F469331

General Info

Members Datasets Scaffolds Average Seq Length
614 345 1228 176

Family's Representative Sequence

Representative Sequence 3300005328|Ga0070676_10000093|Ga0070676_1000009322
Length 210
Sequence LAIECLRRRGSKSLELSAKITGVDVLEQVASVAPMNSAIMDRLRAGVRDVPDFPKTGIVFKDITPLLSDHVLFRASIDLFLERCRGKEIDKIVGIDARGFLFGSAVAYELGVGFVPIRKRGKLPYKTEIAKYSLEYGQAEMEMHIDAMIEGERVILVDDLLATGGTSAAAARLIRKVGGRLLEAQFLIELEFLNGRKQLDPTPVISFLRY

Samples

Sample ID Description Type Environment
1 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
9 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
10 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
11 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
12 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
13 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
14 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
15 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
16 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
17 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
18 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
19 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
20 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
21 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
22 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
23 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
24 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
25 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
26 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
27 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
28 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
29 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
30 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
31 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
32 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
33 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
34 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
35 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
36 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
37 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
38 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
39 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
40 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
41 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
42 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
43 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
44 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
45 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
46 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
47 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
48 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
49 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
50 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
51 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
52 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
53 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
54 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
55 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
56 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
57 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
58 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
59 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
60 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
61 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
62 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
63 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
64 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
65 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
66 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
67 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
68 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
69 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
70 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
71 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
72 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
73 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
74 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
75 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
76 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
77 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
78 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
79 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
80 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
81 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
82 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
83 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
84 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
85 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
86 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
87 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
88 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
89 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
90 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
91 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
92 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
93 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
94 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
95 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
97 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
98 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
99 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
100 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
101 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
102 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
103 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
104 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
106 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
