal protein from ferns ipd113_cow. | 0.5569 | 13 | 101 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4javA01 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Signal transduction histidine kinase, dimerisation/phosphotransfer (DHp) domain | 0.6432 | 6 | 72 | 1.10.287.130 |
| af_Q4D532_1_122_1.25.40.270 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Vacuolar protein sorting-associated protein vta1 | 0.6162 | 15 | 100 | 1.25.40.270 |
| af_Q4E3R3_1_122_1.25.40.270 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Vacuolar protein sorting-associated protein vta1 | 0.6156 | 15 | 100 | 1.25.40.270 |
| af_Q8S0N4_1_99_1.20.58.400 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;t-snare proteins | 0.6049 | 16 | 100 | 1.20.58.400 |
| af_A0A1D6NEE8_1_99_1.20.58.400 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;t-snare proteins | 0.6008 | 16 | 100 | 1.20.58.400 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W1N6L5-F1-model_v4 | Uncharacterized protein | 0.965 | 4 | 101 |
|
| AF-A0A7W0NHV8-F1-model_v4 | Uncharacterized protein | 0.9567 | 2 | 93 |
|
| AF-A0A7V9I497-F1-model_v4 | Uncharacterized protein | 0.9563 | 3 | 101 |
|
| AF-A0A538HSN3-F1-model_v4 | Uncharacterized protein | 0.9556 | 4 | 98 |
|
| AF-A0A537TPC9-F1-model_v4 | Uncharacterized protein | 0.9529 | 9 | 98 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar