F469293

General Info

Members Datasets Scaffolds Average Seq Length
613 257 1226 357

Family's Representative Sequence

Representative Sequence 3300046616|Ga0495668_0000912|Ga0495668_0000912_21599_22849
Length 416
Sequence MEFFEKLASLAAKVRLQSAAIQTEEATKNAFVMPFISTVLGYDVFDPTEVTPEFVCDVGTKKGEKIDYAIMKGGEVQILIECKKIGEPLHINHASQLFRYFHVTSARISILTNGQVYKFFTDLDAPNKMDEKPFLELDLLDIDEYSVPELVKLTKSAFDVDSIINAAGELKYVSQIKKVIAAQVSKPDDDFVKVFASRVYDGVITQKVREQFHELTRKAVAQFLNDQINERLKSAMSGAIAQALVPVPTASGGTDPLVPGDESDDKIITTLEELEGYHIVRALVRSVVDAKRIVQRDTQSYFGILLDDNNRKPICRLHFNRSQKYIGIFDEEKNETRHPISTVDDIYEYSDHLKKRLGTTPDNKPALGGRFFIAYSVISMPTVQLKYPTASHCWFTSMKLNSHCSTPIPFAVQAQK

Samples

Sample ID Description Type Environment
1 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
2 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
5 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
10 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
11 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
12 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
13 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
14 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
15 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
29 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
30 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
31 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
32 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
33 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
34 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
35 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
39 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
40 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
46 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
47 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
48 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
49 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
50 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
51 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
52 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
55 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
70 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
72 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
74 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
75 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
76 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
77 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
78 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
79 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
80 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
81 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
82 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
83 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
84 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
85 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
86 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
87 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
88 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
89 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
90 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
91 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
92 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
93 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
94 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
95 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
96 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
97 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
98 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
99 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
100 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
101 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
102 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
103 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
104 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
105 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
106 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
107 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
108 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
109 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
110 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
111 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
112 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
113 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
114 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
115 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
116 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
117 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
118 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
119 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
120 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
121 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
122 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
123 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
124 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
125 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
126 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
127 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
128 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
129 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
130 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
131 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
132 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
133 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
134 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
135 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
136 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
137 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
138 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
139 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
140 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
141 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
142 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
143 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
144 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
145 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
146 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
147 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
148 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
149 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
150 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
151 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
152 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
153 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
154 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
155 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
156 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
157 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
158 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
159 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
160 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
161 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
162 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
163 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
164 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
165 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
166 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
167 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
168 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
169 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
170 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
171 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
172 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
173 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
174 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
175 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
176 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
177 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
178 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
179 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
180 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
181 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
182 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
183 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
184 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
185 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
186 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
187 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
188 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
189 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
190 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
191 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
192 2511231004 Pseudomonas sp. GM102 Isolate Nodule
193 2511231016 Pseudomonas sp. GM50 Isolate Nodule
194 2511231023 Pseudomonas sp. GM80 Isolate Nodule
195 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
196 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
197 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
198 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
199 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
200 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
201 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
202 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
203 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
204 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
205 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
206 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
207 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
208 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
209 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
210 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
211 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
212 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
213 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
214 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
215 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
216 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
217 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
218 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
219 2739367653 Kocuria sp. OV113 Isolate Unclassified
220 2773857670 Pseudomonas sp. 478 Isolate Unclassified
221 2784132063 Pseudomonas sp. 424 Isolate Unclassified
222 2784132072 Pseudomonas sp. 460 Isolate Unclassified
223 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
224 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
225 2816332305 Kocuria rhizophila FDAARGOS_302 Isolate Rhizosphere
226 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
227 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
228 2865014394 Pantoea sp. R-71966 Isolate Unclassified
229 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
230 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
231 2891088606 Methylosinus sp. 3S-1 Isolate Rhizosphere
232 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
233 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
234 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
235 2919150387 Rahnella aceris 1817 Isolate Unclassified
236 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
237 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
238 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
239 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
240 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
241 2927143783 Rahnella sp. 2050 Isolate Unclassified
242 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
243 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
244 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
245 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
246 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
247 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified
248 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified
249 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
250 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
251 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
252 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
253 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
254 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
255 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
256 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
257 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.23
Metatranscriptomes 0
Isolates 10.77

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.53
Nodule 1.79
Rhizoplane 3.1
Rhizosphere 69.49
Stem 0
Stem Tuber 0
Unclassified 0.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495668_0000912 3300046616 Bacteria 33069
2 MRS2a_Contig_9794 2124908027 Bacteria 1432
3 SwRhRL2b_contig_1005263 2162886007 Bacteria 10829
4 SwRhRL2b_contig_3072008 2162886007 Bacteria 2560
5 SwRhRL2b_contig_3949486 2162886007 Bacteria 15614
6 JGI25158J39367_1010157 3300002739 Bacteria 1275
7 JGI25159J45721_1020436 3300002987 Bacteria 1275
8 rootH2_10097397 3300003320 Bacteria 1598
9 rootL2_10048779 3300003322 Bacteria 10944
10 JGI25160J50197_1033941 3300003354 Bacteria 1275
11 JGI25161J50226_1010185 3300003374 Bacteria 1275
12 Ga0055536_1000043 3300003781 Bacteria 124663
13 Ga0055536_1000227 3300003781 Bacteria 45421
14 Ga0055530_10000031 3300003791 Bacteria 122117
15 Ga0055530_10000094 3300003791 Bacteria 76102
16 Ga0055530_10003114 3300003791 Bacteria 9819
17 Ga0055530_10009354 3300003791 Bacteria 3777
18 Ga0055540_1000130 3300003792 Bacteria 76102
19 Ga0055540_1000161 3300003792 Bacteria 66740
20 Ga0055540_1000442 3300003792 Bacteria 32585
21 Ga0055531_10002314 3300003794 Bacteria 12876
22 Ga0055531_10036799 3300003794 Bacteria 1501
23 Ga0058692_1013240 3300003856 Bacteria 1927
24 Ga0055543_1018187 3300004625 Bacteria 1313
25 Ga0065165_1043736 3300005262 Bacteria 1313
26 Ga0065714_10074817 3300005288 Bacteria 2984
27 Ga0065704_10001369 3300005289 Bacteria 18211
28 Ga0065704_10070477 3300005289 Bacteria 23323
29 Ga0065704_10070553 3300005289 Bacteria 20806
30 Ga0065704_10141131 3300005289 Bacteria 1517
31 Ga0065704_10157362 3300005289 Bacteria 1381
32 Ga0070658_10096114 3300005327 Bacteria 2446
33 Ga0070668_100105264 3300005347 Bacteria 2240
34 Ga0070669_100002540 3300005353 Bacteria 13189
35 Ga0070662_100005940 3300005457 Bacteria 7828
36 Ga0070686_100000055 3300005544 Bacteria 89101
37 Ga0070665_100148574 3300005548 Bacteria 2346
38 Ga0068854_100004716 3300005578 Bacteria 8591
39 Ga0068856_100115611 3300005614 Bacteria 2683
40 Ga0068856_100218934 3300005614 Bacteria 1919
41 Ga0081539_10000132 3300005985 Bacteria 175454
42 Ga0075364_10047485 3300006051 Bacteria 2797
43 Ga0075364_10096578 3300006051 Bacteria 1965
44 Ga0075364_10129909 3300006051 Bacteria 1690
45 Ga0075436_100169880 3300006914 Bacteria 1540
46 Ga0079104_1000059 3300006946 Bacteria 162642
47 Ga0079104_1003509 3300006946 Bacteria 7240
48 Ga0079104_1014022 3300006946 Bacteria 2439
49 Ga0105251_10000018 3300009011 Bacteria 142493
50 Ga0105251_10002673 3300009011 Bacteria 13730
51 Ga0105251_10004093 3300009011 Bacteria 10210
52 Ga0105251_10005208 3300009011 Bacteria 8572
53 Ga0105251_10013525 3300009011 Bacteria 4561
54 Ga0105251_10025143 3300009011 Bacteria 3050
55 Ga0105251_10050311 3300009011 Bacteria 1991
56 Ga0105251_10064115 3300009011 Bacteria 1723
57 Ga0105251_10065790 3300009011 Bacteria 1696
58 Ga0105251_10077312 3300009011 Bacteria 1543
59 Ga0105244_10020404 3300009036 Bacteria 3683
60 Ga0105244_10023005 3300009036 Bacteria 3424
61 Ga0105244_10034456 3300009036 Bacteria 2665
62 Ga0105244_10038057 3300009036 Bacteria 2510
63 Ga0105244_10042277 3300009036 Bacteria 2357
64 Ga0105244_10066366 3300009036 Bacteria 1806
65 Ga0105244_10068372 3300009036 Bacteria 1775
66 Ga0105244_10086097 3300009036 Bacteria 1550
67 Ga0105250_10002104 3300009092 Bacteria 10222
68 Ga0105250_10003350 3300009092 Bacteria 7614
69 Ga0105250_10008209 3300009092 Bacteria 4445
70 Ga0105250_10013409 3300009092 Bacteria 3376
71 Ga0105250_10045069 3300009092 Bacteria 1768
72 Ga0105250_10053992 3300009092 Bacteria 1611
73 Ga0105250_10057323 3300009092 Bacteria 1563
74 Ga0105250_10057832 3300009092 Bacteria 1556
75 Ga0105250_10075534 3300009092 Bacteria 1363
76 Ga0105247_10030070 3300009101 Bacteria 3293
77 Ga0105243_10000196 3300009148 Bacteria 71069
78 Ga0105248_10023148 3300009177 Bacteria 6899
79 Ga0105239_10071346 3300010375 Bacteria 3816
80 Ga0105246_10084034 3300011119 Bacteria 2276
81 Ga0157373_10010108 3300013100 Bacteria 6951
82 Ga0157373_10015814 3300013100 Bacteria 5509
83 Ga0157373_10019922 3300013100 Bacteria 4880
84 Ga0157373_10021580 3300013100 Bacteria 4676
85 Ga0157373_10055505 3300013100 Bacteria 2814
86 Ga0157373_10131247 3300013100 Bacteria 1762
87 Ga0157371_10000044 3300013102 Bacteria 194689
88 Ga0157371_10024651 3300013102 Bacteria 4390
89 Ga0157371_10046556 3300013102 Bacteria 3085
90 Ga0157371_10083121 3300013102 Bacteria 2267
91 Ga0157371_10116206 3300013102 Bacteria 1901
92 Ga0157371_10146160 3300013102 Bacteria 1685
93 Ga0157370_10036532 3300013104 Bacteria 4767
94 Ga0157370_10164421 3300013104 Bacteria 2064
95 Ga0157370_10208633 3300013104 Bacteria 1811
96 Ga0157370_10373829 3300013104 Bacteria 1313
97 Ga0157369_10015985 3300013105 Bacteria 8444
98 Ga0157369_10072450 3300013105 Unclassified 3698
99 Ga0157369_10089027 3300013105 Bacteria 3296
100 Ga0157369_10164169 3300013105 Bacteria 2343
101 Ga0163162_10183455 3300013306 Bacteria 2219
102 Ga0163162_10203791 3300013306 Bacteria 2107
103 Ga0163162_10309922 3300013306 Bacteria 1711
104 Ga0157372_10001040 3300013307 Bacteria 30363
105 Ga0157372_10033066 3300013307 Bacteria 5677
106 Ga0157372_10039970 3300013307 Bacteria 5179
107 Ga0157372_10044327 3300013307 Bacteria 4928
108 Ga0157372_10295859 3300013307 Bacteria 1883
109 Ga0182008_10006185 3300014497 Bacteria 6727
110 Ga0182008_10110299 3300014497 Bacteria 1363
111 Ga0182006_1004345 3300015261 Bacteria 7007
112 Ga0182006_1034341 3300015261 Bacteria 2029
113 Ga0182006_1039090 3300015261 Bacteria 1874
114 Ga0182006_1050282 3300015261 Bacteria 1606
115 Ga0182006_1050738 3300015261 Bacteria 1598
116 Ga0182006_1057056 3300015261 Bacteria 1486
117 Ga0182007_10045959 3300015262 Bacteria 1446
118 Ga0182007_10051157 3300015262 Bacteria 1363
119 Ga0182005_1025302 3300015265 Bacteria 1620
120 Ga0182005_1025554 3300015265 Bacteria 1612
121 Ga0163161_10000522 3300017792 Bacteria 31370
122 Ga0163161_10019422 3300017792 Bacteria 4767
123 Ga0163161_10024826 3300017792 Bacteria 4237
124 Ga0163161_10034810 3300017792 Bacteria 3603
125 Ga0163161_10125147 3300017792 Bacteria 1935
126 Ga0163161_10150498 3300017792 Bacteria 1768
127 Ga0163161_10181253 3300017792 Bacteria 1615
128 Ga0209436_113554 3300025208 Bacteria 1327
129 Ga0209130_1024229 3300025284 Bacteria 1327
130 Ga0209676_1000016 3300025292 Bacteria 655561
131 Ga0209676_1000080 3300025292 Bacteria 287400
132 Ga0209676_1003039 3300025292 Bacteria 10848
133 Ga0209050_1000036 3300025298 Bacteria 423070
134 Ga0209050_1000079 3300025298 Bacteria 277803
135 Ga0209050_1000117 3300025298 Bacteria 202979
136 Ga0209050_1024119 3300025298 Bacteria 2117
137 Ga0209050_1033293 3300025298 Bacteria 1565
138 Ga0207426_1045871 3300025302 Bacteria 1327
139 Ga0209051_1000054 3300025303 Bacteria 280804
140 Ga0209051_1000077 3300025303 Bacteria 202959
141 Ga0209051_1000094 3300025303 Bacteria 168538
142 Ga0209257_1000173 3300025304 Bacteria 166678
143 Ga0209257_1007132 3300025304 Bacteria 6874
144 Ga0207696_1000083 3300025711 Bacteria 197352