108 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
109 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
110 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
111 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
112 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
113 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
114 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
115 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
116 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
117 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
118 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
119 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
120 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
121 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
122 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
123 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
124 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
125 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
126 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
127 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
128 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
129 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
130 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
131 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
132 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
133 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
134 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
135 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
136 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
137 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
138 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
139 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
140 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
145 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
146 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
148 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
149 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
150 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
152 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
153 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
154 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
155 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
157 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
158 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
159 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
160 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
162 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
163 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
164 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
166 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
225 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
228 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
229 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
230 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
231 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
232 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
233 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
234 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
235 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
236 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
237 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
238 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
239 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
240 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
241 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
242 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
243 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
244 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
245 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
246 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
247 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
248 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
249 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
250 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
251 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
252 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
253 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
254 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
255 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
256 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
257 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
258 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
259 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
260 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
261 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
262 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
263 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
264 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
265 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
266 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
267 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
268 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
269 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
270 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
271 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
272 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
273 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
274 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
275 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
276 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
277 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
278 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
279 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
280 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
281 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
282 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
283 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
284 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
285 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
286 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
287 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
288 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
289 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
290 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
291 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
292 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
293 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
294 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
295 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
296 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
297 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
298 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
299 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
300 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
301 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
302 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
303 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
304 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
305 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
306 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
307 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
308 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
309 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
310 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
311 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
312 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
313 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
315 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
318 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
321 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
322 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
323 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
324 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
325 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
326 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
327 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
328 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
329 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
330 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
331 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
332 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
333 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
334 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
335 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
336 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
337 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
338 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
339 2884411467 Dyella sp. AD56 Isolate Rhizosphere
340 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
341 2928963466 Dyella japonica 1073 Isolate Unclassified
342 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
343 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
344 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
345 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.56
Metatranscriptomes 0.65
Isolates 1.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.8
Nodule 0
Rhizoplane 5.05
Rhizosphere 72.31
Stem 0
Stem Tuber 0
Unclassified 8.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_10000093 3300005328 Bacteria 31006
2 JGI24746J21847_1004473 3300001977 Bacteria 2203
3 JGI24739J22299_10026837 3300001989 Bacteria 2018
4 JGI24737J22298_10003313 3300001990 Bacteria 5705
5 JGI24737J22298_10040539 3300001990 Bacteria 1429
6 JGI24735J21928_10001795 3300002067 Bacteria 7529
7 JGI24735J21928_10031010 3300002067 Bacteria 1586
8 JGI25162J39368_1001103 3300002737 Bacteria 16377
9 JGI25162J39368_1001211 3300002737 Bacteria 15019
10 JGI25162J39368_1001631 3300002737 Bacteria 11183
11 JGI25157J39369_1000343 3300002741 Bacteria 32869
12 JGI25157J39369_1000788 3300002741 Bacteria 16190
13 JGI25163J39215_1000482 3300002771 Bacteria 12006
14 JGI25164J39214_1000093 3300002772 Bacteria 89262
15 JGI25164J39214_1000581 3300002772 Bacteria 16386
16 JGI25164J39214_1000806 3300002772 Bacteria 11175
17 JGI25151J46595_10067881 3300003187 Bacteria 1097
18 JGI25165J46597_1000283 3300003214 Bacteria 64612
19 JGI25165J46597_1001571 3300003214 Bacteria 11183
20 JGI25165J46597_1002330 3300003214 Bacteria 6410
21 JGI25165J46597_1018480 3300003214 Bacteria 923
22 rootH1_10063477 3300003316 Bacteria 2016
23 rootH1_10099417 3300003316 Bacteria 2525
24 rootH2_10066056 3300003320 Bacteria 1175
25 Ga0006562J51391_1006439 3300003578 Bacteria 12519
26 Ga0006562J51391_1006443 3300003578 Bacteria 7179
27 Ga0055538_1000681 3300003751 Bacteria 10496
28 Ga0055533_1000324 3300003756 Bacteria 21682
29 Ga0055535_1000070 3300003761 Bacteria 114467
30 Ga0055535_1000152 3300003761 Bacteria 73843
31 Ga0055542_1000232 3300003762 Bacteria 64691
32 Ga0055542_1000606 3300003762 Bacteria 30638
33 Ga0055529_1000024 3300003763 Bacteria 305218
34 Ga0055529_1000082 3300003763 Bacteria 146912
35 Ga0055526_1000072 3300003771 Bacteria 94464
36 Ga0055537_1000665 3300003773 Bacteria 18074
37 Ga0055524_1000173 3300003775 Bacteria 73388
38 Ga0055524_1008199 3300003775 Bacteria 4360
39 Ga0055524_1035474 3300003775 Bacteria 1359
40 Ga0055536_1007458 3300003781 Bacteria 4890
41 Ga0055536_1024684 3300003781 Bacteria 1734
42 Ga0055536_1038454 3300003781 Bacteria 1159
43 Ga0055534_1000628 3300003784 Bacteria 18074
44 Ga0055528_1000085 3300003790 Bacteria 73426
45 Ga0055530_10001219 3300003791 Bacteria 19751
46 Ga0055531_10016729 3300003794 Bacteria 3144
47 Ga0055531_10020584 3300003794 Bacteria 2602
48 Ga0055531_10023824 3300003794 Bacteria 2280
