F469331
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 614 | 345 | 1228 | 176 |
Family's Representative Sequence
| Representative Sequence | 3300005328|Ga0070676_10000093|Ga0070676_1000009322 |
| Length | 210 |
| Sequence | LAIECLRRRGSKSLELSAKITGVDVLEQVASVAPMNSAIMDRLRAGVRDVPDFPKTGIVFKDITPLLSDHVLFRASIDLFLERCRGKEIDKIVGIDARGFLFGSAVAYELGVGFVPIRKRGKLPYKTEIAKYSLEYGQAEMEMHIDAMIEGERVILVDDLLATGGTSAAAARLIRKVGGRLLEAQFLIELEFLNGRKQLDPTPVISFLRY |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 7 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 8 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 9 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 10 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 11 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 12 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 13 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 14 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 15 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 16 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 17 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 18 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 19 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 20 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 22 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 24 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 25 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 26 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 27 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 28 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 29 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 30 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 31 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 32 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 37 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 40 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 42 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 52 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 66 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 67 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 71 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 73 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 75 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 80 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 82 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 83 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 84 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 86 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 87 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 88 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 89 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 90 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 91 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 93 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 94 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 95 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 97 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 98 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 99 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 100 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 101 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 102 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 116 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 117 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 118 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 129 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 132 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 133 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 134 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 135 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 137 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 138 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 139 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 148 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 149 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 150 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 152 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 153 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 155 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 157 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 160 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 163 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 166 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 225 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 228 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 229 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 230 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 231 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 232 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 233 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 234 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 235 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 236 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 237 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 238 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 239 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 240 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 241 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 242 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 243 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 244 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 245 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 246 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 247 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 248 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 249 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 250 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 251 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 252 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 253 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 254 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 255 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 256 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 257 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 258 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 259 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 260 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 261 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 262 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 263 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 264 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 265 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 266 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 267 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 268 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 269 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 289 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 290 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 291 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 292 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 293 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 294 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 295 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 296 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 297 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 298 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 299 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 300 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 301 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 302 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 303 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 304 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 305 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 306 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 307 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 308 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 309 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 310 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 335 | 2537561836 | Rhodanobacter spathiphylli B39 | Isolate | Unclassified |
| 336 | 2643221577 | Rhodanobacter sp. Root627 | Isolate | Unclassified |
| 337 | 2643221685 | Rhodanobacter sp. Root480 | Isolate | Unclassified |
| 338 | 2687453130 | Dyella thiooxydans ATSB10 | Isolate | Unclassified |
| 339 | 2884411467 | Dyella sp. AD56 | Isolate | Rhizosphere |
| 340 | 2895395659 | Rhodanobacter sp. T12-5 | Isolate | Unclassified |
| 341 | 2928963466 | Dyella japonica 1073 | Isolate | Unclassified |
| 342 | 2939611941 | Rhodanobacter soli 1757 | Isolate | Rhizosphere |
| 343 | 2941489479 | Lysobacter enzymogenes 2943 | Isolate | Rhizosphere |
| 344 | 2995948881 | Lysobacter enzymogenes B25 | Isolate | Unclassified |
| 345 | 8003014200 | Lysobacter changpingensis Cm-3-T8 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.56 |
| Metatranscriptomes | 0.65 |
| Isolates | 1.79 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 15.8 |
| Nodule | 0 |
| Rhizoplane | 5.05 |
| Rhizosphere | 72.31 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.47 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070676_10000093 | 3300005328 | Bacteria | 31006 |
| 2 | JGI24746J21847_1004473 | 3300001977 | Bacteria | 2203 |
| 3 | JGI24739J22299_10026837 | 3300001989 | Bacteria | 2018 |
| 4 | JGI24737J22298_10003313 | 3300001990 | Bacteria | 5705 |
| 5 | JGI24737J22298_10040539 | 3300001990 | Bacteria | 1429 |
| 6 | JGI24735J21928_10001795 | 3300002067 | Bacteria | 7529 |
| 7 | JGI24735J21928_10031010 | 3300002067 | Bacteria | 1586 |
| 8 | JGI25162J39368_1001103 | 3300002737 | Bacteria | 16377 |
| 9 | JGI25162J39368_1001211 | 3300002737 | Bacteria | 15019 |
| 10 | JGI25162J39368_1001631 | 3300002737 | Bacteria | 11183 |
| 11 | JGI25157J39369_1000343 | 3300002741 | Bacteria | 32869 |
| 12 | JGI25157J39369_1000788 | 3300002741 | Bacteria | 16190 |
| 13 | JGI25163J39215_1000482 | 3300002771 | Bacteria | 12006 |
| 14 | JGI25164J39214_1000093 | 3300002772 | Bacteria | 89262 |
| 15 | JGI25164J39214_1000581 | 3300002772 | Bacteria | 16386 |
| 16 | JGI25164J39214_1000806 | 3300002772 | Bacteria | 11175 |
| 17 | JGI25151J46595_10067881 | 3300003187 | Bacteria | 1097 |
| 18 | JGI25165J46597_1000283 | 3300003214 | Bacteria | 64612 |
| 19 | JGI25165J46597_1001571 | 3300003214 | Bacteria | 11183 |
| 20 | JGI25165J46597_1002330 | 3300003214 | Bacteria | 6410 |
| 21 | JGI25165J46597_1018480 | 3300003214 | Bacteria | 923 |
| 22 | rootH1_10063477 | 3300003316 | Bacteria | 2016 |
| 23 | rootH1_10099417 | 3300003316 | Bacteria | 2525 |
| 24 | rootH2_10066056 | 3300003320 | Bacteria | 1175 |
| 25 | Ga0006562J51391_1006439 | 3300003578 | Bacteria | 12519 |
| 26 | Ga0006562J51391_1006443 | 3300003578 | Bacteria | 7179 |
| 27 | Ga0055538_1000681 | 3300003751 | Bacteria | 10496 |
| 28 | Ga0055533_1000324 | 3300003756 | Bacteria | 21682 |
| 29 | Ga0055535_1000070 | 3300003761 | Bacteria | 114467 |
| 30 | Ga0055535_1000152 | 3300003761 | Bacteria | 73843 |
| 31 | Ga0055542_1000232 | 3300003762 | Bacteria | 64691 |
| 32 | Ga0055542_1000606 | 3300003762 | Bacteria | 30638 |
| 33 | Ga0055529_1000024 | 3300003763 | Bacteria | 305218 |
| 34 | Ga0055529_1000082 | 3300003763 | Bacteria | 146912 |
| 35 | Ga0055526_1000072 | 3300003771 | Bacteria | 94464 |
| 36 | Ga0055537_1000665 | 3300003773 | Bacteria | 18074 |
| 37 | Ga0055524_1000173 | 3300003775 | Bacteria | 73388 |
| 38 | Ga0055524_1008199 | 3300003775 | Bacteria | 4360 |
| 39 | Ga0055524_1035474 | 3300003775 | Bacteria | 1359 |
| 40 | Ga0055536_1007458 | 3300003781 | Bacteria | 4890 |
| 41 | Ga0055536_1024684 | 3300003781 | Bacteria | 1734 |
| 42 | Ga0055536_1038454 | 3300003781 | Bacteria | 1159 |
| 43 | Ga0055534_1000628 | 3300003784 | Bacteria | 18074 |
| 44 | Ga0055528_1000085 | 3300003790 | Bacteria | 73426 |
| 45 | Ga0055530_10001219 | 3300003791 | Bacteria | 19751 |
| 46 | Ga0055531_10016729 | 3300003794 | Bacteria | 3144 |
| 47 | Ga0055531_10020584 | 3300003794 | Bacteria | 2602 |
| 48 | Ga0055531_10023824 | 3300003794 | Bacteria | 2280 |
| 49 | Ga0055531_10040003 | 3300003794 | Bacteria | 1382 |
| 50 | Ga0055531_10046742 | 3300003794 | Bacteria | 1186 |
| 51 | Ga0065165_1003415 | 3300005262 | Bacteria | 11194 |
| 52 | Ga0065712_10076093 | 3300005290 | Bacteria | 3734 |
| 53 | Ga0065715_10009293 | 3300005293 | Bacteria | 2748 |
| 54 | Ga0065707_10249815 | 3300005295 | Unclassified | 1127 |
| 55 | Ga0070676_10010043 | 3300005328 | Bacteria | 5126 |
| 56 | Ga0070683_100295045 | 3300005329 | Bacteria | 1542 |
| 57 | Ga0070690_100103127 | 3300005330 | Bacteria | 1894 |
| 58 | Ga0070690_100397064 | 3300005330 | Bacteria | 1012 |
| 59 | Ga0070670_100013984 | 3300005331 | Bacteria | 6882 |
| 60 | Ga0070670_100203882 | 3300005331 | Bacteria | 1719 |
| 61 | Ga0070677_10094162 | 3300005333 | Bacteria | 1308 |
| 62 | Ga0068869_100044088 | 3300005334 | Bacteria | 3207 |
| 63 | Ga0070666_10016070 | 3300005335 | Bacteria | 4783 |
| 64 | Ga0070666_10107195 | 3300005335 | Bacteria | 1930 |
| 65 | Ga0070680_100201892 | 3300005336 | Bacteria | 1677 |
| 66 | Ga0068868_100001212 | 3300005338 | Bacteria | 17721 |
| 67 | Ga0068868_100007275 | 3300005338 | Bacteria | 7875 |
| 68 | Ga0068868_100057822 | 3300005338 | Bacteria | 3064 |
| 69 | Ga0070660_100452928 | 3300005339 | Unclassified | 1065 |
| 70 | Ga0070660_100876273 | 3300005339 | Bacteria | 756 |
| 71 | Ga0070689_100037307 | 3300005340 | Bacteria | 3716 |
| 72 | Ga0070689_100068454 | 3300005340 | Unclassified | 2769 |
| 73 | Ga0070689_100204613 | 3300005340 | Bacteria | 1613 |
| 74 | Ga0070689_100215220 | 3300005340 | Bacteria | 1574 |
| 75 | Ga0070689_100497724 | 3300005340 | Unclassified | 1044 |
| 76 | Ga0070687_100002785 | 3300005343 | Bacteria | 6648 |
| 77 | Ga0070661_100021256 | 3300005344 | Bacteria | 4632 |
| 78 | Ga0070692_10060585 | 3300005345 | Bacteria | 1992 |
| 79 | Ga0070668_100003497 | 3300005347 | Bacteria | 11582 |
| 80 | Ga0070668_100116736 | 3300005347 | Bacteria | 2129 |
| 81 | Ga0070669_100032261 | 3300005353 | Unclassified | 3784 |
| 82 | Ga0070669_100056895 | 3300005353 | Bacteria | 2868 |
| 83 | Ga0070675_100000332 | 3300005354 | Bacteria | 32006 |
| 84 | Ga0070675_100006328 | 3300005354 | Bacteria | 9090 |
| 85 | Ga0070675_100025742 | 3300005354 | Unclassified | 4717 |
| 86 | Ga0070675_100619917 | 3300005354 | Unclassified | 982 |
| 87 | Ga0070671_100022499 | 3300005355 | Bacteria | 5147 |
| 88 | Ga0070671_100099489 | 3300005355 | Bacteria | 2439 |
| 89 | Ga0070671_100346250 | 3300005355 | Unclassified | 1268 |
| 90 | Ga0070674_100002544 | 3300005356 | Bacteria | 10098 |
| 91 | Ga0070673_100010708 | 3300005364 | Bacteria | 6219 |
| 92 | Ga0070673_100121911 | 3300005364 | Bacteria | 2176 |
| 93 | Ga0070688_100136862 | 3300005365 | Unclassified | 1659 |
| 94 | Ga0070688_100195450 | 3300005365 | Unclassified | 1412 |
| 95 | Ga0070688_100502506 | 3300005365 | Unclassified | 915 |
| 96 | Ga0070659_100404808 | 3300005366 | Bacteria | 1152 |
| 97 | Ga0070667_100007165 | 3300005367 | Bacteria | 9265 |
| 98 | Ga0070667_100014461 | 3300005367 | Bacteria | 6519 |
| 99 | Ga0070667_100071761 | 3300005367 | Bacteria | 2949 |
| 100 | Ga0070667_100560026 | 3300005367 | Bacteria | 1051 |
| 101 | Ga0070709_10421432 | 3300005434 | Bacteria | 1000 |
| 102 | Ga0070714_100000830 | 3300005435 | Bacteria | 21852 |
| 103 | Ga0070714_100006315 | 3300005435 | Bacteria | 9136 |
| 104 | Ga0070714_100037494 | 3300005435 | Bacteria | 4074 |
| 105 | Ga0070713_100163514 | 3300005436 | Bacteria | 1988 |
| 106 | Ga0070710_10034613 | 3300005437 | Bacteria | 2749 |
| 107 | Ga0070710_10200647 | 3300005437 | Bacteria | 1259 |
| 108 | Ga0070711_100127693 | 3300005439 | Bacteria | 1889 |
| 109 | Ga0070711_100657823 | 3300005439 | Bacteria | 879 |
| 110 | Ga0070705_100006957 | 3300005440 | Bacteria | 5558 |
| 111 | Ga0070705_100019996 | 3300005440 | Bacteria | 3534 |
| 112 | Ga0070700_100410990 | 3300005441 | Bacteria | 1020 |
| 113 | Ga0070708_100222382 | 3300005445 | Unclassified | 1771 |
| 114 | Ga0070708_100246564 | 3300005445 | Bacteria | 1678 |
| 115 | Ga0070663_100044187 | 3300005455 | Bacteria | 3139 |
| 116 | Ga0070663_100069301 | 3300005455 | Bacteria | 2562 |
| 117 | Ga0070678_100359898 | 3300005456 | Unclassified | 1253 |
| 118 | Ga0070662_100000824 | 3300005457 | Bacteria | 19096 |
| 119 | Ga0070662_100014903 | 3300005457 | Bacteria | 5199 |
| 120 | Ga0070662_100434603 | 3300005457 | Bacteria | 1087 |
| 121 | Ga0070681_10105653 | 3300005458 | Bacteria | 2758 |
| 122 | Ga0070681_10304779 | 3300005458 | Bacteria | 1502 |
| 123 | Ga0068867_100068167 | 3300005459 | Unclassified | 2655 |
| 124 | Ga0068867_100468723 | 3300005459 | Bacteria | 1077 |
| 125 | Ga0070685_10097155 | 3300005466 | Bacteria | 1793 |
| 126 | Ga0070706_100052568 | 3300005467 | Bacteria | 3759 |
| 127 | Ga0070706_100085994 | 3300005467 | Bacteria | 2914 |
| 128 | Ga0070699_100448502 | 3300005518 | Bacteria | 1170 |