145 Ga0207696_1000743 3300025711 Bacteria 21773
146 Ga0207696_1001411 3300025711 Bacteria 13119
147 Ga0207696_1013861 3300025711 Bacteria 2785
148 Ga0207696_1016192 3300025711 Bacteria 2501
149 Ga0207696_1017157 3300025711 Bacteria 2404
150 Ga0207696_1031031 3300025711 Bacteria 1619
151 Ga0207696_1031891 3300025711 Bacteria 1590
152 Ga0207696_1032936 3300025711 Bacteria 1556
153 Ga0207696_1041765 3300025711 Bacteria 1339
154 Ga0207655_1001403 3300025728 Bacteria 22459
155 Ga0207655_1011841 3300025728 Bacteria 5153
156 Ga0207655_1032478 3300025728 Bacteria 2384
157 Ga0207655_1035622 3300025728 Bacteria 2219
158 Ga0207655_1037386 3300025728 Bacteria 2138
159 Ga0207655_1055445 3300025728 Bacteria 1569
160 Ga0207713_1000156 3300025735 Bacteria 102640
161 Ga0207713_1002302 3300025735 Bacteria 14047
162 Ga0207713_1002375 3300025735 Bacteria 13763
163 Ga0207713_1003752 3300025735 Bacteria 10202
164 Ga0207713_1007149 3300025735 Bacteria 6660
165 Ga0207713_1019263 3300025735 Bacteria 3346
166 Ga0207713_1031916 3300025735 Bacteria 2321
167 Ga0207713_1042771 3300025735 Bacteria 1878
168 Ga0207710_10015947 3300025900 Bacteria 3177
169 Ga0207705_10053797 3300025909 Bacteria 2901
170 Ga0207681_10000386 3300025923 Bacteria 30907
171 Ga0207706_10000056 3300025933 Bacteria 113022
172 Ga0207709_10273025 3300025935 Bacteria 1245
173 Ga0207711_10075864 3300025941 Bacteria 2927
174 Ga0207668_10206358 3300025972 Bacteria 1568
175 Ga0207640_10040147 3300025981 Bacteria 2966
176 Ga0207702_10087537 3300026078 Bacteria 2719
177 Ga0209281_1000065 3300027111 Bacteria 285579
178 Ga0209281_1000774 3300027111 Bacteria 30468
179 Ga0209281_1001095 3300027111 Bacteria 19831
180 Ga0209281_1013296 3300027111 Bacteria 1781
181 Ga0209371_1004524 3300027312 Bacteria 5980
182 Ga0207428_10037980 3300027907 Bacteria 3918
183 Ga0207428_10087366 3300027907 Bacteria 2426
184 Ga0207428_10147699 3300027907 Bacteria 1791
185 Ga0268266_10028121 3300028379 Bacteria 4780
186 Ga0307515_10007850 3300028794 Bacteria 20974
187 Ga0268256_1002736 3300030500 Bacteria 8617
188 Ga0307512_10005973 3300030522 Bacteria 12497
189 Ga0316179_1110150 3300030734 Bacteria 4866
190 Ga0316183_1130390 3300030742 Bacteria 4308
191 Ga0265331_10071876 3300031250 Bacteria 1617
192 Ga0265327_10000027 3300031251 Bacteria 364541
193 Ga0307408_100021721 3300031548 Bacteria 4347
194 Ga0307408_100139095 3300031548 Bacteria 1904
195 Ga0307408_100244184 3300031548 Bacteria 1477
196 Ga0307405_10052513 3300031731 Bacteria 2535
197 Ga0307412_10134311 3300031911 Bacteria 1802
198 Ga0307412_10136999 3300031911 Bacteria 1787
199 Ga0307416_100207862 3300032002 Bacteria 1864
200 Ga0307414_10138002 3300032004 Bacteria 1904
201 Ga0307510_10000338 3300033180 Bacteria 43774
202 Ga0373925_0008930 3300037068 Bacteria 7302
203 Ga0237819_00554 3300038705 Bacteria 12547
204 Ga0400488_22115 3300038741 Bacteria 2576
205 Ga0400483_090640 3300039062 Bacteria 2178
206 Ga0400487_00700 3300039110 Viruses 1379
207 Ga0436365_0192868 3300039437 Unclassified 1236
208 Ga0439438_000005 3300041405 Bacteria 408610
209 Ga0439438_000184 3300041405 Bacteria 28007
210 Ga0439438_000885 3300041405 Bacteria 13347
211 Ga0439438_000924 3300041405 Bacteria 13114
212 Ga0439438_001047 3300041405 Bacteria 12316
213 Ga0439438_002883 3300041405 Bacteria 7148
214 Ga0439438_009382 3300041405 Bacteria 3170
215 Ga0439438_026376 3300041405 Bacteria 1575
216 Ga0439438_031273 3300041405 Bacteria 1415
217 Ga0439447_001821 3300041407 Bacteria 7815
218 Ga0439447_002560 3300041407 Bacteria 6614
219 Ga0439447_008514 3300041407 Bacteria 3170
220 Ga0439447_020958 3300041407 Bacteria 1726
221 Ga0439447_029690 3300041407 Bacteria 1382
222 Ga0439466_0001623 3300041411 Bacteria 8788
223 Ga0439466_0001754 3300041411 Bacteria 8488
224 Ga0439466_0008936 3300041411 Bacteria 3766
225 Ga0439466_0012203 3300041411 Bacteria 3170
226 Ga0439466_0041683 3300041411 Bacteria 1530
227 Ga0439466_0046282 3300041411 Bacteria 1437
228 Ga0439431_0000041 3300041997 Bacteria 18802
229 Ga0439432_001733 3300042006 Bacteria 8167
230 Ga0439432_010745 3300042006 Bacteria 3165
231 Ga0439432_023362 3300042006 Bacteria 2037
232 Ga0439432_036324 3300042006 Bacteria 1576
233 Ga0439451_001507 3300042009 Bacteria 4595
234 Ga0439451_014899 3300042009 Bacteria 1568
235 Ga0439452_001380 3300042010 Bacteria 10001
236 Ga0439452_002007 3300042010 Bacteria 7786
237 Ga0439452_008144 3300042010 Bacteria 3170
238 Ga0439452_023712 3300042010 Bacteria 1576
239 Ga0439456_015828 3300042013 Bacteria 1576
240 Ga0439463_025361 3300042016 Bacteria 1487
241 Ga0450911_000245 3300042115 Bacteria 20565
242 Ga0450920_000596 3300042122 Bacteria 5776
243 Ga0450922_000143 3300042124 Bacteria 7452
244 Ga0450923_007593 3300042125 Bacteria 1840
245 Ga0450890_000068 3300042127 Bacteria 18424
246 Ga0450902_001595 3300042137 Bacteria 3114
247 Ga0450903_008948 3300042138 Bacteria 1636
248 Ga0450906_008647 3300042145 Bacteria 1963
249 Ga0450906_012847 3300042145 Bacteria 1549
250 Ga0450907_000007 3300042146 Bacteria 111445
251 Ga0450907_000041 3300042146 Bacteria 56455
252 Ga0450907_000756 3300042146 Bacteria 8178
253 Ga0450908_007783 3300042184 Bacteria 2013
254 Ga0450909_000107 3300042185 Bacteria 8225
255 Ga0450909_001186 3300042185 Bacteria 3618
256 Ga0439434_0000029 3300042435 Bacteria 35254
257 Ga0439464_0013526 3300042439 Bacteria 2186
258 Ga0439460_0031142 3300042461 Bacteria 1520
259 Ga0453684_0087962 3300044712 Bacteria 3848
260 Ga0495617_002507 3300046452 Bacteria 7276
261 Ga0495617_013335 3300046452 Bacteria 2796
262 Ga0495617_052904 3300046452 Bacteria 1348
263 Ga0495627_000004 3300046453 Bacteria 640612
264 Ga0495627_001368 3300046453 Bacteria 14562
265 Ga0495603_0036482 3300046455 Bacteria 2952
266 Ga0495603_0054772 3300046455 Bacteria 2363
267 Ga0495603_0061474 3300046455 Bacteria 2218
268 Ga0495590_0014217 3300046457 Bacteria 2909
269 Ga0495591_000831 3300046458 Bacteria 21826
270 Ga0495591_030883 3300046458 Bacteria 1613
271 Ga0495638_0001131 3300046460 Bacteria 25808
272 Ga0495638_0001939 3300046460 Bacteria 17744
273 Ga0495638_0004663 3300046460 Bacteria 10367
274 Ga0495638_0005491 3300046460 Bacteria 9425
275 Ga0495638_0043347 3300046460 Bacteria 2838
276 Ga0495638_0139333 3300046460 Bacteria 1417
277 Ga0495653_0021455 3300046463 Bacteria 5232
278 Ga0495650_0000039 3300046471 Bacteria 375501
279 Ga0495650_0000062 3300046471 Bacteria 277977
280 Ga0495650_0000816 3300046471 Bacteria 37924
281 Ga0495650_0001935 3300046471 Bacteria 18335
282 Ga0495650_0002360 3300046471 Bacteria 15511
283 Ga0495650_0008277 3300046471 Bacteria 6092
284 Ga0495650_0008585 3300046471 Bacteria 5934
285 Ga0495650_0008766 3300046471 Bacteria 5852
286 Ga0495650_0024018 3300046471 Bacteria 2888
287 Ga0495605_0000462 3300046474 Bacteria 36406
288 Ga0495605_0001071 3300046474 Bacteria 18244
289 Ga0495605_0022596 3300046474 Bacteria 3319
290 Ga0495605_0027577 3300046474 Bacteria 2942
291 Ga0495584_0007251 3300046491 Bacteria 5785
292 Ga0495584_0011458 3300046491 Bacteria 4541
293 Ga0495585_0000700 3300046492 Bacteria 30394