49 Ga0055531_10040003 3300003794 Bacteria 1382
50 Ga0055531_10046742 3300003794 Bacteria 1186
51 Ga0065165_1003415 3300005262 Bacteria 11194
52 Ga0065712_10076093 3300005290 Bacteria 3734
53 Ga0065715_10009293 3300005293 Bacteria 2748
54 Ga0065707_10249815 3300005295 Unclassified 1127
55 Ga0070676_10010043 3300005328 Bacteria 5126
56 Ga0070683_100295045 3300005329 Bacteria 1542
57 Ga0070690_100103127 3300005330 Bacteria 1894
58 Ga0070690_100397064 3300005330 Bacteria 1012
59 Ga0070670_100013984 3300005331 Bacteria 6882
60 Ga0070670_100203882 3300005331 Bacteria 1719
61 Ga0070677_10094162 3300005333 Bacteria 1308
62 Ga0068869_100044088 3300005334 Bacteria 3207
63 Ga0070666_10016070 3300005335 Bacteria 4783
64 Ga0070666_10107195 3300005335 Bacteria 1930
65 Ga0070680_100201892 3300005336 Bacteria 1677
66 Ga0068868_100001212 3300005338 Bacteria 17721
67 Ga0068868_100007275 3300005338 Bacteria 7875
68 Ga0068868_100057822 3300005338 Bacteria 3064
69 Ga0070660_100452928 3300005339 Unclassified 1065
70 Ga0070660_100876273 3300005339 Bacteria 756
71 Ga0070689_100037307 3300005340 Bacteria 3716
72 Ga0070689_100068454 3300005340 Unclassified 2769
73 Ga0070689_100204613 3300005340 Bacteria 1613
74 Ga0070689_100215220 3300005340 Bacteria 1574
75 Ga0070689_100497724 3300005340 Unclassified 1044
76 Ga0070687_100002785 3300005343 Bacteria 6648
77 Ga0070661_100021256 3300005344 Bacteria 4632
78 Ga0070692_10060585 3300005345 Bacteria 1992
79 Ga0070668_100003497 3300005347 Bacteria 11582
80 Ga0070668_100116736 3300005347 Bacteria 2129
81 Ga0070669_100032261 3300005353 Unclassified 3784
82 Ga0070669_100056895 3300005353 Bacteria 2868
83 Ga0070675_100000332 3300005354 Bacteria 32006
84 Ga0070675_100006328 3300005354 Bacteria 9090
85 Ga0070675_100025742 3300005354 Unclassified 4717
86 Ga0070675_100619917 3300005354 Unclassified 982
87 Ga0070671_100022499 3300005355 Bacteria 5147
88 Ga0070671_100099489 3300005355 Bacteria 2439
89 Ga0070671_100346250 3300005355 Unclassified 1268
90 Ga0070674_100002544 3300005356 Bacteria 10098
91 Ga0070673_100010708 3300005364 Bacteria 6219
92 Ga0070673_100121911 3300005364 Bacteria 2176
93 Ga0070688_100136862 3300005365 Unclassified 1659
94 Ga0070688_100195450 3300005365 Unclassified 1412
95 Ga0070688_100502506 3300005365 Unclassified 915
96 Ga0070659_100404808 3300005366 Bacteria 1152
97 Ga0070667_100007165 3300005367 Bacteria 9265
98 Ga0070667_100014461 3300005367 Bacteria 6519
99 Ga0070667_100071761 3300005367 Bacteria 2949
100 Ga0070667_100560026 3300005367 Bacteria 1051
101 Ga0070709_10421432 3300005434 Bacteria 1000
102 Ga0070714_100000830 3300005435 Bacteria 21852
103 Ga0070714_100006315 3300005435 Bacteria 9136
104 Ga0070714_100037494 3300005435 Bacteria 4074
105 Ga0070713_100163514 3300005436 Bacteria 1988
106 Ga0070710_10034613 3300005437 Bacteria 2749
107 Ga0070710_10200647 3300005437 Bacteria 1259
108 Ga0070711_100127693 3300005439 Bacteria 1889
109 Ga0070711_100657823 3300005439 Bacteria 879
110 Ga0070705_100006957 3300005440 Bacteria 5558
111 Ga0070705_100019996 3300005440 Bacteria 3534
112 Ga0070700_100410990 3300005441 Bacteria 1020
113 Ga0070708_100222382 3300005445 Unclassified 1771
114 Ga0070708_100246564 3300005445 Bacteria 1678
115 Ga0070663_100044187 3300005455 Bacteria 3139
116 Ga0070663_100069301 3300005455 Bacteria 2562
117 Ga0070678_100359898 3300005456 Unclassified 1253
118 Ga0070662_100000824 3300005457 Bacteria 19096
119 Ga0070662_100014903 3300005457 Bacteria 5199
120 Ga0070662_100434603 3300005457 Bacteria 1087
121 Ga0070681_10105653 3300005458 Bacteria 2758
122 Ga0070681_10304779 3300005458 Bacteria 1502
123 Ga0068867_100068167 3300005459 Unclassified 2655
124 Ga0068867_100468723 3300005459 Bacteria 1077
125 Ga0070685_10097155 3300005466 Bacteria 1793
126 Ga0070706_100052568 3300005467 Bacteria 3759
127 Ga0070706_100085994 3300005467 Bacteria 2914
128 Ga0070699_100448502 3300005518 Bacteria 1170
129 Ga0070699_101155325 3300005518 Bacteria 710
130 Ga0070679_100138912 3300005530 Bacteria 2410
131 Ga0070697_100025251 3300005536 Unclassified 4738
132 Ga0070697_100504701 3300005536 Bacteria 1058
133 Ga0068853_100062807 3300005539 Bacteria 3215
134 Ga0070672_100005502 3300005543 Bacteria 8399
135 Ga0070672_100142681 3300005543 Unclassified 1977
136 Ga0070686_100028279 3300005544 Bacteria 3399
137 Ga0070695_100056623 3300005545 Bacteria 2531
138 Ga0070696_100021450 3300005546 Bacteria 4379
139 Ga0070696_100030481 3300005546 Bacteria 3692
140 Ga0070693_100084291 3300005547 Bacteria 1902
141 Ga0070693_100097970 3300005547 Bacteria 1781
142 Ga0070704_100024248 3300005549 Bacteria 3978
143 Ga0070704_100081303 3300005549 Unclassified 2386
144 Ga0070704_100564480 3300005549 Bacteria 996
145 Ga0068855_100014993 3300005563 Bacteria 9334
146 Ga0068855_100088838 3300005563 Bacteria 3569
147 Ga0068855_100193450 3300005563 Bacteria 2293
148 Ga0068855_100870963 3300005563 Bacteria 953
149 Ga0068855_101109784 3300005563 Bacteria 826
150 Ga0070664_100043756 3300005564 Bacteria 3779
151 Ga0068857_100010936 3300005577 Bacteria 7899
152 Ga0068857_100322385 3300005577 Bacteria 1427
153 Ga0068857_101050013 3300005577 Unclassified 785
154 Ga0068854_100000327 3300005578 Bacteria 31304
155 Ga0068854_100216595 3300005578 Bacteria 1513
156 Ga0068856_100070794 3300005614 Bacteria 3451
157 Ga0068856_100081014 3300005614 Bacteria 3220
158 Ga0070702_100073848 3300005615 Bacteria 2022
159 Ga0068852_100064660 3300005616 Bacteria 3190
160 Ga0068852_100262164 3300005616 Bacteria 1660
161 Ga0068852_100392282 3300005616 Bacteria 1364
162 Ga0068859_100123820 3300005617 Bacteria 2653
163 Ga0068859_100276533 3300005617 Bacteria 1772
164 Ga0068864_100023613 3300005618 Bacteria 5165
165 Ga0068858_100066703 3300005842 Bacteria 3332
166 Ga0068858_100540127 3300005842 Bacteria 1128
167 Ga0068860_100001706 3300005843 Bacteria 23469
168 Ga0068860_100153619 3300005843 Bacteria 2218
169 Ga0081455_10004812 3300005937 Bacteria 14998
170 Ga0081455_10022598 3300005937 Bacteria 5874
171 Ga0081455_10351787 3300005937 Unclassified 1039