| 129 | Ga0070699_101155325 | 3300005518 | Bacteria | 710 |
| 130 | Ga0070679_100138912 | 3300005530 | Bacteria | 2410 |
| 131 | Ga0070697_100025251 | 3300005536 | Unclassified | 4738 |
| 132 | Ga0070697_100504701 | 3300005536 | Bacteria | 1058 |
| 133 | Ga0068853_100062807 | 3300005539 | Bacteria | 3215 |
| 134 | Ga0070672_100005502 | 3300005543 | Bacteria | 8399 |
| 135 | Ga0070672_100142681 | 3300005543 | Unclassified | 1977 |
| 136 | Ga0070686_100028279 | 3300005544 | Bacteria | 3399 |
| 137 | Ga0070695_100056623 | 3300005545 | Bacteria | 2531 |
| 138 | Ga0070696_100021450 | 3300005546 | Bacteria | 4379 |
| 139 | Ga0070696_100030481 | 3300005546 | Bacteria | 3692 |
| 140 | Ga0070693_100084291 | 3300005547 | Bacteria | 1902 |
| 141 | Ga0070693_100097970 | 3300005547 | Bacteria | 1781 |
| 142 | Ga0070704_100024248 | 3300005549 | Bacteria | 3978 |
| 143 | Ga0070704_100081303 | 3300005549 | Unclassified | 2386 |
| 144 | Ga0070704_100564480 | 3300005549 | Bacteria | 996 |
| 145 | Ga0068855_100014993 | 3300005563 | Bacteria | 9334 |
| 146 | Ga0068855_100088838 | 3300005563 | Bacteria | 3569 |
| 147 | Ga0068855_100193450 | 3300005563 | Bacteria | 2293 |
| 148 | Ga0068855_100870963 | 3300005563 | Bacteria | 953 |
| 149 | Ga0068855_101109784 | 3300005563 | Bacteria | 826 |
| 150 | Ga0070664_100043756 | 3300005564 | Bacteria | 3779 |
| 151 | Ga0068857_100010936 | 3300005577 | Bacteria | 7899 |
| 152 | Ga0068857_100322385 | 3300005577 | Bacteria | 1427 |
| 153 | Ga0068857_101050013 | 3300005577 | Unclassified | 785 |
| 154 | Ga0068854_100000327 | 3300005578 | Bacteria | 31304 |
| 155 | Ga0068854_100216595 | 3300005578 | Bacteria | 1513 |
| 156 | Ga0068856_100070794 | 3300005614 | Bacteria | 3451 |
| 157 | Ga0068856_100081014 | 3300005614 | Bacteria | 3220 |
| 158 | Ga0070702_100073848 | 3300005615 | Bacteria | 2022 |
| 159 | Ga0068852_100064660 | 3300005616 | Bacteria | 3190 |
| 160 | Ga0068852_100262164 | 3300005616 | Bacteria | 1660 |
| 161 | Ga0068852_100392282 | 3300005616 | Bacteria | 1364 |
| 162 | Ga0068859_100123820 | 3300005617 | Bacteria | 2653 |
| 163 | Ga0068859_100276533 | 3300005617 | Bacteria | 1772 |
| 164 | Ga0068864_100023613 | 3300005618 | Bacteria | 5165 |
| 165 | Ga0068858_100066703 | 3300005842 | Bacteria | 3332 |
| 166 | Ga0068858_100540127 | 3300005842 | Bacteria | 1128 |
| 167 | Ga0068860_100001706 | 3300005843 | Bacteria | 23469 |
| 168 | Ga0068860_100153619 | 3300005843 | Bacteria | 2218 |
| 169 | Ga0081455_10004812 | 3300005937 | Bacteria | 14998 |
| 170 | Ga0081455_10022598 | 3300005937 | Bacteria | 5874 |
| 171 | Ga0081455_10351787 | 3300005937 | Unclassified | 1039 |
| 172 | Ga0070717_10188266 | 3300006028 | Bacteria | 1802 |
| 173 | Ga0070717_10271485 | 3300006028 | Bacteria | 1502 |
| 174 | Ga0070715_10029224 | 3300006163 | Bacteria | 2218 |
| 175 | Ga0070716_100013517 | 3300006173 | Unclassified | 4161 |
| 176 | Ga0070712_100194146 | 3300006175 | Bacteria | 1591 |
| 177 | Ga0097621_100080613 | 3300006237 | Bacteria | 2708 |
| 178 | Ga0075428_100173940 | 3300006844 | Bacteria | 2333 |
| 179 | Ga0075428_101176585 | 3300006844 | Bacteria | 809 |
| 180 | Ga0075430_100003406 | 3300006846 | Bacteria | 13282 |
| 181 | Ga0075431_100029917 | 3300006847 | Bacteria | 5608 |
| 182 | Ga0075431_100449498 | 3300006847 | Bacteria | 1284 |
| 183 | Ga0075434_100068274 | 3300006871 | Bacteria | 3541 |
| 184 | Ga0075429_100076679 | 3300006880 | Bacteria | 2912 |
| 185 | Ga0068865_100094184 | 3300006881 | Bacteria | 2179 |
| 186 | Ga0097620_100123819 | 3300006931 | Bacteria | 2653 |
| 187 | Ga0097620_100276535 | 3300006931 | Bacteria | 1772 |
| 188 | Ga0105240_10001947 | 3300009093 | Bacteria | 34195 |
| 189 | Ga0105240_10002550 | 3300009093 | Bacteria | 29197 |
| 190 | Ga0105240_10064493 | 3300009093 | Bacteria | 4551 |
| 191 | Ga0111539_10083053 | 3300009094 | Bacteria | 3767 |
| 192 | Ga0111539_10093864 | 3300009094 | Bacteria | 3525 |
| 193 | Ga0111539_10221165 | 3300009094 | Bacteria | 2205 |
| 194 | Ga0111539_11056919 | 3300009094 | Unclassified | 944 |
| 195 | Ga0105245_10037440 | 3300009098 | Bacteria | 4313 |
| 196 | Ga0105245_10057793 | 3300009098 | Bacteria | 3490 |
| 197 | Ga0114129_10013834 | 3300009147 | Bacteria | 11498 |
| 198 | Ga0105243_10237328 | 3300009148 | Bacteria | 1621 |
| 199 | Ga0105241_10418124 | 3300009174 | Bacteria | 1179 |
| 200 | Ga0105242_10025442 | 3300009176 | Bacteria | 4685 |
| 201 | Ga0105242_10226462 | 3300009176 | Bacteria | 1673 |
| 202 | Ga0105242_10334196 | 3300009176 | Unclassified | 1394 |
| 203 | Ga0105242_10633597 | 3300009176 | Bacteria | 1037 |
| 204 | Ga0105248_10329294 | 3300009177 | Unclassified | 1720 |
| 205 | Ga0105248_11429120 | 3300009177 | Bacteria | 783 |
| 206 | Ga0105248_11979558 | 3300009177 | Bacteria | 662 |
| 207 | Ga0105237_10000145 | 3300009545 | Bacteria | 99941 |
| 208 | Ga0105237_10296831 | 3300009545 | Bacteria | 1619 |
| 209 | Ga0105238_10092290 | 3300009551 | Bacteria | 3016 |
| 210 | Ga0105238_11853297 | 3300009551 | Bacteria | 636 |
| 211 | Ga0105249_10001374 | 3300009553 | Bacteria | 21282 |
| 212 | Ga0105239_10000174 | 3300010375 | Bacteria | 92922 |
| 213 | Ga0105239_10002323 | 3300010375 | Bacteria | 24270 |
| 214 | Ga0157345_1027577 | 3300012498 | Bacteria | 618 |
| 215 | Ga0157314_1001349 | 3300012500 | Bacteria | 1774 |
| 216 | Ga0157347_1004001 | 3300012502 | Bacteria | 1349 |
| 217 | Ga0157373_10116633 | 3300013100 | Bacteria | 1877 |
| 218 | Ga0157373_10313648 | 3300013100 | Bacteria | 1115 |
| 219 | Ga0157373_10340412 | 3300013100 | Bacteria | 1069 |
| 220 | Ga0157373_10392074 | 3300013100 | Bacteria | 994 |
| 221 | Ga0157373_10609047 | 3300013100 | Bacteria | 795 |
| 222 | Ga0157373_10879373 | 3300013100 | Bacteria | 664 |
| 223 | Ga0157371_10011460 | 3300013102 | Bacteria | 6826 |
| 224 | Ga0157371_10349557 | 3300013102 | Bacteria | 1076 |
| 225 | Ga0157370_10047184 | 3300013104 | Bacteria | 4129 |
| 226 | Ga0157369_10095426 | 3300013105 | Bacteria | 3173 |
| 227 | Ga0157369_10208387 | 3300013105 | Bacteria | 2050 |
| 228 | Ga0157374_10010001 | 3300013296 | Bacteria | 8143 |
| 229 | Ga0157374_10321596 | 3300013296 | Bacteria | 1533 |
| 230 | Ga0157378_10020756 | 3300013297 | Bacteria | 5776 |
| 231 | Ga0157378_10124306 | 3300013297 | Bacteria | 2382 |
| 232 | Ga0163162_10001824 | 3300013306 | Bacteria | 20033 |
| 233 | Ga0163162_10009523 | 3300013306 | Bacteria | 9448 |
| 234 | Ga0163162_10088338 | 3300013306 | Bacteria | 3179 |
| 235 | Ga0163162_10091145 | 3300013306 | Bacteria | 3131 |
| 236 | Ga0163162_10287424 | 3300013306 | Bacteria | 1776 |
| 237 | Ga0157372_10099392 | 3300013307 | Bacteria | 3319 |
| 238 | Ga0157372_10459074 | 3300013307 | Bacteria | 1485 |
| 239 | Ga0157372_10472697 | 3300013307 | Bacteria | 1461 |
| 240 | Ga0157372_10530387 | 3300013307 | Bacteria | 1372 |
| 241 | Ga0157372_11670041 | 3300013307 | Bacteria | 733 |
| 242 | Ga0157375_10005856 | 3300013308 | Bacteria | 10698 |
| 243 | Ga0157375_10102170 | 3300013308 | Unclassified | 2951 |
| 244 | Ga0163163_10056085 | 3300014325 | Bacteria | 3894 |
| 245 | Ga0182008_10013425 | 3300014497 | Bacteria | 4308 |
| 246 | Ga0182008_10045457 | 3300014497 | Bacteria | 2183 |
| 247 | Ga0182008_10200788 | 3300014497 | Bacteria | 1015 |
| 248 | Ga0157377_10076823 | 3300014745 | Bacteria | 1943 |
| 249 | Ga0157377_10707249 | 3300014745 | Unclassified | 732 |
| 250 | Ga0157376_10016825 | 3300014969 | Bacteria | 5562 |
| 251 | Ga0182006_1153021 | 3300015261 | Bacteria | 781 |
| 252 | Ga0182007_10013113 | 3300015262 | Bacteria | 3175 |
| 253 | Ga0182007_10049892 | 3300015262 | Bacteria | 1382 |
| 254 | Ga0182007_10056263 | 3300015262 | Bacteria | 1292 |
| 255 | Ga0182007_10116689 | 3300015262 | Bacteria | 891 |
| 256 | Ga0183369_1003 | 3300015685 | Bacteria | 726443 |
| 257 | Ga0183368_1002 | 3300015687 | Bacteria | 1865598 |
| 258 | Ga0163161_10012495 | 3300017792 | Bacteria | 5895 |
| 259 | Ga0163161_10118828 | 3300017792 | Unclassified | 1984 |
| 260 | Ga0197907_10754485 | 3300020069 | Bacteria | 754 |
| 261 | Ga0206353_10701236 | 3300020082 | Bacteria | 630 |
| 262 | Ga0209435_100965 | 3300025206 | Bacteria | 4202 |
| 263 | Ga0209760_100330 | 3300025207 | Bacteria | 14198 |
| 264 | Ga0209784_100011 | 3300025224 | Bacteria | 546770 |
| 265 | Ga0209566_102792 | 3300025225 | Bacteria | 2998 |
| 266 | Ga0209674_100061 | 3300025226 | Bacteria | 280844 |
| 267 | Ga0209674_100858 | 3300025226 | Bacteria | 9997 |
| 268 | Ga0209672_106339 | 3300025228 | Bacteria | 1932 |
| 269 | Ga0207427_100026 | 3300025231 | Bacteria | 412764 |
| 270 | Ga0207427_100147 | 3300025231 | Bacteria | 80584 |
| 271 | Ga0207427_100205 | 3300025231 | Bacteria | 53817 |
| 272 | Ga0207427_101454 | 3300025231 | Bacteria | 8542 |