294 Ga0495585_0004622 3300046492 Bacteria 8888
295 Ga0495585_0015009 3300046492 Bacteria 4503
296 Ga0495585_0016684 3300046492 Bacteria 4254
297 Ga0495596_0000075 3300046500 Bacteria 69681
298 Ga0495596_0027193 3300046500 Bacteria 2301
299 Ga0495596_0036399 3300046500 Bacteria 1949
300 Ga0495607_0009695 3300046501 Bacteria 6501
301 Ga0495607_0017442 3300046501 Bacteria 4608
302 Ga0495607_0056504 3300046501 Bacteria 2253
303 Ga0495607_0075710 3300046501 Bacteria 1864
304 Ga0495607_0105234 3300046501 Bacteria 1504
305 Ga0495583_0009215 3300046506 Bacteria 5920
306 Ga0495583_0034634 3300046506 Bacteria 2416
307 Ga0495606_0000042 3300046507 Bacteria 215099
308 Ga0495606_0000740 3300046507 Bacteria 50470
309 Ga0495606_0001625 3300046507 Bacteria 29285
310 Ga0495606_0005303 3300046507 Bacteria 12414
311 Ga0495606_0008195 3300046507 Bacteria 9142
312 Ga0495610_0002069 3300046512 Bacteria 17119
313 Ga0495610_0021524 3300046512 Bacteria 3545
314 Ga0495616_0003396 3300046513 Bacteria 10208
315 Ga0495620_0000517 3300046515 Bacteria 24926
316 Ga0495631_0014295 3300046518 Bacteria 3835
317 Ga0495632_0000341 3300046519 Bacteria 44339
318 Ga0495632_0003301 3300046519 Bacteria 11512
319 Ga0495632_0011627 3300046519 Bacteria 5126
320 Ga0495632_0017012 3300046519 Bacteria 4027
321 Ga0495632_0052568 3300046519 Bacteria 2002
322 Ga0495637_0000580 3300046520 Bacteria 26042
323 Ga0495637_0003015 3300046520 Bacteria 9028
324 Ga0495637_0003021 3300046520 Bacteria 9022
325 Ga0495637_0003198 3300046520 Bacteria 8740
326 Ga0495637_0018560 3300046520 Bacteria 3225
327 Ga0495637_0042764 3300046520 Bacteria 1937
328 Ga0495643_0019970 3300046522 Bacteria 3870
329 Ga0495643_0038900 3300046522 Bacteria 2602
330 Ga0495643_0050158 3300046522 Bacteria 2248
331 Ga0495643_0088949 3300046522 Bacteria 1595
332 Ga0495648_0000314 3300046524 Bacteria 53429
333 Ga0495648_0001666 3300046524 Bacteria 21528
334 Ga0495648_0013206 3300046524 Bacteria 6121
335 Ga0495648_0043728 3300046524 Bacteria 2804
336 Ga0495648_0096684 3300046524 Bacteria 1640
337 Ga0495648_0099588 3300046524 Bacteria 1607
338 Ga0495654_0000675 3300046530 Bacteria 26908
339 Ga0495654_0002824 3300046530 Bacteria 10915
340 Ga0495654_0005902 3300046530 Bacteria 7043
341 Ga0495654_0009990 3300046530 Bacteria 5183
342 Ga0495654_0013066 3300046530 Bacteria 4448
343 Ga0495654_0016270 3300046530 Bacteria 3936
344 Ga0495654_0019402 3300046530 Bacteria 3556
345 Ga0495654_0026620 3300046530 Bacteria 2971
346 Ga0495654_0053951 3300046530 Bacteria 1951
347 Ga0495654_0059454 3300046530 Bacteria 1840
348 Ga0495654_0087111 3300046530 Bacteria 1454
349 Ga0495609_0041257 3300046538 Bacteria 2074
350 Ga0495609_0052735 3300046538 Bacteria 1809
351 Ga0495597_0000832 3300046542 Bacteria 24275
352 Ga0495597_0032994 3300046542 Bacteria 2347
353 Ga0495597_0064653 3300046542 Bacteria 1588
354 Ga0495622_0000441 3300046557 Bacteria 26822
355 Ga0495622_0055220 3300046557 Bacteria 1842
356 Ga0495622_0065299 3300046557 Bacteria 1682
357 Ga0495622_0068462 3300046557 Bacteria 1639
358 Ga0495633_0000443 3300046558 Bacteria 42796
359 Ga0495633_0001797 3300046558 Bacteria 15826
360 Ga0495633_0006287 3300046558 Bacteria 7076
361 Ga0495656_0006368 3300046615 Bacteria 4139
362 Ga0495668_0000195 3300046616 Bacteria 89153
363 Ga0495668_0072747 3300046616 Bacteria 1888
364 Ga0495634_0001010 3300046642 Bacteria 26441
365 Ga0495611_0066639 3300046648 Bacteria 1642
366 Ga0495625_0011256 3300046660 Bacteria 7315
367 Ga0495625_0030955 3300046660 Bacteria 3985
368 Ga0495625_0057807 3300046660 Bacteria 2757
369 Ga0495625_0126720 3300046660 Bacteria 1732
370 Ga0495661_0001080 3300046665 Bacteria 23989
371 Ga0495661_0013577 3300046665 Bacteria 5467
372 Ga0495646_0037110 3300046680 Bacteria 3017
373 Ga0495669_0004460 3300046684 Bacteria 5782
374 Ga0495613_0006736 3300046689 Bacteria 8579
375 Ga0495670_0000132 3300046691 Bacteria 32251
376 Ga0495670_0000533 3300046691 Bacteria 18075
377 Ga0495670_0002962 3300046691 Bacteria 8379
378 Ga0495670_0010627 3300046691 Bacteria 4523
379 Ga0495671_0008074 3300046692 Bacteria 5942
380 Ga0495671_0012558 3300046692 Bacteria 4621
381 Ga0495671_0020654 3300046692 Bacteria 3468
382 Ga0495649_0000601 3300046694 Bacteria 29997
383 Ga0495649_0004465 3300046694 Bacteria 9141
384 Ga0495649_0004494 3300046694 Bacteria 9102
385 Ga0495649_0008493 3300046694 Bacteria 6172
386 Ga0495649_0009591 3300046694 Bacteria 5740
387 Ga0495649_0028318 3300046694 Bacteria 3105
388 Ga0495649_0035581 3300046694 Bacteria 2739
389 Ga0495649_0069870 3300046694 Bacteria 1883
390 Ga0495649_0084628 3300046694 Bacteria 1693
391 Ga0495649_0116169 3300046694 Bacteria 1416
392 Ga0495589_0009643 3300046794 Bacteria 5019
393 Ga0495589_0016301 3300046794 Bacteria 3819
394 Ga0495589_0018848 3300046794 Bacteria 3538
395 Ga0495589_0030018 3300046794 Bacteria 2739
396 Ga0495589_0070295 3300046794 Bacteria 1711
397 Ga0495600_0016587 3300046809 Bacteria 4677
398 Ga0495660_0000023 3300046810 Bacteria 272605
399 Ga0495660_0001485 3300046810 Bacteria 15910
400 Ga0495660_0001575 3300046810 Bacteria 15325
401 Ga0495660_0006210 3300046810 Bacteria 7088
402 Ga0495660_0022046 3300046810 Bacteria 3640
403 Ga0495660_0031638 3300046810 Bacteria 2974
404 Ga0495660_0051560 3300046810 Bacteria 2238
405 Ga0495660_0066268 3300046810 Bacteria 1926
406 Ga0495660_0068246 3300046810 Bacteria 1892
407 Ga0495604_0034209 3300047317 Bacteria 4021
408 Ga0495636_0031142 3300047318 Bacteria 2185
409 Ga0495672_0000011 3300047320 Bacteria 535362
410 Ga0495672_0000040 3300047320 Bacteria 268573
411 Ga0495672_0004581 3300047320 Bacteria 11236
412 Ga0495672_0005408 3300047320 Bacteria 10141
413 Ga0495672_0006402 3300047320 Bacteria 9138
414 Ga0495672_0013359 3300047320 Bacteria 5670
415 Ga0495680_0099303 3300047322 Bacteria 2171
416 Ga0495680_0181572 3300047322 Bacteria 1518
417 Ga0495683_0011030 3300047323 Bacteria 4765
418 Ga0495683_0027714 3300047323 Bacteria 2896
419 Ga0495683_0038662 3300047323 Bacteria 2415
420 Ga0495683_0053665 3300047323 Bacteria 2010
421 Ga0495683_0092195 3300047323 Bacteria 1466
422 Ga0495687_003347 3300047443 Bacteria 11716
423 Ga0495687_008029 3300047443 Bacteria 6100
424 Ga0495677_0000197 3300047445 Bacteria 27861
425 Ga0495679_000016 3300047446 Bacteria 282024
426 Ga0495679_001724 3300047446 Bacteria 12087
427 Ga0495679_027265 3300047446 Bacteria 1888
428 Ga0495673_0000128 3300047469 Bacteria 139672
429 Ga0495673_0000535 3300047469 Bacteria 39346
430 Ga0495673_0003340 3300047469 Bacteria 10624
431 Ga0495673_0008062 3300047469 Bacteria 5968
432 Ga0495673_0010611 3300047469 Bacteria 4999
433 Ga0495673_0023571 3300047469 Bacteria 2991
434 Ga0495681_0001336 3300047470 Bacteria 18599
435 Ga0495681_0031690 3300047470 Bacteria 2672
436 Ga0495681_0071721 3300047470 Bacteria 1567
437 Ga0495686_0011529 3300047472 Bacteria 6226
438 Ga0495686_0032512 3300047472 Bacteria 3376
439 Ga0495626_0000724 3300048091 Bacteria 30862
440 Ga0495626_0001079 3300048091 Bacteria 23225
441 Ga0495626_0006789 3300048091 Bacteria 6469
442 Ga0495626_0011234 3300048091 Bacteria 4743