172 Ga0070717_10188266 3300006028 Bacteria 1802
173 Ga0070717_10271485 3300006028 Bacteria 1502
174 Ga0070715_10029224 3300006163 Bacteria 2218
175 Ga0070716_100013517 3300006173 Unclassified 4161
176 Ga0070712_100194146 3300006175 Bacteria 1591
177 Ga0097621_100080613 3300006237 Bacteria 2708
178 Ga0075428_100173940 3300006844 Bacteria 2333
179 Ga0075428_101176585 3300006844 Bacteria 809
180 Ga0075430_100003406 3300006846 Bacteria 13282
181 Ga0075431_100029917 3300006847 Bacteria 5608
182 Ga0075431_100449498 3300006847 Bacteria 1284
183 Ga0075434_100068274 3300006871 Bacteria 3541
184 Ga0075429_100076679 3300006880 Bacteria 2912
185 Ga0068865_100094184 3300006881 Bacteria 2179
186 Ga0097620_100123819 3300006931 Bacteria 2653
187 Ga0097620_100276535 3300006931 Bacteria 1772
188 Ga0105240_10001947 3300009093 Bacteria 34195
189 Ga0105240_10002550 3300009093 Bacteria 29197
190 Ga0105240_10064493 3300009093 Bacteria 4551
191 Ga0111539_10083053 3300009094 Bacteria 3767
192 Ga0111539_10093864 3300009094 Bacteria 3525
193 Ga0111539_10221165 3300009094 Bacteria 2205
194 Ga0111539_11056919 3300009094 Unclassified 944
195 Ga0105245_10037440 3300009098 Bacteria 4313
196 Ga0105245_10057793 3300009098 Bacteria 3490
197 Ga0114129_10013834 3300009147 Bacteria 11498
198 Ga0105243_10237328 3300009148 Bacteria 1621
199 Ga0105241_10418124 3300009174 Bacteria 1179
200 Ga0105242_10025442 3300009176 Bacteria 4685
201 Ga0105242_10226462 3300009176 Bacteria 1673
202 Ga0105242_10334196 3300009176 Unclassified 1394
203 Ga0105242_10633597 3300009176 Bacteria 1037
204 Ga0105248_10329294 3300009177 Unclassified 1720
205 Ga0105248_11429120 3300009177 Bacteria 783
206 Ga0105248_11979558 3300009177 Bacteria 662
207 Ga0105237_10000145 3300009545 Bacteria 99941
208 Ga0105237_10296831 3300009545 Bacteria 1619
209 Ga0105238_10092290 3300009551 Bacteria 3016
210 Ga0105238_11853297 3300009551 Bacteria 636
211 Ga0105249_10001374 3300009553 Bacteria 21282
212 Ga0105239_10000174 3300010375 Bacteria 92922
213 Ga0105239_10002323 3300010375 Bacteria 24270
214 Ga0157345_1027577 3300012498 Bacteria 618
215 Ga0157314_1001349 3300012500 Bacteria 1774
216 Ga0157347_1004001 3300012502 Bacteria 1349
217 Ga0157373_10116633 3300013100 Bacteria 1877
218 Ga0157373_10313648 3300013100 Bacteria 1115
219 Ga0157373_10340412 3300013100 Bacteria 1069
220 Ga0157373_10392074 3300013100 Bacteria 994
221 Ga0157373_10609047 3300013100 Bacteria 795
222 Ga0157373_10879373 3300013100 Bacteria 664
223 Ga0157371_10011460 3300013102 Bacteria 6826
224 Ga0157371_10349557 3300013102 Bacteria 1076
225 Ga0157370_10047184 3300013104 Bacteria 4129
226 Ga0157369_10095426 3300013105 Bacteria 3173
227 Ga0157369_10208387 3300013105 Bacteria 2050
228 Ga0157374_10010001 3300013296 Bacteria 8143
229 Ga0157374_10321596 3300013296 Bacteria 1533
230 Ga0157378_10020756 3300013297 Bacteria 5776
231 Ga0157378_10124306 3300013297 Bacteria 2382
232 Ga0163162_10001824 3300013306 Bacteria 20033
233 Ga0163162_10009523 3300013306 Bacteria 9448
234 Ga0163162_10088338 3300013306 Bacteria 3179
235 Ga0163162_10091145 3300013306 Bacteria 3131
236 Ga0163162_10287424 3300013306 Bacteria 1776
237 Ga0157372_10099392 3300013307 Bacteria 3319
238 Ga0157372_10459074 3300013307 Bacteria 1485
239 Ga0157372_10472697 3300013307 Bacteria 1461
240 Ga0157372_10530387 3300013307 Bacteria 1372
241 Ga0157372_11670041 3300013307 Bacteria 733
242 Ga0157375_10005856 3300013308 Bacteria 10698
243 Ga0157375_10102170 3300013308 Unclassified 2951
244 Ga0163163_10056085 3300014325 Bacteria 3894
245 Ga0182008_10013425 3300014497 Bacteria 4308
246 Ga0182008_10045457 3300014497 Bacteria 2183
247 Ga0182008_10200788 3300014497 Bacteria 1015
248 Ga0157377_10076823 3300014745 Bacteria 1943
249 Ga0157377_10707249 3300014745 Unclassified 732
250 Ga0157376_10016825 3300014969 Bacteria 5562
251 Ga0182006_1153021 3300015261 Bacteria 781
252 Ga0182007_10013113 3300015262 Bacteria 3175
253 Ga0182007_10049892 3300015262 Bacteria 1382
254 Ga0182007_10056263 3300015262 Bacteria 1292
255 Ga0182007_10116689 3300015262 Bacteria 891
256 Ga0183369_1003 3300015685 Bacteria 726443
257 Ga0183368_1002 3300015687 Bacteria 1865598
258 Ga0163161_10012495 3300017792 Bacteria 5895
259 Ga0163161_10118828 3300017792 Unclassified 1984
260 Ga0197907_10754485 3300020069 Bacteria 754
261 Ga0206353_10701236 3300020082 Bacteria 630
262 Ga0209435_100965 3300025206 Bacteria 4202
263 Ga0209760_100330 3300025207 Bacteria 14198
264 Ga0209784_100011 3300025224 Bacteria 546770
265 Ga0209566_102792 3300025225 Bacteria 2998
266 Ga0209674_100061 3300025226 Bacteria 280844
267 Ga0209674_100858 3300025226 Bacteria 9997
268 Ga0209672_106339 3300025228 Bacteria 1932
269 Ga0207427_100026 3300025231 Bacteria 412764
270 Ga0207427_100147 3300025231 Bacteria 80584
271 Ga0207427_100205 3300025231 Bacteria 53817
272 Ga0207427_101454 3300025231 Bacteria 8542
273 Ga0207427_106956 3300025231 Bacteria 1373
274 Ga0209437_100005 3300025233 Bacteria 1071596
275 Ga0209437_100241 3300025233 Bacteria 89459
276 Ga0209437_100340 3300025233 Bacteria 56228
277 Ga0209437_100349 3300025233 Bacteria 53817
278 Ga0209437_116347 3300025233 Bacteria 997
279 Ga0209258_100027 3300025242 Bacteria 518449
280 Ga0209258_102071 3300025242 Bacteria 5683
281 Ga0207425_1025235 3300025245 Bacteria 1228
282 Ga0209646_1005902 3300025246 Bacteria 2098
283 Ga0209646_1027153 3300025246 Bacteria 790
284 Ga0209026_1000017 3300025250 Bacteria 385214
285 Ga0209026_1000018 3300025250 Bacteria 381351
286 Ga0209026_1003512 3300025250 Bacteria 5097
287 Ga0209148_1000001 3300025254 Bacteria 2545271
288 Ga0209148_1000002 3300025254 Bacteria 2399500
289 Ga0209759_1001248 3300025256 Bacteria 15421
290 Ga0209759_1004487 3300025256 Bacteria 5191
291 Ga0209129_1001119 3300025258 Bacteria 15581
292 Ga0209233_1000002 3300025261 Bacteria 2501366
293 Ga0209233_1000011 3300025261 Bacteria 1071611
294 Ga0209233_1000315 3300025261 Bacteria 53817
295 Ga0209565_1000001 3300025263 Bacteria 2950419
296 Ga0209565_1015866 3300025263 Bacteria 1687