| 273 | Ga0207427_106956 | 3300025231 | Bacteria | 1373 |
| 274 | Ga0209437_100005 | 3300025233 | Bacteria | 1071596 |
| 275 | Ga0209437_100241 | 3300025233 | Bacteria | 89459 |
| 276 | Ga0209437_100340 | 3300025233 | Bacteria | 56228 |
| 277 | Ga0209437_100349 | 3300025233 | Bacteria | 53817 |
| 278 | Ga0209437_116347 | 3300025233 | Bacteria | 997 |
| 279 | Ga0209258_100027 | 3300025242 | Bacteria | 518449 |
| 280 | Ga0209258_102071 | 3300025242 | Bacteria | 5683 |
| 281 | Ga0207425_1025235 | 3300025245 | Bacteria | 1228 |
| 282 | Ga0209646_1005902 | 3300025246 | Bacteria | 2098 |
| 283 | Ga0209646_1027153 | 3300025246 | Bacteria | 790 |
| 284 | Ga0209026_1000017 | 3300025250 | Bacteria | 385214 |
| 285 | Ga0209026_1000018 | 3300025250 | Bacteria | 381351 |
| 286 | Ga0209026_1003512 | 3300025250 | Bacteria | 5097 |
| 287 | Ga0209148_1000001 | 3300025254 | Bacteria | 2545271 |
| 288 | Ga0209148_1000002 | 3300025254 | Bacteria | 2399500 |
| 289 | Ga0209759_1001248 | 3300025256 | Bacteria | 15421 |
| 290 | Ga0209759_1004487 | 3300025256 | Bacteria | 5191 |
| 291 | Ga0209129_1001119 | 3300025258 | Bacteria | 15581 |
| 292 | Ga0209233_1000002 | 3300025261 | Bacteria | 2501366 |
| 293 | Ga0209233_1000011 | 3300025261 | Bacteria | 1071611 |
| 294 | Ga0209233_1000315 | 3300025261 | Bacteria | 53817 |
| 295 | Ga0209565_1000001 | 3300025263 | Bacteria | 2950419 |
| 296 | Ga0209565_1015866 | 3300025263 | Bacteria | 1687 |
| 297 | Ga0209455_1000019 | 3300025272 | Bacteria | 705658 |
| 298 | Ga0209673_1000001 | 3300025273 | Bacteria | 3176258 |
| 299 | Ga0209673_1004055 | 3300025273 | Bacteria | 8097 |
| 300 | Ga0209130_1007366 | 3300025284 | Bacteria | 3405 |
| 301 | Ga0207673_1000941 | 3300025290 | Bacteria | 3136 |
| 302 | Ga0209675_1000001 | 3300025291 | Bacteria | 2950293 |
| 303 | Ga0209675_1006701 | 3300025291 | Bacteria | 4565 |
| 304 | Ga0209675_1045195 | 3300025291 | Bacteria | 938 |
| 305 | Ga0209676_1000875 | 3300025292 | Bacteria | 38585 |
| 306 | Ga0209676_1001240 | 3300025292 | Bacteria | 26876 |
| 307 | Ga0209676_1010760 | 3300025292 | Bacteria | 3768 |
| 308 | Ga0209676_1013959 | 3300025292 | Bacteria | 3055 |
| 309 | Ga0209676_1017043 | 3300025292 | Bacteria | 2589 |
| 310 | Ga0209025_1000564 | 3300025294 | Bacteria | 67936 |
| 311 | Ga0209025_1003024 | 3300025294 | Bacteria | 16604 |
| 312 | Ga0209025_1040121 | 3300025294 | Bacteria | 2030 |
| 313 | Ga0209025_1119105 | 3300025294 | Bacteria | 792 |
| 314 | Ga0209564_1000001 | 3300025295 | Bacteria | 3176258 |
| 315 | Ga0209564_1029549 | 3300025295 | Bacteria | 1722 |
| 316 | Ga0209564_1042483 | 3300025295 | Bacteria | 1205 |
| 317 | Ga0209758_1000647 | 3300025297 | Bacteria | 52818 |
| 318 | Ga0209758_1023925 | 3300025297 | Bacteria | 2742 |
| 319 | Ga0209050_1009346 | 3300025298 | Bacteria | 5034 |
| 320 | Ga0209050_1015414 | 3300025298 | Bacteria | 3212 |
| 321 | Ga0209256_1000006 | 3300025299 | Bacteria | 1250310 |
| 322 | Ga0209256_1002134 | 3300025299 | Bacteria | 17096 |
| 323 | Ga0209256_1007997 | 3300025299 | Bacteria | 5027 |
| 324 | Ga0209256_1028829 | 3300025299 | Bacteria | 1558 |
| 325 | Ga0209051_1045090 | 3300025303 | Bacteria | 1529 |
| 326 | Ga0209257_1000343 | 3300025304 | Bacteria | 96876 |
| 327 | Ga0209257_1000738 | 3300025304 | Bacteria | 49567 |
| 328 | Ga0209257_1011641 | 3300025304 | Bacteria | 4200 |
| 329 | Ga0209257_1012654 | 3300025304 | Bacteria | 3867 |
| 330 | Ga0209257_1047071 | 3300025304 | Bacteria | 1242 |
| 331 | Ga0207697_10000159 | 3300025315 | Bacteria | 33779 |
| 332 | Ga0207697_10002051 | 3300025315 | Bacteria | 10609 |
| 333 | Ga0207682_10052540 | 3300025893 | Bacteria | 1689 |
| 334 | Ga0207692_10026706 | 3300025898 | Bacteria | 2711 |
| 335 | Ga0207692_10029280 | 3300025898 | Bacteria | 2615 |
| 336 | Ga0207642_10018374 | 3300025899 | Unclassified | 2682 |
| 337 | Ga0207688_10003223 | 3300025901 | Bacteria | 8909 |
| 338 | Ga0207680_10014740 | 3300025903 | Bacteria | 4058 |
| 339 | Ga0207680_10136531 | 3300025903 | Bacteria | 1622 |
| 340 | Ga0207647_10005088 | 3300025904 | Bacteria | 9697 |
| 341 | Ga0207647_10008525 | 3300025904 | Bacteria | 7342 |
| 342 | Ga0207647_10042160 | 3300025904 | Bacteria | 2865 |
| 343 | Ga0207685_10032203 | 3300025905 | Unclassified | 1885 |
| 344 | Ga0207699_10033234 | 3300025906 | Unclassified | 2914 |
| 345 | Ga0207645_10000188 | 3300025907 | Bacteria | 49705 |
| 346 | Ga0207645_10005345 | 3300025907 | Bacteria | 9336 |
| 347 | Ga0207705_10038194 | 3300025909 | Bacteria | 3437 |
| 348 | Ga0207684_10000595 | 3300025910 | Bacteria | 43323 |
| 349 | Ga0207707_10172548 | 3300025912 | Bacteria | 1889 |
| 350 | Ga0207707_10245796 | 3300025912 | Bacteria | 1555 |
| 351 | Ga0207695_10001062 | 3300025913 | Bacteria | 48136 |
| 352 | Ga0207695_10001671 | 3300025913 | Bacteria | 35725 |
| 353 | Ga0207695_10020536 | 3300025913 | Bacteria | 7561 |
| 354 | Ga0207671_10000028 | 3300025914 | Bacteria | 263092 |
| 355 | Ga0207671_10142296 | 3300025914 | Bacteria | 1849 |
| 356 | Ga0207693_10572869 | 3300025915 | Unclassified | 880 |
| 357 | Ga0207663_10026116 | 3300025916 | Bacteria | 3386 |
| 358 | Ga0207663_10311179 | 3300025916 | Bacteria | 1180 |
| 359 | Ga0207662_10052776 | 3300025918 | Bacteria | 2420 |
| 360 | Ga0207657_10014776 | 3300025919 | Bacteria | 7602 |
| 361 | Ga0207657_10079639 | 3300025919 | Bacteria | 2756 |
| 362 | Ga0207657_10176916 | 3300025919 | Unclassified | 1726 |
| 363 | Ga0207649_10120725 | 3300025920 | Unclassified | 1766 |
| 364 | Ga0207646_10495730 | 3300025922 | Bacteria | 1101 |
| 365 | Ga0207681_10000346 | 3300025923 | Bacteria | 33215 |
| 366 | Ga0207681_10045775 | 3300025923 | Bacteria | 2940 |
| 367 | Ga0207694_10049824 | 3300025924 | Bacteria | 3242 |
| 368 | Ga0207650_10006763 | 3300025925 | Bacteria | 7819 |
| 369 | Ga0207659_10001566 | 3300025926 | Bacteria | 13571 |
| 370 | Ga0207659_10659957 | 3300025926 | Unclassified | 894 |
| 371 | Ga0207687_10575687 | 3300025927 | Unclassified | 947 |
| 372 | Ga0207700_10102883 | 3300025928 | Bacteria | 2282 |
| 373 | Ga0207700_10113021 | 3300025928 | Bacteria | 2189 |
| 374 | Ga0207700_10122183 | 3300025928 | Bacteria | 2113 |
| 375 | Ga0207664_10000132 | 3300025929 | Bacteria | 64236 |
| 376 | Ga0207664_10000170 | 3300025929 | Bacteria | 51533 |
| 377 | Ga0207664_10125400 | 3300025929 | Bacteria | 2155 |
| 378 | Ga0207664_10300410 | 3300025929 | Bacteria | 1412 |
| 379 | Ga0207644_10012665 | 3300025931 | Bacteria | 5605 |
| 380 | Ga0207644_10033242 | 3300025931 | Unclassified | 3602 |
| 381 | Ga0207690_10000534 | 3300025932 | Bacteria | 24783 |
| 382 | Ga0207690_10023745 | 3300025932 | Bacteria | 3831 |
| 383 | Ga0207690_10153502 | 3300025932 | Bacteria | 1709 |
| 384 | Ga0207690_10250310 | 3300025932 | Bacteria | 1368 |
| 385 | Ga0207706_10000656 | 3300025933 | Bacteria | 36548 |
| 386 | Ga0207706_10015955 | 3300025933 | Bacteria | 6788 |
| 387 | Ga0207706_10042484 | 3300025933 | Bacteria | 4029 |
| 388 | Ga0207706_10366683 | 3300025933 | Bacteria | 1251 |
| 389 | Ga0207709_10274710 | 3300025935 | Bacteria | 1242 |
| 390 | Ga0207670_10045495 | 3300025936 | Unclassified | 2910 |
| 391 | Ga0207670_10083558 | 3300025936 | Bacteria | 2240 |
| 392 | Ga0207670_10122370 | 3300025936 | Bacteria | 1894 |
| 393 | Ga0207669_10008892 | 3300025937 | Unclassified | 4744 |
| 394 | Ga0207665_10019553 | 3300025939 | Bacteria | 4453 |
| 395 | Ga0207691_10082314 | 3300025940 | Bacteria | 2891 |
| 396 | Ga0207691_10252435 | 3300025940 | Unclassified | 1522 |
| 397 | Ga0207711_10046396 | 3300025941 | Bacteria | 3712 |
| 398 | Ga0207711_10761785 | 3300025941 | Bacteria | 902 |
| 399 | Ga0207689_10055035 | 3300025942 | Bacteria | 3275 |
| 400 | Ga0207679_10004813 | 3300025945 | Bacteria | 8413 |
| 401 | Ga0207667_10001299 | 3300025949 | Bacteria | 31318 |
| 402 | Ga0207667_10016517 | 3300025949 | Bacteria | 8337 |
| 403 | Ga0207667_10122592 | 3300025949 | Bacteria | 2678 |
| 404 | Ga0207667_10196747 | 3300025949 | Bacteria | 2068 |
| 405 | Ga0207651_10013358 | 3300025960 | Bacteria | 4698 |
| 406 | Ga0207668_10002313 | 3300025972 | Bacteria | 11120 |
| 407 | Ga0207668_10020705 | 3300025972 | Bacteria | 4185 |
| 408 | Ga0207640_10000313 | 3300025981 | Bacteria | 32457 |
| 409 | Ga0207640_10000713 | 3300025981 | Bacteria | 19283 |
| 410 | Ga0207658_10003941 | 3300025986 | Bacteria | 10429 |
| 411 | Ga0207658_10031933 | 3300025986 | Bacteria | 3743 |
| 412 | Ga0207658_10038570 | 3300025986 | Bacteria | 3442 |
| 413 | Ga0207677_10004906 | 3300026023 | Bacteria | 7221 |
| 414 | Ga0207677_10028286 | 3300026023 | Bacteria | 3542 |
| 415 | Ga0207677_10034188 | 3300026023 | Bacteria | 3289 |