443 Ga0495626_0012066 3300048091 Bacteria 4546
444 Ga0495626_0044571 3300048091 Bacteria 2074
445 Ga0496104_0000219 3300048907 Bacteria 50064
446 Ga0496110_0455239 3300048913 Viruses 1166
447 Ga0496114_0026083 3300048917 Bacteria 4782
448 Ga0496116_0000126 3300048919 Bacteria 160425
449 Ga0496116_0000917 3300048919 Bacteria 36435
450 Ga0496116_0002322 3300048919 Bacteria 20140
451 Ga0496116_0031758 3300048919 Bacteria 3774
452 Ga0496116_0055569 3300048919 Bacteria 2599
453 Ga0496117_0000623 3300048920 Bacteria 57364
454 Ga0496117_0001894 3300048920 Bacteria 28078
455 Ga0496117_0002812 3300048920 Bacteria 21197
456 Ga0496117_0003267 3300048920 Bacteria 19056
457 Ga0496117_0006508 3300048920 Bacteria 11779
458 Ga0496117_0014842 3300048920 Bacteria 6684
459 Ga0496117_0030304 3300048920 Bacteria 4154
460 Ga0496117_0047327 3300048920 Bacteria 3084
461 Ga0496117_0060838 3300048920 Bacteria 2599
462 Ga0496117_0077044 3300048920 Bacteria 2208
463 Ga0496118_0000684 3300048921 Bacteria 55100
464 Ga0496118_0002921 3300048921 Bacteria 22204
465 Ga0496118_0018165 3300048921 Bacteria 6354
466 Ga0496118_0024582 3300048921 Bacteria 5195
467 Ga0496118_0024735 3300048921 Bacteria 5172
468 Ga0496118_0035528 3300048921 Bacteria 4044
469 Ga0496118_0073296 3300048921 Bacteria 2453
470 Ga0496118_0087208 3300048921 Bacteria 2165
471 Ga0496118_0141078 3300048921 Bacteria 1527
472 Ga0496119_0005609 3300048922 Bacteria 11934
473 Ga0496119_0023365 3300048922 Bacteria 4388
474 Ga0496119_0028163 3300048922 Bacteria 3841
475 Ga0496119_0031604 3300048922 Bacteria 3545
476 Ga0496119_0053682 3300048922 Bacteria 2459
477 Ga0496119_0063175 3300048922 Bacteria 2203
478 Ga0496119_0094724 3300048922 Bacteria 1688
479 Ga0496120_0011119 3300048923 Bacteria 6212
480 Ga0496120_0014868 3300048923 Bacteria 5161
481 Ga0496120_0049105 3300048923 Bacteria 2423
482 Ga0496120_0095202 3300048923 Bacteria 1583
483 Ga0496120_0108003 3300048923 Bacteria 1458
484 Ga0496121_0000142 3300048924 Bacteria 160072
485 Ga0496121_0001953 3300048924 Bacteria 32867
486 Ga0496121_0002695 3300048924 Bacteria 26553
487 Ga0496121_0002876 3300048924 Bacteria 25361
488 Ga0496121_0021741 3300048924 Bacteria 6268
489 Ga0496121_0037332 3300048924 Bacteria 4316
490 Ga0496121_0069120 3300048924 Bacteria 2852
491 Ga0496121_0107575 3300048924 Bacteria 2135
492 Ga0496121_0111843 3300048924 Bacteria 2081
493 Ga0496122_0000067 3300048925 Bacteria 231365
494 Ga0496122_0030111 3300048925 Bacteria 4557
495 Ga0496122_0032105 3300048925 Bacteria 4349
496 Ga0496122_0045063 3300048925 Bacteria 3432
497 Ga0496122_0048097 3300048925 Bacteria 3284
498 Ga0496122_0049728 3300048925 Bacteria 3205
499 Ga0496122_0062428 3300048925 Bacteria 2727
500 Ga0496122_0090762 3300048925 Bacteria 2083
501 Ga0496122_0132471 3300048925 Bacteria 1580
502 Ga0496123_0000056 3300048926 Bacteria 231365
503 Ga0496123_0036238 3300048926 Bacteria 3501
504 Ga0496123_0036286 3300048926 Bacteria 3498
505 Ga0496123_0044396 3300048926 Bacteria 3040
506 Ga0496123_0048318 3300048926 Bacteria 2863
507 Ga0496123_0078730 3300048926 Bacteria 2017
508 Ga0496123_0105311 3300048926 Bacteria 1628
509 Ga0496124_0000251 3300048927 Bacteria 103690
510 Ga0496124_0002208 3300048927 Bacteria 25928
511 Ga0496124_0003628 3300048927 Bacteria 18738
512 Ga0496124_0055658 3300048927 Bacteria 3341
513 Ga0496124_0063002 3300048927 Bacteria 3100
514 Ga0496124_0069474 3300048927 Bacteria 2924
515 Ga0496124_0109298 3300048927 Bacteria 2228
516 Ga0496124_0197210 3300048927 Bacteria 1534
517 Ga0496124_0281381 3300048927 Bacteria 1212
518 Ga0496125_0000183 3300048928 Bacteria 137652
519 Ga0496125_0013810 3300048928 Bacteria 7910
520 Ga0496125_0014700 3300048928 Bacteria 7607
521 Ga0496125_0017357 3300048928 Bacteria 6865
522 Ga0496125_0018757 3300048928 Bacteria 6556
523 Ga0496125_0024596 3300048928 Bacteria 5533
524 Ga0496125_0029031 3300048928 Bacteria 4979
525 Ga0496125_0055869 3300048928 Bacteria 3211
526 Ga0496125_0077437 3300048928 Bacteria 2563
527 Ga0496126_0008717 3300048929 Bacteria 10892
528 Ga0496126_0032838 3300048929 Bacteria 4885
529 Ga0496126_0092289 3300048929 Bacteria 2660
530 Ga0496126_0101234 3300048929 Bacteria 2520
531 Ga0496126_0293587 3300048929 Bacteria 1343
532 Ga0495678_003266 3300049459 Bacteria 10133
533 Ga0495678_008130 3300049459 Bacteria 5340
534 Ga0495678_009503 3300049459 Bacteria 4808
535 Ga0495678_011583 3300049459 Bacteria 4214
536 Ga0495678_025147 3300049459 Bacteria 2561
537 Ga0495678_030760 3300049459 Bacteria 2243
538 Ga0495678_041828 3300049459 Bacteria 1830
539 Ga0495682_0000005 3300049460 Bacteria 360387
540 Ga0495682_0044831 3300049460 Bacteria 1617
541 Ga0495682_0070167 3300049460 Bacteria 1261
542 Ga0501223_010448 3300049663 Bacteria 1867
543 Ga0501269_000661 3300049766 Bacteria 5926
544 nmdc:mga00v17_86554_c1 3300050491 Bacteria 1964
545 Ga0500621_024312 3300053126 Bacteria 2358
546 Ga0500659_0002792 3300053135 Bacteria 10437
547 Ga0500634_0000039 3300053161 Bacteria 62173
548 2511256460 2511231004 Bacteria 6669789
549 2511329269 2511231016 Bacteria 6704427
550 2511366434 2511231023 Bacteria 6808468
551 2555668385 2554235341 Bacteria 6867980
552 2588108256 2585428157 Bacteria 3018951
553 2597871903 2597489889 Bacteria 6297495
554 2599331091 2599185155 Bacteria 5827168
555 2599501088 2599185188 Bacteria 6164180
556 2599515155 2599185190 Bacteria 6285678
557 2599773058 2599185248 Bacteria 6696816
558 2599894535 2599185290 Bacteria 6289611
559 2599942814 2599185302 Bacteria 5954930
560 2599953563 2599185304 Bacteria 5951361
561 2600026067 2599185316 Bacteria 6320029
562 2600046934 2599185320 Bacteria 5963263
563 2600080045 2599185325 Bacteria 6324919
564 2601799872 2600255318 Bacteria 6383414
565 2606074329 2603880185 Bacteria 6379190
566 2606127192 2603880199 Bacteria 6377649
567 2643869664 2643221571 Bacteria 6228673
568 2643952005 2643221589 Bacteria 6250934
569 2644024236 2643221602 Bacteria 6249926
570 2671109157 2667528173 Bacteria 5375747
571 2671585102 2671180115 Bacteria 5353919
572 2718633030 2718217725 Bacteria 5758958
573 2739198675 2738543004 Bacteria 6381073
574 2739256565 2738543015 Bacteria 6750701
575 2739604427 2739367653 Bacteria 2780952
576 2774121441 2773857670 Bacteria 6407454
577 2784260128 2784132063 Bacteria 6262788
578 2784315671 2784132072 Bacteria 6596533
579 2808960919 2808606382 Bacteria 6841132
580 2809216118 2808606445 Bacteria 6057339
581 2817509950 2816332305 Bacteria 2697803
582 2819654619 2818991456 Bacteria 6123676
583 2823422265 2823421272 Bacteria 5372474
584 2865014939 2865014394 Bacteria 4764573
585 2880233802 2880230671 Bacteria 6140320
586 2885085758 2885080285 Bacteria 6355622
587 2891090259 2891088606 Bacteria 4762464
588 2904477566 2904474040 Bacteria 5504324
589 2904522437 2904518522 Bacteria 6068986
590 2917072153 2917070673 Bacteria 6868303
591 2919153727 2919150387 Bacteria 5500879
592 2919390334 2919385768 Bacteria 5897293
593 2919483185 2919481497 Bacteria 6907839
594 2919506103 2919501602 Bacteria 5286340
595 2919523762 2919523602 Bacteria 3788128
596 2926067598 2926063275 Bacteria 5285848