297 Ga0209455_1000019 3300025272 Bacteria 705658
298 Ga0209673_1000001 3300025273 Bacteria 3176258
299 Ga0209673_1004055 3300025273 Bacteria 8097
300 Ga0209130_1007366 3300025284 Bacteria 3405
301 Ga0207673_1000941 3300025290 Bacteria 3136
302 Ga0209675_1000001 3300025291 Bacteria 2950293
303 Ga0209675_1006701 3300025291 Bacteria 4565
304 Ga0209675_1045195 3300025291 Bacteria 938
305 Ga0209676_1000875 3300025292 Bacteria 38585
306 Ga0209676_1001240 3300025292 Bacteria 26876
307 Ga0209676_1010760 3300025292 Bacteria 3768
308 Ga0209676_1013959 3300025292 Bacteria 3055
309 Ga0209676_1017043 3300025292 Bacteria 2589
310 Ga0209025_1000564 3300025294 Bacteria 67936
311 Ga0209025_1003024 3300025294 Bacteria 16604
312 Ga0209025_1040121 3300025294 Bacteria 2030
313 Ga0209025_1119105 3300025294 Bacteria 792
314 Ga0209564_1000001 3300025295 Bacteria 3176258
315 Ga0209564_1029549 3300025295 Bacteria 1722
316 Ga0209564_1042483 3300025295 Bacteria 1205
317 Ga0209758_1000647 3300025297 Bacteria 52818
318 Ga0209758_1023925 3300025297 Bacteria 2742
319 Ga0209050_1009346 3300025298 Bacteria 5034
320 Ga0209050_1015414 3300025298 Bacteria 3212
321 Ga0209256_1000006 3300025299 Bacteria 1250310
322 Ga0209256_1002134 3300025299 Bacteria 17096
323 Ga0209256_1007997 3300025299 Bacteria 5027
324 Ga0209256_1028829 3300025299 Bacteria 1558
325 Ga0209051_1045090 3300025303 Bacteria 1529
326 Ga0209257_1000343 3300025304 Bacteria 96876
327 Ga0209257_1000738 3300025304 Bacteria 49567
328 Ga0209257_1011641 3300025304 Bacteria 4200
329 Ga0209257_1012654 3300025304 Bacteria 3867
330 Ga0209257_1047071 3300025304 Bacteria 1242
331 Ga0207697_10000159 3300025315 Bacteria 33779
332 Ga0207697_10002051 3300025315 Bacteria 10609
333 Ga0207682_10052540 3300025893 Bacteria 1689
334 Ga0207692_10026706 3300025898 Bacteria 2711
335 Ga0207692_10029280 3300025898 Bacteria 2615
336 Ga0207642_10018374 3300025899 Unclassified 2682
337 Ga0207688_10003223 3300025901 Bacteria 8909
338 Ga0207680_10014740 3300025903 Bacteria 4058
339 Ga0207680_10136531 3300025903 Bacteria 1622
340 Ga0207647_10005088 3300025904 Bacteria 9697
341 Ga0207647_10008525 3300025904 Bacteria 7342
342 Ga0207647_10042160 3300025904 Bacteria 2865
343 Ga0207685_10032203 3300025905 Unclassified 1885
344 Ga0207699_10033234 3300025906 Unclassified 2914
345 Ga0207645_10000188 3300025907 Bacteria 49705
346 Ga0207645_10005345 3300025907 Bacteria 9336
347 Ga0207705_10038194 3300025909 Bacteria 3437
348 Ga0207684_10000595 3300025910 Bacteria 43323
349 Ga0207707_10172548 3300025912 Bacteria 1889
350 Ga0207707_10245796 3300025912 Bacteria 1555
351 Ga0207695_10001062 3300025913 Bacteria 48136
352 Ga0207695_10001671 3300025913 Bacteria 35725
353 Ga0207695_10020536 3300025913 Bacteria 7561
354 Ga0207671_10000028 3300025914 Bacteria 263092
355 Ga0207671_10142296 3300025914 Bacteria 1849
356 Ga0207693_10572869 3300025915 Unclassified 880
357 Ga0207663_10026116 3300025916 Bacteria 3386
358 Ga0207663_10311179 3300025916 Bacteria 1180
359 Ga0207662_10052776 3300025918 Bacteria 2420
360 Ga0207657_10014776 3300025919 Bacteria 7602
361 Ga0207657_10079639 3300025919 Bacteria 2756
362 Ga0207657_10176916 3300025919 Unclassified 1726
363 Ga0207649_10120725 3300025920 Unclassified 1766
364 Ga0207646_10495730 3300025922 Bacteria 1101
365 Ga0207681_10000346 3300025923 Bacteria 33215
366 Ga0207681_10045775 3300025923 Bacteria 2940
367 Ga0207694_10049824 3300025924 Bacteria 3242
368 Ga0207650_10006763 3300025925 Bacteria 7819
369 Ga0207659_10001566 3300025926 Bacteria 13571
370 Ga0207659_10659957 3300025926 Unclassified 894
371 Ga0207687_10575687 3300025927 Unclassified 947
372 Ga0207700_10102883 3300025928 Bacteria 2282
373 Ga0207700_10113021 3300025928 Bacteria 2189
374 Ga0207700_10122183 3300025928 Bacteria 2113
375 Ga0207664_10000132 3300025929 Bacteria 64236
376 Ga0207664_10000170 3300025929 Bacteria 51533
377 Ga0207664_10125400 3300025929 Bacteria 2155
378 Ga0207664_10300410 3300025929 Bacteria 1412
379 Ga0207644_10012665 3300025931 Bacteria 5605
380 Ga0207644_10033242 3300025931 Unclassified 3602
381 Ga0207690_10000534 3300025932 Bacteria 24783
382 Ga0207690_10023745 3300025932 Bacteria 3831
383 Ga0207690_10153502 3300025932 Bacteria 1709
384 Ga0207690_10250310 3300025932 Bacteria 1368
385 Ga0207706_10000656 3300025933 Bacteria 36548
386 Ga0207706_10015955 3300025933 Bacteria 6788
387 Ga0207706_10042484 3300025933 Bacteria 4029
388 Ga0207706_10366683 3300025933 Bacteria 1251
389 Ga0207709_10274710 3300025935 Bacteria 1242
390 Ga0207670_10045495 3300025936 Unclassified 2910
391 Ga0207670_10083558 3300025936 Bacteria 2240
392 Ga0207670_10122370 3300025936 Bacteria 1894
393 Ga0207669_10008892 3300025937 Unclassified 4744
394 Ga0207665_10019553 3300025939 Bacteria 4453
395 Ga0207691_10082314 3300025940 Bacteria 2891
396 Ga0207691_10252435 3300025940 Unclassified 1522
397 Ga0207711_10046396 3300025941 Bacteria 3712
398 Ga0207711_10761785 3300025941 Bacteria 902
399 Ga0207689_10055035 3300025942 Bacteria 3275
400 Ga0207679_10004813 3300025945 Bacteria 8413
401 Ga0207667_10001299 3300025949 Bacteria 31318
402 Ga0207667_10016517 3300025949 Bacteria 8337
403 Ga0207667_10122592 3300025949 Bacteria 2678
404 Ga0207667_10196747 3300025949 Bacteria 2068
405 Ga0207651_10013358 3300025960 Bacteria 4698
406 Ga0207668_10002313 3300025972 Bacteria 11120
407 Ga0207668_10020705 3300025972 Bacteria 4185
408 Ga0207640_10000313 3300025981 Bacteria 32457
409 Ga0207640_10000713 3300025981 Bacteria 19283
410 Ga0207658_10003941 3300025986 Bacteria 10429
411 Ga0207658_10031933 3300025986 Bacteria 3743
412 Ga0207658_10038570 3300025986 Bacteria 3442
413 Ga0207677_10004906 3300026023 Bacteria 7221
414 Ga0207677_10028286 3300026023 Bacteria 3542
415 Ga0207677_10034188 3300026023 Bacteria 3289
416 Ga0207703_10251262 3300026035 Bacteria 1594
417 Ga0207639_10173684 3300026041 Bacteria 1827
418 Ga0207678_10142217 3300026067 Bacteria 2048
419 Ga0207708_10351668 3300026075 Bacteria 1209
420 Ga0207702_10149867 3300026078 Bacteria 2120