| 416 | Ga0207703_10251262 | 3300026035 | Bacteria | 1594 |
| 417 | Ga0207639_10173684 | 3300026041 | Bacteria | 1827 |
| 418 | Ga0207678_10142217 | 3300026067 | Bacteria | 2048 |
| 419 | Ga0207708_10351668 | 3300026075 | Bacteria | 1209 |
| 420 | Ga0207702_10149867 | 3300026078 | Bacteria | 2120 |
| 421 | Ga0207641_10051040 | 3300026088 | Bacteria | 3502 |
| 422 | Ga0207648_10121618 | 3300026089 | Bacteria | 2296 |
| 423 | Ga0207676_10011408 | 3300026095 | Bacteria | 6351 |
| 424 | Ga0207674_10000091 | 3300026116 | Bacteria | 99785 |
| 425 | Ga0207674_10012340 | 3300026116 | Bacteria | 9551 |
| 426 | Ga0207674_10036136 | 3300026116 | Bacteria | 5151 |
| 427 | Ga0207674_10088243 | 3300026116 | Bacteria | 3095 |
| 428 | Ga0207683_10051991 | 3300026121 | Bacteria | 3590 |
| 429 | Ga0207698_10017795 | 3300026142 | Bacteria | 4830 |
| 430 | Ga0207698_11256621 | 3300026142 | Unclassified | 755 |
| 431 | Ga0207698_11496840 | 3300026142 | Bacteria | 690 |
| 432 | Ga0207428_10245193 | 3300027907 | Bacteria | 1337 |
| 433 | Ga0268266_10497727 | 3300028379 | Bacteria | 1163 |
| 434 | Ga0268264_10105113 | 3300028381 | Bacteria | 2462 |
| 435 | Ga0265338_10753051 | 3300028800 | Bacteria | 670 |
| 436 | Ga0307413_10450048 | 3300031824 | Bacteria | 1022 |
| 437 | Ga0307406_10003526 | 3300031901 | Bacteria | 8524 |
| 438 | Ga0307406_10038443 | 3300031901 | Bacteria | 2962 |
| 439 | Ga0307416_100293873 | 3300032002 | Bacteria | 1610 |
| 440 | Ga0307414_10555634 | 3300032004 | Bacteria | 1024 |
| 441 | Ga0307411_10775547 | 3300032005 | Bacteria | 842 |
| 442 | Ga0307507_10350648 | 3300033179 | Bacteria | 868 |
| 443 | Ga0373943_0023573 | 3300035170 | Unclassified | 2863 |
| 444 | Ga0373946_0140307 | 3300035171 | Unclassified | 1120 |
| 445 | Ga0373931_0947090 | 3300035691 | Bacteria | 581 |
| 446 | Ga0373935_0062892 | 3300035692 | Unclassified | 2378 |
| 447 | Ga0373925_0504939 | 3300037068 | Bacteria | 993 |
| 448 | Ga0395899_0057282 | 3300037312 | Bacteria | 2877 |
| 449 | Ga0395899_0057761 | 3300037312 | Bacteria | 2863 |
| 450 | Ga0395899_0415327 | 3300037312 | Bacteria | 887 |
| 451 | Ga0395900_0004220 | 3300037418 | Bacteria | 15251 |
| 452 | Ga0395898_0008857 | 3300037466 | Bacteria | 10605 |
| 453 | Ga0395898_0026299 | 3300037466 | Bacteria | 5858 |
| 454 | Ga0395898_0040683 | 3300037466 | Bacteria | 4595 |
| 455 | Ga0395898_0066638 | 3300037466 | Bacteria | 3487 |
| 456 | Ga0395898_0205699 | 3300037466 | Bacteria | 1878 |
| 457 | Ga0395905_0182111 | 3300037471 | Bacteria | 1973 |
| 458 | Ga0395901_0000667 | 3300038443 | Bacteria | 39465 |
| 459 | Ga0395901_0013437 | 3300038443 | Bacteria | 8322 |
| 460 | Ga0395901_0060007 | 3300038443 | Bacteria | 3957 |
| 461 | Ga0395901_0098124 | 3300038443 | Bacteria | 3072 |
| 462 | Ga0395901_0346162 | 3300038443 | Bacteria | 1534 |
| 463 | Ga0395901_0365120 | 3300038443 | Bacteria | 1488 |
| 464 | Ga0395901_0391962 | 3300038443 | Bacteria | 1428 |
| 465 | Ga0439436_0004115 | 3300041404 | Bacteria | 4456 |
| 466 | Ga0439436_0008877 | 3300041404 | Bacteria | 3084 |
| 467 | Ga0439439_0018752 | 3300041406 | Bacteria | 1712 |
| 468 | Ga0439465_0012328 | 3300041413 | Bacteria | 2675 |
| 469 | Ga0451835_1124474 | 3300041492 | Bacteria | 688 |
| 470 | Ga0439431_0073660 | 3300041997 | Bacteria | 913 |
| 471 | Ga0439437_004370 | 3300042000 | Bacteria | 1540 |
| 472 | Ga0439449_0092480 | 3300042007 | Bacteria | 1117 |
| 473 | Ga0439451_012943 | 3300042009 | Unclassified | 1686 |
| 474 | Ga0439452_021211 | 3300042010 | Bacteria | 1696 |
| 475 | Ga0439462_0019562 | 3300042015 | Bacteria | 1763 |
| 476 | Ga0439446_0056598 | 3300042156 | Bacteria | 1179 |
| 477 | Ga0439446_0057602 | 3300042156 | Bacteria | 1170 |
| 478 | Ga0439434_0131618 | 3300042435 | Bacteria | 821 |
| 479 | Ga0466969_0164579 | 3300044656 | Bacteria | 1018 |
| 480 | Ga0466972_0041093 | 3300044658 | Bacteria | 2251 |
| 481 | Ga0466982_0000007 | 3300044672 | Bacteria | 250854 |
| 482 | Ga0466965_0045915 | 3300044683 | Bacteria | 2161 |
| 483 | Ga0466966_0001249 | 3300044684 | Bacteria | 16281 |
| 484 | Ga0466964_0053229 | 3300044706 | Bacteria | 1665 |
| 485 | Ga0466971_0004245 | 3300044719 | Bacteria | 6178 |
| 486 | Ga0466968_0009931 | 3300044735 | Bacteria | 3675 |
| 487 | Ga0466970_0008624 | 3300044765 | Bacteria | 5135 |
| 488 | Ga0466970_0222300 | 3300044765 | Bacteria | 1054 |
| 489 | Ga0466960_0075668 | 3300044901 | Bacteria | 1685 |
| 490 | Ga0466960_0116669 | 3300044901 | Bacteria | 1393 |
| 491 | Ga0466959_0266607 | 3300045049 | Bacteria | 1178 |
| 492 | Ga0466959_0308850 | 3300045049 | Bacteria | 1082 |
| 493 | Ga0466959_0342454 | 3300045049 | Bacteria | 1020 |
| 494 | Ga0451576_0109456 | 3300045051 | Bacteria | 2875 |
| 495 | Ga0466958_0116383 | 3300045836 | Bacteria | 1671 |
| 496 | Ga0495629_0216372 | 3300046459 | Bacteria | 1322 |
| 497 | Ga0495638_0000082 | 3300046460 | Bacteria | 153986 |
| 498 | Ga0495638_0000104 | 3300046460 | Bacteria | 135059 |
| 499 | Ga0495638_0120739 | 3300046460 | Bacteria | 1549 |
| 500 | Ga0495650_0000443 | 3300046471 | Bacteria | 66631 |
| 501 | Ga0495580_0106896 | 3300046472 | Bacteria | 1944 |
| 502 | Ga0495639_0478601 | 3300046475 | Bacteria | 634 |
| 503 | Ga0495662_0032056 | 3300046476 | Unclassified | 2539 |
| 504 | Ga0495606_0000113 | 3300046507 | Bacteria | 136805 |
| 505 | Ga0495630_0436132 | 3300046517 | Unclassified | 1004 |
| 506 | Ga0495640_0134264 | 3300046533 | Bacteria | 1600 |
| 507 | Ga0495597_0235949 | 3300046542 | Bacteria | 722 |
| 508 | Ga0495635_0222450 | 3300046663 | Bacteria | 1277 |
| 509 | Ga0495588_0408263 | 3300046674 | Bacteria | 713 |
| 510 | Ga0495669_0329134 | 3300046684 | Unclassified | 738 |
| 511 | Ga0495613_0598927 | 3300046689 | Bacteria | 734 |
| 512 | Ga0495649_0004395 | 3300046694 | Bacteria | 9218 |
| 513 | Ga0495600_0158582 | 3300046809 | Bacteria | 1463 |
| 514 | Ga0495674_0078351 | 3300047319 | Bacteria | 2839 |
| 515 | Ga0495680_0212743 | 3300047322 | Bacteria | 1383 |
| 516 | Ga0495684_0189897 | 3300047471 | Bacteria | 1519 |
| 517 | Ga0495684_0258470 | 3300047471 | Bacteria | 1264 |
| 518 | Ga0496100_0396396 | 3300048903 | Bacteria | 1050 |
| 519 | Ga0496100_0443469 | 3300048903 | Bacteria | 994 |
| 520 | Ga0496101_0003479 | 3300048904 | Bacteria | 9820 |
| 521 | Ga0496101_0004032 | 3300048904 | Bacteria | 9184 |
| 522 | Ga0496101_0124570 | 3300048904 | Bacteria | 1952 |
| 523 | Ga0496101_0727372 | 3300048904 | Bacteria | 783 |
| 524 | Ga0496102_0032832 | 3300048905 | Unclassified | 4664 |
| 525 | Ga0496103_0034644 | 3300048906 | Unclassified | 3088 |
| 526 | Ga0496104_0016434 | 3300048907 | Bacteria | 6722 |
| 527 | Ga0496104_0023548 | 3300048907 | Bacteria | 5662 |
| 528 | Ga0496104_0214829 | 3300048907 | Bacteria | 1835 |
| 529 | Ga0496104_0495223 | 3300048907 | Bacteria | 1133 |
| 530 | Ga0496105_0081850 | 3300048908 | Bacteria | 2666 |
| 531 | Ga0496105_0186334 | 3300048908 | Bacteria | 1698 |
| 532 | Ga0496105_0231105 | 3300048908 | Unclassified | 1503 |
| 533 | Ga0496106_0027368 | 3300048909 | Bacteria | 4246 |
| 534 | Ga0496107_0070330 | 3300048910 | Bacteria | 2540 |
| 535 | Ga0496107_0400004 | 3300048910 | Bacteria | 1021 |
| 536 | Ga0496109_0447213 | 3300048912 | Bacteria | 1221 |
| 537 | Ga0496110_0257191 | 3300048913 | Bacteria | 1589 |
| 538 | Ga0496111_0302581 | 3300048914 | Bacteria | 1185 |
| 539 | Ga0496112_0080727 | 3300048915 | Unclassified | 3216 |
| 540 | Ga0496112_0175257 | 3300048915 | Bacteria | 2110 |
| 541 | Ga0496113_0022495 | 3300048916 | Bacteria | 4460 |
| 542 | Ga0496113_0362845 | 3300048916 | Unclassified | 1162 |
| 543 | Ga0496114_0054979 | 3300048917 | Bacteria | 3319 |
| 544 | Ga0496115_0000670 | 3300048918 | Bacteria | 25300 |
| 545 | Ga0496115_0001663 | 3300048918 | Bacteria | 15992 |
| 546 | Ga0496115_0003761 | 3300048918 | Bacteria | 10906 |
| 547 | Ga0496115_0011255 | 3300048918 | Bacteria | 6704 |
| 548 | Ga0496115_0130818 | 3300048918 | Bacteria | 2068 |
| 549 | Ga0496116_0051651 | 3300048919 | Bacteria | 2729 |
| 550 | Ga0496117_0053334 | 3300048920 | Bacteria | 2842 |
| 551 | Ga0496117_0058859 | 3300048920 | Bacteria | 2658 |
| 552 | Ga0496118_0001339 | 3300048921 | Bacteria | 37382 |
| 553 | Ga0496118_0001517 | 3300048921 | Bacteria | 34567 |
| 554 | Ga0496119_0000926 | 3300048922 | Bacteria | 37977 |
| 555 | Ga0496119_0028238 | 3300048922 | Bacteria | 3833 |
| 556 | Ga0496120_0000054 | 3300048923 | Bacteria | 181170 |
| 557 | Ga0496120_0000154 | 3300048923 | Bacteria | 114615 |
| 558 | Ga0496121_0005127 | 3300048924 | Bacteria | 17063 |
| 559 | Ga0496121_0024345 | 3300048924 | Bacteria | 5793 |
| 560 | Ga0496121_0026560 | 3300048924 | Bacteria | 5449 |
| 561 | Ga0496121_0056632 | 3300048924 | Bacteria | 3254 |