597 2927147257 2927143783 Bacteria 5504251
598 2931395876 2931390751 Bacteria 6273349
599 2939637765 2939636861 Bacteria 6297853
600 2946033088 2946027586 Bacteria 6049274
601 2947233859 2947233263 Bacteria 6439278
602 2969305936 2969304461 Bacteria 6601805
603 2978977681 2978975091 Bacteria 4704313
604 2990200550 2990196909 Bacteria 4054280
605 2998141349 2998139840 Bacteria 6073514
606 3007616200 3007614139 Bacteria 6053559
607 3007620492 3007619802 Bacteria 6411688
608 8054288891 8054285046 Bacteria 6919322
609 8054353070 8054347763 Bacteria 5901107
610 8056150570 8056148874 Bacteria 6479865
611 8056159422 8056155041 Bacteria 6486948
612 8056163047 8056161164 Bacteria 6106669
613 8057801074 8057798959 Bacteria 6713499
614 Ga0495668_0000912
615 MRS2a_Contig_9794
616 SwRhRL2b_contig_1005263
617 SwRhRL2b_contig_3072008
618 SwRhRL2b_contig_3949486
619 JGI25158J39367_1010157
620 JGI25159J45721_1020436
621 rootH2_10097397
622 rootL2_10048779
623 JGI25160J50197_1033941
624 JGI25161J50226_1010185
625 Ga0055536_1000043
626 Ga0055536_1000227
627 Ga0055530_10000031
628 Ga0055530_10000094
629 Ga0055530_10003114
630 Ga0055530_10009354
631 Ga0055540_1000130
632 Ga0055540_1000161
633 Ga0055540_1000442
634 Ga0055531_10002314
635 Ga0055531_10036799
636 Ga0058692_1013240
637 Ga0055543_1018187
638 Ga0065165_1043736
639 Ga0065714_10074817
640 Ga0065704_10001369
641 Ga0065704_10070477
642 Ga0065704_10070553
643 Ga0065704_10141131
644 Ga0065704_10157362
645 Ga0070658_10096114
646 Ga0070668_100105264
647 Ga0070669_100002540
648 Ga0070662_100005940
649 Ga0070686_100000055
650 Ga0070665_100148574
651 Ga0068854_100004716
652 Ga0068856_100115611
653 Ga0068856_100218934
654 Ga0081539_10000132
655 Ga0075364_10047485
656 Ga0075364_10096578
657 Ga0075364_10129909
658 Ga0075436_100169880
659 Ga0079104_1000059
660 Ga0079104_1003509
661 Ga0079104_1014022
662 Ga0105251_10000018
663 Ga0105251_10002673
664 Ga0105251_10004093
665 Ga0105251_10005208
666 Ga0105251_10013525
667 Ga0105251_10025143
668 Ga0105251_10050311
669 Ga0105251_10064115
670 Ga0105251_10065790
671 Ga0105251_10077312
672 Ga0105244_10020404
673 Ga0105244_10023005
674 Ga0105244_10034456
675 Ga0105244_10038057
676 Ga0105244_10042277
677 Ga0105244_10066366
678 Ga0105244_10068372
679 Ga0105244_10086097
680 Ga0105250_10002104
681 Ga0105250_10003350
682 Ga0105250_10008209
683 Ga0105250_10013409
684 Ga0105250_10045069
685 Ga0105250_10053992
686 Ga0105250_10057323
687 Ga0105250_10057832
688 Ga0105250_10075534
689 Ga0105247_10030070
690 Ga0105243_10000196
691 Ga0105248_10023148
692 Ga0105239_10071346
693 Ga0105246_10084034
694 Ga0157373_10010108
695 Ga0157373_10015814
696 Ga0157373_10019922
697 Ga0157373_10021580
698 Ga0157373_10055505
699 Ga0157373_10131247
700 Ga0157371_10000044
701 Ga0157371_10024651
702 Ga0157371_10046556
703 Ga0157371_10083121
704 Ga0157371_10116206
705 Ga0157371_10146160
706 Ga0157370_10036532
707 Ga0157370_10164421
708 Ga0157370_10208633
709 Ga0157370_10373829
710 Ga0157369_10015985
711 Ga0157369_10072450
712 Ga0157369_10089027
713 Ga0157369_10164169
714 Ga0163162_10183455
715 Ga0163162_10203791
716 Ga0163162_10309922
717 Ga0157372_10001040
718 Ga0157372_10033066
719 Ga0157372_10039970
720 Ga0157372_10044327
721 Ga0157372_10295859
722 Ga0182008_10006185
723 Ga0182008_10110299
724 Ga0182006_1004345
725 Ga0182006_1034341
726 Ga0182006_1039090
727 Ga0182006_1050282
728 Ga0182006_1050738
729 Ga0182006_1057056
730 Ga0182007_10045959
731 Ga0182007_10051157
732 Ga0182005_1025302
733 Ga0182005_1025554
734 Ga0163161_10000522
735 Ga0163161_10019422
736 Ga0163161_10024826
737 Ga0163161_10034810
738 Ga0163161_10125147
739 Ga0163161_10150498
740 Ga0163161_10181253
741 Ga0209436_113554
742 Ga0209130_1024229
743 Ga0209676_1000016
744 Ga0209676_1000080
745 Ga0209676_1003039
746 Ga0209050_1000036
747 Ga0209050_1000079
748 Ga0209050_1000117
749 Ga0209050_1024119
750 Ga0209050_1033293
751 Ga0207426_1045871
752 Ga0209051_1000054
753 Ga0209051_1000077
754 Ga0209051_1000094
755 Ga0209257_1000173
756 Ga0209257_1007132
757 Ga0207696_1000083
758 Ga0207696_1000743
759 Ga0207696_1001411
760 Ga0207696_1013861
761 Ga0207696_1016192
762 Ga0207696_1017157
763 Ga0207696_1031031
764 Ga0207696_1031891
765 Ga0207696_1032936
766 Ga0207696_1041765
767 Ga0207655_1001403
768 Ga0207655_1011841
769 Ga0207655_1032478
770 Ga0207655_1035622
771 Ga0207655_1037386
772 Ga0207655_1055445
773 Ga0207713_1000156
774 Ga0207713_1002302
775 Ga0207713_1002375
776 Ga0207713_1003752
777 Ga0207713_1007149
778 Ga0207713_1019263
779 Ga0207713_1031916
780 Ga0207713_1042771
781 Ga0207710_10015947
782 Ga0207705_10053797
783 Ga0207681_10000386
784 Ga0207706_10000056
785 Ga0207709_10273025
786 Ga0207711_10075864
787 Ga0207668_10206358
788 Ga0207640_10040147
789 Ga0207702_10087537
790 Ga0209281_1000065
791 Ga0209281_1000774
792 Ga0209281_1001095
793 Ga0209281_1013296
794 Ga0209371_1004524
795 Ga0207428_10037980
796 Ga0207428_10087366
797 Ga0207428_10147699
798 Ga0268266_10028121
799 Ga0307515_10007850
800 Ga0268256_1002736
801 Ga0307512_10005973
802 Ga0316179_1110150
803 Ga0316183_1130390
804 Ga0265331_10071876
805 Ga0265327_10000027
806 Ga0307408_100021721
807 Ga0307408_100139095
808 Ga0307408_100244184
809 Ga0307405_10052513
810 Ga0307412_10134311
811 Ga0307412_10136999
812 Ga0307416_100207862
813 Ga0307414_10138002
814 Ga0307510_10000338
815 Ga0373925_0008930
816 Ga0237819_00554
817 Ga0400488_22115
818 Ga0400483_090640
819 Ga0400487_00700
820 Ga0436365_0192868
821 Ga0439438_000005
822 Ga0439438_000184
823 Ga0439438_000885
824 Ga0439438_000924
825 Ga0439438_001047
826 Ga0439438_002883
827 Ga0439438_009382
828 Ga0439438_026376
829 Ga0439438_031273
830 Ga0439447_001821
831 Ga0439447_002560
832 Ga0439447_008514
833 Ga0439447_020958
834 Ga0439447_029690
835 Ga0439466_0001623
836 Ga0439466_0001754
837 Ga0439466_0008936
838 Ga0439466_0012203
839 Ga0439466_0041683
840 Ga0439466_0046282
841 Ga0439431_0000041
842 Ga0439432_001733
843 Ga0439432_010745
844 Ga0439432_023362
845 Ga0439432_036324
846 Ga0439451_001507
847 Ga0439451_014899
848 Ga0439452_001380
849 Ga0439452_002007
850 Ga0439452_008144
851 Ga0439452_023712
852 Ga0439456_015828
853 Ga0439463_025361
854 Ga0450911_000245
855 Ga0450920_000596
856 Ga0450922_000143
857 Ga0450923_007593
858 Ga0450890_000068
859 Ga0450902_001595
860 Ga0450903_008948
861 Ga0450906_008647
862 Ga0450906_012847
863 Ga0450907_000007
864 Ga0450907_000041
865 Ga0450907_000756
866 Ga0450908_007783
867 Ga0450909_000107
868 Ga0450909_001186
869 Ga0439434_0000029
870 Ga0439464_0013526
871 Ga0439460_0031142
872 Ga0453684_0087962
873 Ga0495617_002507
874 Ga0495617_013335
875 Ga0495617_052904
876 Ga0495627_000004
877 Ga0495627_001368
878 Ga0495603_0036482
879 Ga0495603_0054772
880 Ga0495603_0061474
881 Ga0495590_0014217
882 Ga0495591_000831
883 Ga0495591_030883
884 Ga0495638_0001131
885 Ga0495638_0001939
886 Ga0495638_0004663
887 Ga0495638_0005491
888 Ga0495638_0043347
889 Ga0495638_0139333
890 Ga0495653_0021455
891 Ga0495650_0000039
892 Ga0495650_0000062
893 Ga0495650_0000816
894 Ga0495650_0001935
895 Ga0495650_0002360