421 Ga0207641_10051040 3300026088 Bacteria 3502
422 Ga0207648_10121618 3300026089 Bacteria 2296
423 Ga0207676_10011408 3300026095 Bacteria 6351
424 Ga0207674_10000091 3300026116 Bacteria 99785
425 Ga0207674_10012340 3300026116 Bacteria 9551
426 Ga0207674_10036136 3300026116 Bacteria 5151
427 Ga0207674_10088243 3300026116 Bacteria 3095
428 Ga0207683_10051991 3300026121 Bacteria 3590
429 Ga0207698_10017795 3300026142 Bacteria 4830
430 Ga0207698_11256621 3300026142 Unclassified 755
431 Ga0207698_11496840 3300026142 Bacteria 690
432 Ga0207428_10245193 3300027907 Bacteria 1337
433 Ga0268266_10497727 3300028379 Bacteria 1163
434 Ga0268264_10105113 3300028381 Bacteria 2462
435 Ga0265338_10753051 3300028800 Bacteria 670
436 Ga0307413_10450048 3300031824 Bacteria 1022
437 Ga0307406_10003526 3300031901 Bacteria 8524
438 Ga0307406_10038443 3300031901 Bacteria 2962
439 Ga0307416_100293873 3300032002 Bacteria 1610
440 Ga0307414_10555634 3300032004 Bacteria 1024
441 Ga0307411_10775547 3300032005 Bacteria 842
442 Ga0307507_10350648 3300033179 Bacteria 868
443 Ga0373943_0023573 3300035170 Unclassified 2863
444 Ga0373946_0140307 3300035171 Unclassified 1120
445 Ga0373931_0947090 3300035691 Bacteria 581
446 Ga0373935_0062892 3300035692 Unclassified 2378
447 Ga0373925_0504939 3300037068 Bacteria 993
448 Ga0395899_0057282 3300037312 Bacteria 2877
449 Ga0395899_0057761 3300037312 Bacteria 2863
450 Ga0395899_0415327 3300037312 Bacteria 887
451 Ga0395900_0004220 3300037418 Bacteria 15251
452 Ga0395898_0008857 3300037466 Bacteria 10605
453 Ga0395898_0026299 3300037466 Bacteria 5858
454 Ga0395898_0040683 3300037466 Bacteria 4595
455 Ga0395898_0066638 3300037466 Bacteria 3487
456 Ga0395898_0205699 3300037466 Bacteria 1878
457 Ga0395905_0182111 3300037471 Bacteria 1973
458 Ga0395901_0000667 3300038443 Bacteria 39465
459 Ga0395901_0013437 3300038443 Bacteria 8322
460 Ga0395901_0060007 3300038443 Bacteria 3957
461 Ga0395901_0098124 3300038443 Bacteria 3072
462 Ga0395901_0346162 3300038443 Bacteria 1534
463 Ga0395901_0365120 3300038443 Bacteria 1488
464 Ga0395901_0391962 3300038443 Bacteria 1428
465 Ga0439436_0004115 3300041404 Bacteria 4456
466 Ga0439436_0008877 3300041404 Bacteria 3084
467 Ga0439439_0018752 3300041406 Bacteria 1712
468 Ga0439465_0012328 3300041413 Bacteria 2675
469 Ga0451835_1124474 3300041492 Bacteria 688
470 Ga0439431_0073660 3300041997 Bacteria 913
471 Ga0439437_004370 3300042000 Bacteria 1540
472 Ga0439449_0092480 3300042007 Bacteria 1117
473 Ga0439451_012943 3300042009 Unclassified 1686
474 Ga0439452_021211 3300042010 Bacteria 1696
475 Ga0439462_0019562 3300042015 Bacteria 1763
476 Ga0439446_0056598 3300042156 Bacteria 1179
477 Ga0439446_0057602 3300042156 Bacteria 1170
478 Ga0439434_0131618 3300042435 Bacteria 821
479 Ga0466969_0164579 3300044656 Bacteria 1018
480 Ga0466972_0041093 3300044658 Bacteria 2251
481 Ga0466982_0000007 3300044672 Bacteria 250854
482 Ga0466965_0045915 3300044683 Bacteria 2161
483 Ga0466966_0001249 3300044684 Bacteria 16281
484 Ga0466964_0053229 3300044706 Bacteria 1665
485 Ga0466971_0004245 3300044719 Bacteria 6178
486 Ga0466968_0009931 3300044735 Bacteria 3675
487 Ga0466970_0008624 3300044765 Bacteria 5135
488 Ga0466970_0222300 3300044765 Bacteria 1054
489 Ga0466960_0075668 3300044901 Bacteria 1685
490 Ga0466960_0116669 3300044901 Bacteria 1393
491 Ga0466959_0266607 3300045049 Bacteria 1178
492 Ga0466959_0308850 3300045049 Bacteria 1082
493 Ga0466959_0342454 3300045049 Bacteria 1020
494 Ga0451576_0109456 3300045051 Bacteria 2875
495 Ga0466958_0116383 3300045836 Bacteria 1671
496 Ga0495629_0216372 3300046459 Bacteria 1322
497 Ga0495638_0000082 3300046460 Bacteria 153986
498 Ga0495638_0000104 3300046460 Bacteria 135059
499 Ga0495638_0120739 3300046460 Bacteria 1549
500 Ga0495650_0000443 3300046471 Bacteria 66631
501 Ga0495580_0106896 3300046472 Bacteria 1944
502 Ga0495639_0478601 3300046475 Bacteria 634
503 Ga0495662_0032056 3300046476 Unclassified 2539
504 Ga0495606_0000113 3300046507 Bacteria 136805
505 Ga0495630_0436132 3300046517 Unclassified 1004
506 Ga0495640_0134264 3300046533 Bacteria 1600
507 Ga0495597_0235949 3300046542 Bacteria 722
508 Ga0495635_0222450 3300046663 Bacteria 1277
509 Ga0495588_0408263 3300046674 Bacteria 713
510 Ga0495669_0329134 3300046684 Unclassified 738
511 Ga0495613_0598927 3300046689 Bacteria 734
512 Ga0495649_0004395 3300046694 Bacteria 9218
513 Ga0495600_0158582 3300046809 Bacteria 1463
514 Ga0495674_0078351 3300047319 Bacteria 2839
515 Ga0495680_0212743 3300047322 Bacteria 1383
516 Ga0495684_0189897 3300047471 Bacteria 1519
517 Ga0495684_0258470 3300047471 Bacteria 1264
518 Ga0496100_0396396 3300048903 Bacteria 1050
519 Ga0496100_0443469 3300048903 Bacteria 994
520 Ga0496101_0003479 3300048904 Bacteria 9820
521 Ga0496101_0004032 3300048904 Bacteria 9184
522 Ga0496101_0124570 3300048904 Bacteria 1952
523 Ga0496101_0727372 3300048904 Bacteria 783
524 Ga0496102_0032832 3300048905 Unclassified 4664
525 Ga0496103_0034644 3300048906 Unclassified 3088
526 Ga0496104_0016434 3300048907 Bacteria 6722
527 Ga0496104_0023548 3300048907 Bacteria 5662
528 Ga0496104_0214829 3300048907 Bacteria 1835
529 Ga0496104_0495223 3300048907 Bacteria 1133
530 Ga0496105_0081850 3300048908 Bacteria 2666
531 Ga0496105_0186334 3300048908 Bacteria 1698
532 Ga0496105_0231105 3300048908 Unclassified 1503
533 Ga0496106_0027368 3300048909 Bacteria 4246
534 Ga0496107_0070330 3300048910 Bacteria 2540
535 Ga0496107_0400004 3300048910 Bacteria 1021
536 Ga0496109_0447213 3300048912 Bacteria 1221
537 Ga0496110_0257191 3300048913 Bacteria 1589
538 Ga0496111_0302581 3300048914 Bacteria 1185
539 Ga0496112_0080727 3300048915 Unclassified 3216
540 Ga0496112_0175257 3300048915 Bacteria 2110
541 Ga0496113_0022495 3300048916 Bacteria 4460
542 Ga0496113_0362845 3300048916 Unclassified 1162
543 Ga0496114_0054979 3300048917 Bacteria 3319
544 Ga0496115_0000670 3300048918 Bacteria 25300
545 Ga0496115_0001663 3300048918 Bacteria 15992
546 Ga0496115_0003761 3300048918 Bacteria 10906
547 Ga0496115_0011255 3300048918 Bacteria 6704