| 562 | Ga0496121_0073080 | 3300048924 | Bacteria | 2750 |
| 563 | Ga0496126_0000411 | 3300048929 | Bacteria | 86952 |
| 564 | Ga0496126_0159477 | 3300048929 | Bacteria | 1928 |
| 565 | Ga0495678_210303 | 3300049459 | Bacteria | 595 |
| 566 | Ga0501031_0507305 | 3300049568 | Bacteria | 778 |
| 567 | Ga0501031_0739901 | 3300049568 | Bacteria | 631 |
| 568 | Ga0501033_0125704 | 3300049570 | Bacteria | 1859 |
| 569 | Ga0501033_0664458 | 3300049570 | Bacteria | 711 |
| 570 | Ga0501034_0053598 | 3300049571 | Bacteria | 4061 |
| 571 | Ga0501036_0513914 | 3300049572 | Bacteria | 996 |
| 572 | Ga0501037_0085496 | 3300049573 | Bacteria | 2284 |
| 573 | Ga0501038_0150946 | 3300049574 | Bacteria | 1894 |
| 574 | Ga0501043_0052664 | 3300049579 | Bacteria | 3196 |
| 575 | Ga0501043_0070994 | 3300049579 | Bacteria | 2735 |
| 576 | Ga0501046_0331324 | 3300049580 | Bacteria | 1108 |
| 577 | Ga0501047_0006972 | 3300049581 | Bacteria | 10609 |
| 578 | Ga0501047_0045443 | 3300049581 | Bacteria | 4247 |
| 579 | Ga0501047_0470674 | 3300049581 | Bacteria | 1085 |
| 580 | Ga0501048_0011435 | 3300049582 | Bacteria | 6622 |
| 581 | Ga0501067_0289461 | 3300049583 | Bacteria | 912 |
| 582 | Ga0501070_0290608 | 3300049586 | Bacteria | 1332 |
| 583 | Ga0501035_0033227 | 3300049822 | Bacteria | 4691 |
| 584 | Ga0501035_0686464 | 3300049822 | Bacteria | 827 |
| 585 | Ga0501044_0082470 | 3300049823 | Bacteria | 3253 |
| 586 | Ga0501044_0425105 | 3300049823 | Bacteria | 1238 |
| 587 | nmdc:mga05p37_21905_c1 | 3300050507 | Bacteria | 7742 |
| 588 | nmdc:mga09592_23157_c1 | 3300050508 | Bacteria | 5128 |
| 589 | nmdc:mga0qj67_47783_c1 | 3300050509 | Bacteria | 3381 |
| 590 | nmdc:mga06r32_1112778_c1 | 3300050510 | Bacteria | 739 |
| 591 | nmdc:mga06r32_450971_c1 | 3300050510 | Bacteria | 1266 |
| 592 | nmdc:mga06r32_60891_c1 | 3300050510 | Bacteria | 3633 |
| 593 | nmdc:mga08y16_214276_c1 | 3300050511 | Bacteria | 1994 |
| 594 | nmdc:mga08y16_23115_c2 | 3300050511 | Bacteria | 3771 |
| 595 | nmdc:mga08y16_452034_c1 | 3300050511 | Bacteria | 1310 |
| 596 | nmdc:mga08y16_806754_c1 | 3300050511 | Unclassified | 931 |
| 597 | nmdc:mga0n895_299_c1 | 3300050512 | Bacteria | 32714 |
| 598 | nmdc:mga0n895_831465_c1 | 3300050512 | Bacteria | 912 |
| 599 | nmdc:mga0rr50_627859_c1 | 3300050513 | Bacteria | 916 |
| 600 | nmdc:mga08x19_34941_c1 | 3300050514 | Bacteria | 3179 |
| 601 | Ga0495601_0408152 | 3300053077 | Bacteria | 880 |
| 602 | Ga0466962_0001663 | 3300061719 | Bacteria | 10427 |
| 603 | Ga0466962_0055718 | 3300061719 | Bacteria | 1889 |
| 604 | 2538834265 | 2537561836 | Bacteria | 3910579 |
| 605 | 2643895621 | 2643221577 | Bacteria | 3710843 |
| 606 | 2644477802 | 2643221685 | Bacteria | 3673288 |
| 607 | 2687582045 | 2687453130 | Bacteria | 4227172 |
| 608 | 2884411630 | 2884411467 | Bacteria | 5246714 |
| 609 | 2895397399 | 2895395659 | Bacteria | 3983269 |
| 610 | 2928965079 | 2928963466 | Bacteria | 5165703 |
| 611 | 2939614970 | 2939611941 | Bacteria | 3892017 |
| 612 | 2941490852 | 2941489479 | Bacteria | 6313767 |
| 613 | 2995950268 | 2995948881 | Bacteria | 6358104 |
| 614 | 8003015072 | 8003014200 | Bacteria | 4059994 |
| 615 | Ga0070676_10000093 | |||
| 616 | JGI24746J21847_1004473 | |||
| 617 | JGI24739J22299_10026837 | |||
| 618 | JGI24737J22298_10003313 | |||
| 619 | JGI24737J22298_10040539 | |||
| 620 | JGI24735J21928_10001795 | |||
| 621 | JGI24735J21928_10031010 | |||
| 622 | JGI25162J39368_1001103 | |||
| 623 | JGI25162J39368_1001211 | |||
| 624 | JGI25162J39368_1001631 | |||
| 625 | JGI25157J39369_1000343 | |||
| 626 | JGI25157J39369_1000788 | |||
| 627 | JGI25163J39215_1000482 | |||
| 628 | JGI25164J39214_1000093 | |||
| 629 | JGI25164J39214_1000581 | |||
| 630 | JGI25164J39214_1000806 | |||
| 631 | JGI25151J46595_10067881 | |||
| 632 | JGI25165J46597_1000283 | |||
| 633 | JGI25165J46597_1001571 | |||
| 634 | JGI25165J46597_1002330 | |||
| 635 | JGI25165J46597_1018480 | |||
| 636 | rootH1_10063477 | |||
| 637 | rootH1_10099417 | |||
| 638 | rootH2_10066056 | |||
| 639 | Ga0006562J51391_1006439 | |||
| 640 | Ga0006562J51391_1006443 | |||
| 641 | Ga0055538_1000681 | |||
| 642 | Ga0055533_1000324 | |||
| 643 | Ga0055535_1000070 | |||
| 644 | Ga0055535_1000152 | |||
| 645 | Ga0055542_1000232 | |||
| 646 | Ga0055542_1000606 | |||
| 647 | Ga0055529_1000024 | |||
| 648 | Ga0055529_1000082 | |||
| 649 | Ga0055526_1000072 | |||
| 650 | Ga0055537_1000665 | |||
| 651 | Ga0055524_1000173 | |||
| 652 | Ga0055524_1008199 | |||
| 653 | Ga0055524_1035474 | |||
| 654 | Ga0055536_1007458 | |||
| 655 | Ga0055536_1024684 | |||
| 656 | Ga0055536_1038454 | |||
| 657 | Ga0055534_1000628 | |||
| 658 | Ga0055528_1000085 | |||
| 659 | Ga0055530_10001219 | |||
| 660 | Ga0055531_10016729 | |||
| 661 | Ga0055531_10020584 | |||
| 662 | Ga0055531_10023824 | |||
| 663 | Ga0055531_10040003 | |||
| 664 | Ga0055531_10046742 | |||
| 665 | Ga0065165_1003415 | |||
| 666 | Ga0065712_10076093 | |||
| 667 | Ga0065715_10009293 | |||
| 668 | Ga0065707_10249815 | |||
| 669 | Ga0070676_10010043 | |||
| 670 | Ga0070683_100295045 | |||
| 671 | Ga0070690_100103127 | |||
| 672 | Ga0070690_100397064 | |||
| 673 | Ga0070670_100013984 | |||
| 674 | Ga0070670_100203882 | |||
| 675 | Ga0070677_10094162 | |||
| 676 | Ga0068869_100044088 | |||
| 677 | Ga0070666_10016070 | |||
| 678 | Ga0070666_10107195 | |||
| 679 | Ga0070680_100201892 | |||
| 680 | Ga0068868_100001212 | |||
| 681 | Ga0068868_100007275 | |||
| 682 | Ga0068868_100057822 | |||
| 683 | Ga0070660_100452928 | |||
| 684 | Ga0070660_100876273 | |||
| 685 | Ga0070689_100037307 | |||
| 686 | Ga0070689_100068454 | |||
| 687 | Ga0070689_100204613 | |||
| 688 | Ga0070689_100215220 | |||
| 689 | Ga0070689_100497724 | |||
| 690 | Ga0070687_100002785 | |||
| 691 | Ga0070661_100021256 | |||
| 692 | Ga0070692_10060585 | |||
| 693 | Ga0070668_100003497 | |||
| 694 | Ga0070668_100116736 | |||
| 695 | Ga0070669_100032261 | |||
| 696 | Ga0070669_100056895 | |||
| 697 | Ga0070675_100000332 | |||
| 698 | Ga0070675_100006328 | |||
| 699 | Ga0070675_100025742 | |||
| 700 | Ga0070675_100619917 | |||
| 701 | Ga0070671_100022499 | |||
| 702 | Ga0070671_100099489 | |||
| 703 | Ga0070671_100346250 | |||
| 704 | Ga0070674_100002544 | |||
| 705 | Ga0070673_100010708 | |||
| 706 | Ga0070673_100121911 | |||
| 707 | Ga0070688_100136862 | |||
| 708 | Ga0070688_100195450 | |||
| 709 | Ga0070688_100502506 | |||
| 710 | Ga0070659_100404808 | |||
| 711 | Ga0070667_100007165 | |||
| 712 | Ga0070667_100014461 | |||
| 713 | Ga0070667_100071761 | |||
| 714 | Ga0070667_100560026 | |||
| 715 | Ga0070709_10421432 | |||
| 716 | Ga0070714_100000830 | |||
| 717 | Ga0070714_100006315 | |||
| 718 | Ga0070714_100037494 | |||
| 719 | Ga0070713_100163514 | |||
| 720 | Ga0070710_10034613 | |||
| 721 | Ga0070710_10200647 | |||
| 722 | Ga0070711_100127693 | |||
| 723 | Ga0070711_100657823 | |||
| 724 | Ga0070705_100006957 | |||
| 725 | Ga0070705_100019996 | |||
| 726 | Ga0070700_100410990 | |||
| 727 | Ga0070708_100222382 | |||
| 728 | Ga0070708_100246564 | |||
| 729 | Ga0070663_100044187 | |||
| 730 | Ga0070663_100069301 | |||
| 731 | Ga0070678_100359898 | |||
| 732 | Ga0070662_100000824 | |||
| 733 | Ga0070662_100014903 | |||
| 734 | Ga0070662_100434603 | |||
| 735 | Ga0070681_10105653 | |||
| 736 | Ga0070681_10304779 | |||
| 737 | Ga0068867_100068167 | |||
| 738 | Ga0068867_100468723 | |||
| 739 | Ga0070685_10097155 | |||
| 740 | Ga0070706_100052568 | |||
| 741 | Ga0070706_100085994 | |||
| 742 | Ga0070699_100448502 | |||
| 743 | Ga0070699_101155325 | |||
| 744 | Ga0070679_100138912 | |||
| 745 | Ga0070697_100025251 | |||
| 746 | Ga0070697_100504701 | |||
| 747 | Ga0068853_100062807 | |||
| 748 | Ga0070672_100005502 | |||
| 749 | Ga0070672_100142681 | |||
| 750 | Ga0070686_100028279 | |||
| 751 | Ga0070695_100056623 | |||
| 752 | Ga0070696_100021450 | |||
| 753 | Ga0070696_100030481 | |||
| 754 | Ga0070693_100084291 | |||
| 755 | Ga0070693_100097970 | |||
| 756 | Ga0070704_100024248 | |||
| 757 | Ga0070704_100081303 | |||
| 758 | Ga0070704_100564480 | |||
| 759 | Ga0068855_100014993 | |||
| 760 | Ga0068855_100088838 | |||
| 761 | Ga0068855_100193450 | |||
| 762 | Ga0068855_100870963 | |||
| 763 | Ga0068855_101109784 | |||
| 764 | Ga0070664_100043756 | |||
| 765 | Ga0068857_100010936 | |||
| 766 | Ga0068857_100322385 | |||
| 767 | Ga0068857_101050013 | |||
| 768 | Ga0068854_100000327 | |||
| 769 | Ga0068854_100216595 | |||
| 770 | Ga0068856_100070794 | |||
| 771 | Ga0068856_100081014 | |||
| 772 | Ga0070702_100073848 | |||
| 773 | Ga0068852_100064660 | |||
| 774 | Ga0068852_100262164 | |||
| 775 | Ga0068852_100392282 | |||
| 776 | Ga0068859_100123820 | |||
| 777 | Ga0068859_100276533 | |||