896 Ga0495650_0008277
897 Ga0495650_0008585
898 Ga0495650_0008766
899 Ga0495650_0024018
900 Ga0495605_0000462
901 Ga0495605_0001071
902 Ga0495605_0022596
903 Ga0495605_0027577
904 Ga0495584_0007251
905 Ga0495584_0011458
906 Ga0495585_0000700
907 Ga0495585_0004622
908 Ga0495585_0015009
909 Ga0495585_0016684
910 Ga0495596_0000075
911 Ga0495596_0027193
912 Ga0495596_0036399
913 Ga0495607_0009695
914 Ga0495607_0017442
915 Ga0495607_0056504
916 Ga0495607_0075710
917 Ga0495607_0105234
918 Ga0495583_0009215
919 Ga0495583_0034634
920 Ga0495606_0000042
921 Ga0495606_0000740
922 Ga0495606_0001625
923 Ga0495606_0005303
924 Ga0495606_0008195
925 Ga0495610_0002069
926 Ga0495610_0021524
927 Ga0495616_0003396
928 Ga0495620_0000517
929 Ga0495631_0014295
930 Ga0495632_0000341
931 Ga0495632_0003301
932 Ga0495632_0011627
933 Ga0495632_0017012
934 Ga0495632_0052568
935 Ga0495637_0000580
936 Ga0495637_0003015
937 Ga0495637_0003021
938 Ga0495637_0003198
939 Ga0495637_0018560
940 Ga0495637_0042764
941 Ga0495643_0019970
942 Ga0495643_0038900
943 Ga0495643_0050158
944 Ga0495643_0088949
945 Ga0495648_0000314
946 Ga0495648_0001666
947 Ga0495648_0013206
948 Ga0495648_0043728
949 Ga0495648_0096684
950 Ga0495648_0099588
951 Ga0495654_0000675
952 Ga0495654_0002824
953 Ga0495654_0005902
954 Ga0495654_0009990
955 Ga0495654_0013066
956 Ga0495654_0016270
957 Ga0495654_0019402
958 Ga0495654_0026620
959 Ga0495654_0053951
960 Ga0495654_0059454
961 Ga0495654_0087111
962 Ga0495609_0041257
963 Ga0495609_0052735
964 Ga0495597_0000832
965 Ga0495597_0032994
966 Ga0495597_0064653
967 Ga0495622_0000441
968 Ga0495622_0055220
969 Ga0495622_0065299
970 Ga0495622_0068462
971 Ga0495633_0000443
972 Ga0495633_0001797
973 Ga0495633_0006287
974 Ga0495656_0006368
975 Ga0495668_0000195
976 Ga0495668_0072747
977 Ga0495634_0001010
978 Ga0495611_0066639
979 Ga0495625_0011256
980 Ga0495625_0030955
981 Ga0495625_0057807
982 Ga0495625_0126720
983 Ga0495661_0001080
984 Ga0495661_0013577
985 Ga0495646_0037110
986 Ga0495669_0004460
987 Ga0495613_0006736
988 Ga0495670_0000132
989 Ga0495670_0000533
990 Ga0495670_0002962
991 Ga0495670_0010627
992 Ga0495671_0008074
993 Ga0495671_0012558
994 Ga0495671_0020654
995 Ga0495649_0000601
996 Ga0495649_0004465
997 Ga0495649_0004494
998 Ga0495649_0008493
999 Ga0495649_0009591
1000 Ga0495649_0028318
1001 Ga0495649_0035581
1002 Ga0495649_0069870
1003 Ga0495649_0084628
1004 Ga0495649_0116169
1005 Ga0495589_0009643
1006 Ga0495589_0016301
1007 Ga0495589_0018848
1008 Ga0495589_0030018
1009 Ga0495589_0070295
1010 Ga0495600_0016587
1011 Ga0495660_0000023
1012 Ga0495660_0001485
1013 Ga0495660_0001575
1014 Ga0495660_0006210
1015 Ga0495660_0022046
1016 Ga0495660_0031638
1017 Ga0495660_0051560
1018 Ga0495660_0066268
1019 Ga0495660_0068246
1020 Ga0495604_0034209
1021 Ga0495636_0031142
1022 Ga0495672_0000011
1023 Ga0495672_0000040
1024 Ga0495672_0004581
1025 Ga0495672_0005408
1026 Ga0495672_0006402
1027 Ga0495672_0013359
1028 Ga0495680_0099303
1029 Ga0495680_0181572
1030 Ga0495683_0011030
1031 Ga0495683_0027714
1032 Ga0495683_0038662
1033 Ga0495683_0053665
1034 Ga0495683_0092195
1035 Ga0495687_003347
1036 Ga0495687_008029
1037 Ga0495677_0000197
1038 Ga0495679_000016
1039 Ga0495679_001724
1040 Ga0495679_027265
1041 Ga0495673_0000128
1042 Ga0495673_0000535
1043 Ga0495673_0003340
1044 Ga0495673_0008062
1045 Ga0495673_0010611
1046 Ga0495673_0023571
1047 Ga0495681_0001336
1048 Ga0495681_0031690
1049 Ga0495681_0071721
1050 Ga0495686_0011529
1051 Ga0495686_0032512
1052 Ga0495626_0000724
1053 Ga0495626_0001079
1054 Ga0495626_0006789
1055 Ga0495626_0011234
1056 Ga0495626_0012066
1057 Ga0495626_0044571
1058 Ga0496104_0000219
1059 Ga0496110_0455239
1060 Ga0496114_0026083
1061 Ga0496116_0000126
1062 Ga0496116_0000917
1063 Ga0496116_0002322
1064 Ga0496116_0031758
1065 Ga0496116_0055569
1066 Ga0496117_0000623
1067 Ga0496117_0001894
1068 Ga0496117_0002812
1069 Ga0496117_0003267
1070 Ga0496117_0006508
1071 Ga0496117_0014842
1072 Ga0496117_0030304
1073 Ga0496117_0047327
1074 Ga0496117_0060838
1075 Ga0496117_0077044
1076 Ga0496118_0000684
1077 Ga0496118_0002921
1078 Ga0496118_0018165
1079 Ga0496118_0024582
1080 Ga0496118_0024735
1081 Ga0496118_0035528
1082 Ga0496118_0073296
1083 Ga0496118_0087208
1084 Ga0496118_0141078
1085 Ga0496119_0005609
1086 Ga0496119_0023365
1087 Ga0496119_0028163
1088 Ga0496119_0031604
1089 Ga0496119_0053682
1090 Ga0496119_0063175
1091 Ga0496119_0094724
1092 Ga0496120_0011119
1093 Ga0496120_0014868
1094 Ga0496120_0049105
1095 Ga0496120_0095202
1096 Ga0496120_0108003
1097 Ga0496121_0000142
1098 Ga0496121_0001953
1099 Ga0496121_0002695
1100 Ga0496121_0002876
1101 Ga0496121_0021741
1102 Ga0496121_0037332
1103 Ga0496121_0069120
1104 Ga0496121_0107575
1105 Ga0496121_0111843
1106 Ga0496122_0000067
1107 Ga0496122_0030111
1108 Ga0496122_0032105
1109 Ga0496122_0045063
1110 Ga0496122_0048097
1111 Ga0496122_0049728
1112 Ga0496122_0062428
1113 Ga0496122_0090762
1114 Ga0496122_0132471
1115 Ga0496123_0000056
1116 Ga0496123_0036238
1117 Ga0496123_0036286
1118 Ga0496123_0044396
1119 Ga0496123_0048318
1120 Ga0496123_0078730
1121 Ga0496123_0105311
1122 Ga0496124_0000251
1123 Ga0496124_0002208
1124 Ga0496124_0003628
1125 Ga0496124_0055658
1126 Ga0496124_0063002
1127 Ga0496124_0069474
1128 Ga0496124_0109298
1129 Ga0496124_0197210
1130 Ga0496124_0281381
1131 Ga0496125_0000183
1132 Ga0496125_0013810
1133 Ga0496125_0014700
1134 Ga0496125_0017357
1135 Ga0496125_0018757
1136 Ga0496125_0024596
1137 Ga0496125_0029031
1138 Ga0496125_0055869
1139 Ga0496125_0077437
1140 Ga0496126_0008717
1141 Ga0496126_0032838
1142 Ga0496126_0092289
1143 Ga0496126_0101234
1144 Ga0496126_0293587
1145 Ga0495678_003266
1146 Ga0495678_008130
1147 Ga0495678_009503
1148 Ga0495678_011583
1149 Ga0495678_025147
1150 Ga0495678_030760
1151 Ga0495678_041828
1152 Ga0495682_0000005
1153 Ga0495682_0044831
1154 Ga0495682_0070167
1155 Ga0501223_010448
1156 Ga0501269_000661
1157 nmdc:mga00v17_86554_c1
1158 Ga0500621_024312
1159 Ga0500659_0002792
1160 Ga0500634_0000039
1161 2511256460
1162 2511329269
1163 2511366434
1164 2555668385
1165 2588108256
1166 2597871903
1167 2599331091
1168 2599501088
1169 2599515155
1170 2599773058
1171 2599894535
1172 2599942814
1173 2599953563
1174 2600026067
1175 2600046934
1176 2600080045
1177 2601799872
1178 2606074329
1179 2606127192
1180 2643869664
1181 2643952005
1182 2644024236
1183 2671109157
1184 2671585102
1185 2718633030
1186 2739198675
1187 2739256565
1188 2739604427
1189 2774121441
1190 2784260128
1191 2784315671
1192 2808960919
1193 2809216118
1194 2817509950
1195 2819654619
1196 2823422265
1197 2865014939
1198 2880233802
1199 2885085758
1200 2891090259
1201 2904477566
1202 2904522437
1203 2917072153
1204 2919153727
1205 2919390334
1206 2919483185
1207 2919506103
1208 2919523762
1209 2926067598
1210 2927147257
1211 2931395876
1212 2939637765
1213 2946033088
1214 2947233859
1215 2969305936
1216 2978977681
1217 2990200550
1218 2998141349
1219 3007616200
1220 3007620492
1221 8054288891
1222 8054353070
1223 8056150570
1224 8056159422
1225 8056163047
1226 8057801074

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13588

HSDR_N_2

Type I restriction enzyme R protein N terminus (HSDR_N)

23

133

0.78

PF04313

HSDR_N

Type I restriction enzyme R protein N terminus (HSDR_N)

21

128

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
3h1t-assembly1.cif.gz_A the fragment structure of a putative hsdr subunit of a type i restriction enzyme from vibrio vulnificus yj016 0.6832 21 132
2l1d-assembly1.cif.gz_A mouse prion protein (121-231) containing the substitution y169g 0.6492 190 232
5u6g-assembly5.cif.gz_I crystal structure of the holo domain-swapped dimer mutant q108k:k40d human cellular retinol binding protein ii bound with all trans retinal 0.6398 284 331
7bto-assembly1.cif.gz_F ecor124i-arda in the translocation state 0.5804 68 137
7pd3-assembly1.cif.gz_b structure of the human mitoribosomal large subunit in complex with nsun4.mterf4.gtpbp7 and malsu1.l0r8f8.mt-acp 0.5684 311 345
ID Description Score Start End Superfamily
af_Q59058_106_224_3.40.1350.10 Alpha Beta;3-Layer(aba) Sandwich;Trna Endonuclease; Chain: A, domain 1; 0.7454 49 112 3.40.1350.10
3h1tA01 Alpha Beta;Alpha-Beta Complex;tt1808, chain A; 0.7169 21 132 3.90.1570.30
af_C7G039_2_116_3.40.1350.10 Alpha Beta;3-Layer(aba) Sandwich;Trna Endonuclease; Chain: A, domain 1; 0.683 50 106 3.40.1350.10
af_Q19532_358_459_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.6514 304 331 2.30.29.30
af_Q60295_117_300_3.90.1570.50 Alpha Beta;Alpha-Beta Complex;tt1808, chain A; 0.6316 42 130 3.90.1570.50
ID Description Score Start End GO Terms
AF-D0WZN0-F1-model_v4 deleted 0.9868 276 352
AF-A0A6L9FDY1-F1-model_v4 Restriction endonuclease 0.9867 1 167 GO:0004519
AF-A0A1N7M212-F1-model_v4 deleted 0.9862 284 351
AF-A0A1X3ACX2-F1-model_v4 deleted 0.9847 280 349
AF-A0A173S1T0-F1-model_v4 Uncharacterized conserved protein 0.984 259 351

Map