| 778 | Ga0068864_100023613 | |||
| 779 | Ga0068858_100066703 | |||
| 780 | Ga0068858_100540127 | |||
| 781 | Ga0068860_100001706 | |||
| 782 | Ga0068860_100153619 | |||
| 783 | Ga0081455_10004812 | |||
| 784 | Ga0081455_10022598 | |||
| 785 | Ga0081455_10351787 | |||
| 786 | Ga0070717_10188266 | |||
| 787 | Ga0070717_10271485 | |||
| 788 | Ga0070715_10029224 | |||
| 789 | Ga0070716_100013517 | |||
| 790 | Ga0070712_100194146 | |||
| 791 | Ga0097621_100080613 | |||
| 792 | Ga0075428_100173940 | |||
| 793 | Ga0075428_101176585 | |||
| 794 | Ga0075430_100003406 | |||
| 795 | Ga0075431_100029917 | |||
| 796 | Ga0075431_100449498 | |||
| 797 | Ga0075434_100068274 | |||
| 798 | Ga0075429_100076679 | |||
| 799 | Ga0068865_100094184 | |||
| 800 | Ga0097620_100123819 | |||
| 801 | Ga0097620_100276535 | |||
| 802 | Ga0105240_10001947 | |||
| 803 | Ga0105240_10002550 | |||
| 804 | Ga0105240_10064493 | |||
| 805 | Ga0111539_10083053 | |||
| 806 | Ga0111539_10093864 | |||
| 807 | Ga0111539_10221165 | |||
| 808 | Ga0111539_11056919 | |||
| 809 | Ga0105245_10037440 | |||
| 810 | Ga0105245_10057793 | |||
| 811 | Ga0114129_10013834 | |||
| 812 | Ga0105243_10237328 | |||
| 813 | Ga0105241_10418124 | |||
| 814 | Ga0105242_10025442 | |||
| 815 | Ga0105242_10226462 | |||
| 816 | Ga0105242_10334196 | |||
| 817 | Ga0105242_10633597 | |||
| 818 | Ga0105248_10329294 | |||
| 819 | Ga0105248_11429120 | |||
| 820 | Ga0105248_11979558 | |||
| 821 | Ga0105237_10000145 | |||
| 822 | Ga0105237_10296831 | |||
| 823 | Ga0105238_10092290 | |||
| 824 | Ga0105238_11853297 | |||
| 825 | Ga0105249_10001374 | |||
| 826 | Ga0105239_10000174 | |||
| 827 | Ga0105239_10002323 | |||
| 828 | Ga0157345_1027577 | |||
| 829 | Ga0157314_1001349 | |||
| 830 | Ga0157347_1004001 | |||
| 831 | Ga0157373_10116633 | |||
| 832 | Ga0157373_10313648 | |||
| 833 | Ga0157373_10340412 | |||
| 834 | Ga0157373_10392074 | |||
| 835 | Ga0157373_10609047 | |||
| 836 | Ga0157373_10879373 | |||
| 837 | Ga0157371_10011460 | |||
| 838 | Ga0157371_10349557 | |||
| 839 | Ga0157370_10047184 | |||
| 840 | Ga0157369_10095426 | |||
| 841 | Ga0157369_10208387 | |||
| 842 | Ga0157374_10010001 | |||
| 843 | Ga0157374_10321596 | |||
| 844 | Ga0157378_10020756 | |||
| 845 | Ga0157378_10124306 | |||
| 846 | Ga0163162_10001824 | |||
| 847 | Ga0163162_10009523 | |||
| 848 | Ga0163162_10088338 | |||
| 849 | Ga0163162_10091145 | |||
| 850 | Ga0163162_10287424 | |||
| 851 | Ga0157372_10099392 | |||
| 852 | Ga0157372_10459074 | |||
| 853 | Ga0157372_10472697 | |||
| 854 | Ga0157372_10530387 | |||
| 855 | Ga0157372_11670041 | |||
| 856 | Ga0157375_10005856 | |||
| 857 | Ga0157375_10102170 | |||
| 858 | Ga0163163_10056085 | |||
| 859 | Ga0182008_10013425 | |||
| 860 | Ga0182008_10045457 | |||
| 861 | Ga0182008_10200788 | |||
| 862 | Ga0157377_10076823 | |||
| 863 | Ga0157377_10707249 | |||
| 864 | Ga0157376_10016825 | |||
| 865 | Ga0182006_1153021 | |||
| 866 | Ga0182007_10013113 | |||
| 867 | Ga0182007_10049892 | |||
| 868 | Ga0182007_10056263 | |||
| 869 | Ga0182007_10116689 | |||
| 870 | Ga0183369_1003 | |||
| 871 | Ga0183368_1002 | |||
| 872 | Ga0163161_10012495 | |||
| 873 | Ga0163161_10118828 | |||
| 874 | Ga0197907_10754485 | |||
| 875 | Ga0206353_10701236 | |||
| 876 | Ga0209435_100965 | |||
| 877 | Ga0209760_100330 | |||
| 878 | Ga0209784_100011 | |||
| 879 | Ga0209566_102792 | |||
| 880 | Ga0209674_100061 | |||
| 881 | Ga0209674_100858 | |||
| 882 | Ga0209672_106339 | |||
| 883 | Ga0207427_100026 | |||
| 884 | Ga0207427_100147 | |||
| 885 | Ga0207427_100205 | |||
| 886 | Ga0207427_101454 | |||
| 887 | Ga0207427_106956 | |||
| 888 | Ga0209437_100005 | |||
| 889 | Ga0209437_100241 | |||
| 890 | Ga0209437_100340 | |||
| 891 | Ga0209437_100349 | |||
| 892 | Ga0209437_116347 | |||
| 893 | Ga0209258_100027 | |||
| 894 | Ga0209258_102071 | |||
| 895 | Ga0207425_1025235 | |||
| 896 | Ga0209646_1005902 | |||
| 897 | Ga0209646_1027153 | |||
| 898 | Ga0209026_1000017 | |||
| 899 | Ga0209026_1000018 | |||
| 900 | Ga0209026_1003512 | |||
| 901 | Ga0209148_1000001 | |||
| 902 | Ga0209148_1000002 | |||
| 903 | Ga0209759_1001248 | |||
| 904 | Ga0209759_1004487 | |||
| 905 | Ga0209129_1001119 | |||
| 906 | Ga0209233_1000002 | |||
| 907 | Ga0209233_1000011 | |||
| 908 | Ga0209233_1000315 | |||
| 909 | Ga0209565_1000001 | |||
| 910 | Ga0209565_1015866 | |||
| 911 | Ga0209455_1000019 | |||
| 912 | Ga0209673_1000001 | |||
| 913 | Ga0209673_1004055 | |||
| 914 | Ga0209130_1007366 | |||
| 915 | Ga0207673_1000941 | |||
| 916 | Ga0209675_1000001 | |||
| 917 | Ga0209675_1006701 | |||
| 918 | Ga0209675_1045195 | |||
| 919 | Ga0209676_1000875 | |||
| 920 | Ga0209676_1001240 | |||
| 921 | Ga0209676_1010760 | |||
| 922 | Ga0209676_1013959 | |||
| 923 | Ga0209676_1017043 | |||
| 924 | Ga0209025_1000564 | |||
| 925 | Ga0209025_1003024 | |||
| 926 | Ga0209025_1040121 | |||
| 927 | Ga0209025_1119105 | |||
| 928 | Ga0209564_1000001 | |||
| 929 | Ga0209564_1029549 | |||
| 930 | Ga0209564_1042483 | |||
| 931 | Ga0209758_1000647 | |||
| 932 | Ga0209758_1023925 | |||
| 933 | Ga0209050_1009346 | |||
| 934 | Ga0209050_1015414 | |||
| 935 | Ga0209256_1000006 | |||
| 936 | Ga0209256_1002134 | |||
| 937 | Ga0209256_1007997 | |||
| 938 | Ga0209256_1028829 | |||
| 939 | Ga0209051_1045090 | |||
| 940 | Ga0209257_1000343 | |||
| 941 | Ga0209257_1000738 | |||
| 942 | Ga0209257_1011641 | |||
| 943 | Ga0209257_1012654 | |||
| 944 | Ga0209257_1047071 | |||
| 945 | Ga0207697_10000159 | |||
| 946 | Ga0207697_10002051 | |||
| 947 | Ga0207682_10052540 | |||
| 948 | Ga0207692_10026706 | |||
| 949 | Ga0207692_10029280 | |||
| 950 | Ga0207642_10018374 | |||
| 951 | Ga0207688_10003223 | |||
| 952 | Ga0207680_10014740 | |||
| 953 | Ga0207680_10136531 | |||
| 954 | Ga0207647_10005088 | |||
| 955 | Ga0207647_10008525 | |||
| 956 | Ga0207647_10042160 | |||
| 957 | Ga0207685_10032203 | |||
| 958 | Ga0207699_10033234 | |||
| 959 | Ga0207645_10000188 | |||
| 960 | Ga0207645_10005345 | |||
| 961 | Ga0207705_10038194 | |||
| 962 | Ga0207684_10000595 | |||
| 963 | Ga0207707_10172548 | |||
| 964 | Ga0207707_10245796 | |||
| 965 | Ga0207695_10001062 | |||
| 966 | Ga0207695_10001671 | |||
| 967 | Ga0207695_10020536 | |||
| 968 | Ga0207671_10000028 | |||
| 969 | Ga0207671_10142296 | |||
| 970 | Ga0207693_10572869 | |||
| 971 | Ga0207663_10026116 | |||
| 972 | Ga0207663_10311179 | |||
| 973 | Ga0207662_10052776 | |||
| 974 | Ga0207657_10014776 | |||
| 975 | Ga0207657_10079639 | |||
| 976 | Ga0207657_10176916 | |||
| 977 | Ga0207649_10120725 | |||
| 978 | Ga0207646_10495730 | |||
| 979 | Ga0207681_10000346 | |||
| 980 | Ga0207681_10045775 | |||
| 981 | Ga0207694_10049824 | |||
| 982 | Ga0207650_10006763 | |||
| 983 | Ga0207659_10001566 | |||
| 984 | Ga0207659_10659957 | |||
| 985 | Ga0207687_10575687 | |||
| 986 | Ga0207700_10102883 | |||
| 987 | Ga0207700_10113021 | |||
| 988 | Ga0207700_10122183 | |||
| 989 | Ga0207664_10000132 | |||
| 990 | Ga0207664_10000170 | |||
| 991 | Ga0207664_10125400 | |||
| 992 | Ga0207664_10300410 | |||
| 993 | Ga0207644_10012665 | |||
| 994 | Ga0207644_10033242 | |||
| 995 | Ga0207690_10000534 | |||
| 996 | Ga0207690_10023745 | |||
| 997 | Ga0207690_10153502 | |||
| 998 | Ga0207690_10250310 | |||
| 999 | Ga0207706_10000656 | |||
| 1000 | Ga0207706_10015955 | |||
| 1001 | Ga0207706_10042484 | |||
| 1002 | Ga0207706_10366683 | |||
| 1003 | Ga0207709_10274710 | |||
| 1004 | Ga0207670_10045495 | |||
| 1005 | Ga0207670_10083558 | |||
| 1006 | Ga0207670_10122370 | |||
| 1007 | Ga0207669_10008892 | |||
| 1008 | Ga0207665_10019553 | |||
| 1009 | Ga0207691_10082314 | |||
| 1010 | Ga0207691_10252435 | |||
| 1011 | Ga0207711_10046396 | |||
| 1012 | Ga0207711_10761785 | |||
| 1013 | Ga0207689_10055035 | |||
| 1014 | Ga0207679_10004813 | |||
| 1015 | Ga0207667_10001299 | |||
| 1016 | Ga0207667_10016517 | |||
| 1017 | Ga0207667_10122592 | |||
| 1018 | Ga0207667_10196747 | |||
| 1019 | Ga0207651_10013358 | |||
| 1020 | Ga0207668_10002313 | |||
| 1021 | Ga0207668_10020705 | |||
| 1022 | Ga0207640_10000313 | |||
| 1023 | Ga0207640_10000713 | |||
| 1024 | Ga0207658_10003941 | |||
| 1025 | Ga0207658_10031933 | |||
| 1026 | Ga0207658_10038570 | |||
| 1027 | Ga0207677_10004906 | |||
| 1028 | Ga0207677_10028286 | |||
| 1029 | Ga0207677_10034188 | |||
| 1030 | Ga0207703_10251262 | |||
| 1031 | Ga0207639_10173684 | |||
| 1032 | Ga0207678_10142217 | |||
| 1033 | Ga0207708_10351668 | |||
| 1034 | Ga0207702_10149867 | |||
| 1035 | Ga0207641_10051040 | |||
| 1036 | Ga0207648_10121618 | |||
| 1037 | Ga0207676_10011408 | |||
| 1038 | Ga0207674_10000091 | |||
| 1039 | Ga0207674_10012340 | |||
| 1040 | Ga0207674_10036136 | |||
| 1041 | Ga0207674_10088243 | |||
| 1042 | Ga0207683_10051991 | |||
| 1043 | Ga0207698_10017795 | |||
| 1044 | Ga0207698_11256621 | |||
| 1045 | Ga0207698_11496840 | |||
| 1046 | Ga0207428_10245193 | |||
| 1047 | Ga0268266_10497727 | |||
| 1048 | Ga0268264_10105113 | |||
| 1049 | Ga0265338_10753051 | |||
| 1050 | Ga0307413_10450048 | |||
| 1051 | Ga0307406_10003526 | |||
| 1052 | Ga0307406_10038443 | |||
| 1053 | Ga0307416_100293873 | |||
| 1054 | Ga0307414_10555634 | |||
| 1055 | Ga0307411_10775547 | |||
| 1056 | Ga0307507_10350648 | |||
| 1057 | Ga0373943_0023573 | |||
| 1058 | Ga0373946_0140307 | |||
| 1059 | Ga0373931_0947090 | |||
| 1060 | Ga0373935_0062892 | |||
| 1061 | Ga0373925_0504939 | |||
| 1062 | Ga0395899_0057282 | |||
| 1063 | Ga0395899_0057761 | |||
| 1064 | Ga0395899_0415327 | |||
| 1065 | Ga0395900_0004220 | |||
| 1066 | Ga0395898_0008857 | |||
| 1067 | Ga0395898_0026299 | |||
| 1068 | Ga0395898_0040683 | |||
| 1069 | Ga0395898_0066638 | |||
| 1070 | Ga0395898_0205699 | |||
| 1071 | Ga0395905_0182111 | |||
| 1072 | Ga0395901_0000667 | |||
| 1073 | Ga0395901_0013437 | |||
| 1074 | Ga0395901_0060007 | |||
| 1075 | Ga0395901_0098124 | |||
| 1076 | Ga0395901_0346162 | |||
| 1077 | Ga0395901_0365120 | |||
| 1078 | Ga0395901_0391962 | |||
| 1079 | Ga0439436_0004115 | |||
| 1080 | Ga0439436_0008877 | |||
| 1081 | Ga0439439_0018752 | |||
| 1082 | Ga0439465_0012328 | |||
| 1083 | Ga0451835_1124474 | |||
| 1084 | Ga0439431_0073660 | |||
| 1085 | Ga0439437_004370 | |||
| 1086 | Ga0439449_0092480 | |||
| 1087 | Ga0439451_012943 | |||
| 1088 | Ga0439452_021211 | |||
| 1089 | Ga0439462_0019562 | |||
| 1090 | Ga0439446_0056598 | |||
| 1091 | Ga0439446_0057602 | |||
| 1092 | Ga0439434_0131618 | |||
| 1093 | Ga0466969_0164579 | |||
| 1094 | Ga0466972_0041093 | |||
| 1095 | Ga0466982_0000007 | |||
| 1096 | Ga0466965_0045915 | |||
| 1097 | Ga0466966_0001249 | |||
| 1098 | Ga0466964_0053229 | |||
| 1099 | Ga0466971_0004245 | |||
| 1100 | Ga0466968_0009931 | |||
| 1101 | Ga0466970_0008624 | |||
| 1102 | Ga0466970_0222300 | |||
| 1103 | Ga0466960_0075668 | |||
| 1104 | Ga0466960_0116669 | |||
| 1105 | Ga0466959_0266607 | |||
| 1106 | Ga0466959_0308850 | |||
| 1107 | Ga0466959_0342454 | |||
| 1108 | Ga0451576_0109456 | |||
| 1109 | Ga0466958_0116383 | |||
| 1110 | Ga0495629_0216372 | |||
| 1111 | Ga0495638_0000082 | |||
| 1112 | Ga0495638_0000104 | |||
| 1113 | Ga0495638_0120739 | |||
| 1114 | Ga0495650_0000443 | |||
| 1115 | Ga0495580_0106896 | |||
| 1116 | Ga0495639_0478601 | |||
| 1117 | Ga0495662_0032056 | |||
| 1118 | Ga0495606_0000113 | |||
| 1119 | Ga0495630_0436132 | |||
| 1120 | Ga0495640_0134264 | |||
| 1121 | Ga0495597_0235949 | |||
| 1122 | Ga0495635_0222450 | |||
| 1123 | Ga0495588_0408263 | |||
| 1124 | Ga0495669_0329134 | |||
| 1125 | Ga0495613_0598927 | |||
| 1126 | Ga0495649_0004395 | |||
| 1127 | Ga0495600_0158582 | |||
| 1128 | Ga0495674_0078351 | |||
| 1129 | Ga0495680_0212743 | |||
| 1130 | Ga0495684_0189897 | |||
| 1131 | Ga0495684_0258470 | |||
| 1132 | Ga0496100_0396396 | |||
| 1133 | Ga0496100_0443469 | |||
| 1134 | Ga0496101_0003479 | |||
| 1135 | Ga0496101_0004032 | |||
| 1136 | Ga0496101_0124570 | |||
| 1137 | Ga0496101_0727372 | |||
| 1138 | Ga0496102_0032832 | |||
| 1139 | Ga0496103_0034644 | |||
| 1140 | Ga0496104_0016434 | |||
| 1141 | Ga0496104_0023548 | |||
| 1142 | Ga0496104_0214829 | |||
| 1143 | Ga0496104_0495223 | |||
| 1144 | Ga0496105_0081850 | |||
| 1145 | Ga0496105_0186334 | |||
| 1146 | Ga0496105_0231105 | |||
| 1147 | Ga0496106_0027368 | |||
| 1148 | Ga0496107_0070330 | |||
| 1149 | Ga0496107_0400004 | |||
| 1150 | Ga0496109_0447213 | |||
| 1151 | Ga0496110_0257191 | |||
| 1152 | Ga0496111_0302581 | |||
| 1153 | Ga0496112_0080727 | |||
| 1154 | Ga0496112_0175257 | |||
| 1155 | Ga0496113_0022495 | |||
| 1156 | Ga0496113_0362845 | |||
| 1157 | Ga0496114_0054979 | |||
| 1158 | Ga0496115_0000670 | |||
| 1159 | Ga0496115_0001663 | |||
| 1160 | Ga0496115_0003761 | |||
| 1161 | Ga0496115_0011255 | |||
| 1162 | Ga0496115_0130818 | |||
| 1163 | Ga0496116_0051651 | |||
| 1164 | Ga0496117_0053334 | |||
| 1165 | Ga0496117_0058859 | |||
| 1166 | Ga0496118_0001339 | |||
| 1167 | Ga0496118_0001517 | |||
| 1168 | Ga0496119_0000926 | |||
| 1169 | Ga0496119_0028238 | |||
| 1170 | Ga0496120_0000054 | |||
| 1171 | Ga0496120_0000154 | |||
| 1172 | Ga0496121_0005127 | |||
| 1173 | Ga0496121_0024345 | |||
| 1174 | Ga0496121_0026560 | |||
| 1175 | Ga0496121_0056632 | |||
| 1176 | Ga0496121_0073080 | |||
| 1177 | Ga0496126_0000411 | |||
| 1178 | Ga0496126_0159477 | |||
| 1179 | Ga0495678_210303 | |||
| 1180 | Ga0501031_0507305 | |||
| 1181 | Ga0501031_0739901 | |||
| 1182 | Ga0501033_0125704 | |||
| 1183 | Ga0501033_0664458 | |||
| 1184 | Ga0501034_0053598 | |||
| 1185 | Ga0501036_0513914 | |||
| 1186 | Ga0501037_0085496 | |||
| 1187 | Ga0501038_0150946 | |||
| 1188 | Ga0501043_0052664 | |||
| 1189 | Ga0501043_0070994 | |||
| 1190 | Ga0501046_0331324 | |||
| 1191 | Ga0501047_0006972 | |||
| 1192 | Ga0501047_0045443 | |||
| 1193 | Ga0501047_0470674 | |||
| 1194 | Ga0501048_0011435 | |||
| 1195 | Ga0501067_0289461 | |||
| 1196 | Ga0501070_0290608 | |||
| 1197 | Ga0501035_0033227 | |||
| 1198 | Ga0501035_0686464 | |||
| 1199 | Ga0501044_0082470 | |||
| 1200 | Ga0501044_0425105 | |||
| 1201 | nmdc:mga05p37_21905_c1 | |||
| 1202 | nmdc:mga09592_23157_c1 | |||
| 1203 | nmdc:mga0qj67_47783_c1 | |||
| 1204 | nmdc:mga06r32_1112778_c1 | |||
| 1205 | nmdc:mga06r32_450971_c1 | |||
| 1206 | nmdc:mga06r32_60891_c1 | |||
| 1207 | nmdc:mga08y16_214276_c1 | |||
| 1208 | nmdc:mga08y16_23115_c2 | |||
| 1209 | nmdc:mga08y16_452034_c1 | |||
| 1210 | nmdc:mga08y16_806754_c1 | |||
| 1211 | nmdc:mga0n895_299_c1 | |||
| 1212 | nmdc:mga0n895_831465_c1 | |||
| 1213 | nmdc:mga0rr50_627859_c1 | |||
| 1214 | nmdc:mga08x19_34941_c1 | |||
| 1215 | Ga0495601_0408152 | |||
| 1216 | Ga0466962_0001663 | |||
| 1217 | Ga0466962_0055718 | |||
| 1218 | 2538834265 | |||
| 1219 | 2643895621 | |||
| 1220 | 2644477802 | |||
| 1221 | 2687582045 | |||
| 1222 | 2884411630 | |||
| 1223 | 2895397399 | |||
| 1224 | 2928965079 | |||
| 1225 | 2939614970 | |||
| 1226 | 2941490852 | |||
| 1227 | 2995950268 | |||
| 1228 | 8003015072 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4lza-assembly1.cif.gz_B | crystal structure of adenine phosphoribosyltransferase from thermoanaerobacter pseudethanolicus atcc 33223, nysgrc target 029700. | 0.9778 | 2 | 171 |
| 4lza-assembly1.cif.gz_A | crystal structure of adenine phosphoribosyltransferase from thermoanaerobacter pseudethanolicus atcc 33223, nysgrc target 029700. | 0.9771 | 2 | 171 |
| 6fd6-assembly1.cif.gz_B | crystal structure of human aprt-tyr105phe variant in complex with adenine, prpp and mg2+, 30 days post crystallization (with amp and ppi products fully generated) | 0.9747 | 2 | 171 |
| 6fci-assembly1.cif.gz_A | crystal structure of human aprt wild type in complex with adenine, prpp and mg2+ | 0.9721 | 2 | 171 |
| 4lza-assembly1.cif.gz_B | crystal structure of adenine phosphoribosyltransferase from thermoanaerobacter pseudethanolicus atcc 33223, nysgrc target 029700. | 0.9666 | 2 | 171 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P69503_1_183_3.40.50.2020 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9715 | 2 | 171 | 3.40.50.2020 |
| af_P12426_6_182_3.40.50.2020 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9671 | 2 | 171 | 3.40.50.2020 |
| af_P91455_5_184_3.40.50.2020 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9646 | 2 | 171 | 3.40.50.2020 |
| af_A0A0P0WCD3_31_176_3.40.50.2020 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9611 | 2 | 135 | 3.40.50.2020 |
| af_P69503_1_183_3.40.50.2020 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9605 | 2 | 171 | 3.40.50.2020 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V5NXW0-F1-model_v4 | Adenine phosphoribosyltransferase (EC 2.4.2.7) | 0.9955 | 18 | 171 |
GO:0002055
GO:0003999 GO:0005737 GO:0006166 GO:0006168 GO:0016208 GO:0044209 |
| AF-A0A2V5XUF2-F1-model_v4 | Adenine phosphoribosyltransferase (EC 2.4.2.7) | 0.9925 | 18 | 171 |
GO:0002055
GO:0003999 GO:0005737 GO:0006166 GO:0006168 GO:0016208 GO:0044209 |
| AF-A0A3N9N2P7-F1-model_v4 | Adenine phosphoribosyltransferase (APRT) (EC 2.4.2.7) | 0.9894 | 2 | 171 |
GO:0002055
GO:0003999 GO:0005737 GO:0006166 GO:0006168 GO:0016208 GO:0044209 |
| AF-A0A2V6D3R0-F1-model_v4 | adenine phosphoribosyltransferase (EC 2.4.2.7) | 0.9893 | 63 | 171 |
GO:0002055
GO:0003999 GO:0005737 GO:0006166 GO:0006168 GO:0016208 GO:0044209 |
| AF-A0A2V5NXW0-F1-model_v4 | Adenine phosphoribosyltransferase (EC 2.4.2.7) | 0.9891 | 18 | 171 |
GO:0002055
GO:0003999 GO:0005737 GO:0006166 GO:0006168 GO:0016208 GO:0044209 |