548 Ga0496115_0130818 3300048918 Bacteria 2068
549 Ga0496116_0051651 3300048919 Bacteria 2729
550 Ga0496117_0053334 3300048920 Bacteria 2842
551 Ga0496117_0058859 3300048920 Bacteria 2658
552 Ga0496118_0001339 3300048921 Bacteria 37382
553 Ga0496118_0001517 3300048921 Bacteria 34567
554 Ga0496119_0000926 3300048922 Bacteria 37977
555 Ga0496119_0028238 3300048922 Bacteria 3833
556 Ga0496120_0000054 3300048923 Bacteria 181170
557 Ga0496120_0000154 3300048923 Bacteria 114615
558 Ga0496121_0005127 3300048924 Bacteria 17063
559 Ga0496121_0024345 3300048924 Bacteria 5793
560 Ga0496121_0026560 3300048924 Bacteria 5449
561 Ga0496121_0056632 3300048924 Bacteria 3254
562 Ga0496121_0073080 3300048924 Bacteria 2750
563 Ga0496126_0000411 3300048929 Bacteria 86952
564 Ga0496126_0159477 3300048929 Bacteria 1928
565 Ga0495678_210303 3300049459 Bacteria 595
566 Ga0501031_0507305 3300049568 Bacteria 778
567 Ga0501031_0739901 3300049568 Bacteria 631
568 Ga0501033_0125704 3300049570 Bacteria 1859
569 Ga0501033_0664458 3300049570 Bacteria 711
570 Ga0501034_0053598 3300049571 Bacteria 4061
571 Ga0501036_0513914 3300049572 Bacteria 996
572 Ga0501037_0085496 3300049573 Bacteria 2284
573 Ga0501038_0150946 3300049574 Bacteria 1894
574 Ga0501043_0052664 3300049579 Bacteria 3196
575 Ga0501043_0070994 3300049579 Bacteria 2735
576 Ga0501046_0331324 3300049580 Bacteria 1108
577 Ga0501047_0006972 3300049581 Bacteria 10609
578 Ga0501047_0045443 3300049581 Bacteria 4247
579 Ga0501047_0470674 3300049581 Bacteria 1085
580 Ga0501048_0011435 3300049582 Bacteria 6622
581 Ga0501067_0289461 3300049583 Bacteria 912
582 Ga0501070_0290608 3300049586 Bacteria 1332
583 Ga0501035_0033227 3300049822 Bacteria 4691
584 Ga0501035_0686464 3300049822 Bacteria 827
585 Ga0501044_0082470 3300049823 Bacteria 3253
586 Ga0501044_0425105 3300049823 Bacteria 1238
587 nmdc:mga05p37_21905_c1 3300050507 Bacteria 7742
588 nmdc:mga09592_23157_c1 3300050508 Bacteria 5128
589 nmdc:mga0qj67_47783_c1 3300050509 Bacteria 3381
590 nmdc:mga06r32_1112778_c1 3300050510 Bacteria 739
591 nmdc:mga06r32_450971_c1 3300050510 Bacteria 1266
592 nmdc:mga06r32_60891_c1 3300050510 Bacteria 3633
593 nmdc:mga08y16_214276_c1 3300050511 Bacteria 1994
594 nmdc:mga08y16_23115_c2 3300050511 Bacteria 3771
595 nmdc:mga08y16_452034_c1 3300050511 Bacteria 1310
596 nmdc:mga08y16_806754_c1 3300050511 Unclassified 931
597 nmdc:mga0n895_299_c1 3300050512 Bacteria 32714
598 nmdc:mga0n895_831465_c1 3300050512 Bacteria 912
599 nmdc:mga0rr50_627859_c1 3300050513 Bacteria 916
600 nmdc:mga08x19_34941_c1 3300050514 Bacteria 3179
601 Ga0495601_0408152 3300053077 Bacteria 880
602 Ga0466962_0001663 3300061719 Bacteria 10427
603 Ga0466962_0055718 3300061719 Bacteria 1889
604 2538834265 2537561836 Bacteria 3910579
605 2643895621 2643221577 Bacteria 3710843
606 2644477802 2643221685 Bacteria 3673288
607 2687582045 2687453130 Bacteria 4227172
608 2884411630 2884411467 Bacteria 5246714
609 2895397399 2895395659 Bacteria 3983269
610 2928965079 2928963466 Bacteria 5165703
611 2939614970 2939611941 Bacteria 3892017
612 2941490852 2941489479 Bacteria 6313767
613 2995950268 2995948881 Bacteria 6358104
614 8003015072 8003014200 Bacteria 4059994
615 Ga0070676_10000093
616 JGI24746J21847_1004473
617 JGI24739J22299_10026837
618 JGI24737J22298_10003313
619 JGI24737J22298_10040539
620 JGI24735J21928_10001795
621 JGI24735J21928_10031010
622 JGI25162J39368_1001103
623 JGI25162J39368_1001211
624 JGI25162J39368_1001631
625 JGI25157J39369_1000343
626 JGI25157J39369_1000788
627 JGI25163J39215_1000482
628 JGI25164J39214_1000093
629 JGI25164J39214_1000581
630 JGI25164J39214_1000806
631 JGI25151J46595_10067881
632 JGI25165J46597_1000283
633 JGI25165J46597_1001571
634 JGI25165J46597_1002330
635 JGI25165J46597_1018480
636 rootH1_10063477
637 rootH1_10099417
638 rootH2_10066056
639 Ga0006562J51391_1006439
640 Ga0006562J51391_1006443
641 Ga0055538_1000681
642 Ga0055533_1000324
643 Ga0055535_1000070
644 Ga0055535_1000152
645 Ga0055542_1000232
646 Ga0055542_1000606
647 Ga0055529_1000024
648 Ga0055529_1000082
649 Ga0055526_1000072
650 Ga0055537_1000665
651 Ga0055524_1000173
652 Ga0055524_1008199
653 Ga0055524_1035474
654 Ga0055536_1007458
655 Ga0055536_1024684
656 Ga0055536_1038454
657 Ga0055534_1000628
658 Ga0055528_1000085
659 Ga0055530_10001219
660 Ga0055531_10016729
661 Ga0055531_10020584
662 Ga0055531_10023824
663 Ga0055531_10040003
664 Ga0055531_10046742
665 Ga0065165_1003415
666 Ga0065712_10076093
667 Ga0065715_10009293
668 Ga0065707_10249815
669 Ga0070676_10010043
670 Ga0070683_100295045
671 Ga0070690_100103127
672 Ga0070690_100397064
673 Ga0070670_100013984
674 Ga0070670_100203882
675 Ga0070677_10094162
676 Ga0068869_100044088
677 Ga0070666_10016070
678 Ga0070666_10107195
679 Ga0070680_100201892
680 Ga0068868_100001212
681 Ga0068868_100007275
682 Ga0068868_100057822
683 Ga0070660_100452928
684 Ga0070660_100876273
685 Ga0070689_100037307
686 Ga0070689_100068454
687 Ga0070689_100204613
688 Ga0070689_100215220
689 Ga0070689_100497724
690 Ga0070687_100002785
691 Ga0070661_100021256
692 Ga0070692_10060585
693 Ga0070668_100003497
694 Ga0070668_100116736
695 Ga0070669_100032261
696 Ga0070669_100056895
697 Ga0070675_100000332
698 Ga0070675_100006328
699 Ga0070675_100025742
700 Ga0070675_100619917
701 Ga0070671_100022499
702 Ga0070671_100099489
703 Ga0070671_100346250
704 Ga0070674_100002544
705 Ga0070673_100010708
706 Ga0070673_100121911
707 Ga0070688_100136862
708 Ga0070688_100195450
709 Ga0070688_100502506
710 Ga0070659_100404808
711 Ga0070667_100007165
712 Ga0070667_100014461
713 Ga0070667_100071761
714 Ga0070667_100560026
715 Ga0070709_10421432
716 Ga0070714_100000830
717 Ga0070714_100006315
718 Ga0070714_100037494
719 Ga0070713_100163514
720 Ga0070710_10034613
721 Ga0070710_10200647
722 Ga0070711_100127693
723 Ga0070711_100657823
724 Ga0070705_100006957
725 Ga0070705_100019996
726 Ga0070700_100410990
727 Ga0070708_100222382
728 Ga0070708_100246564
729 Ga0070663_100044187
730 Ga0070663_100069301
731 Ga0070678_100359898
732 Ga0070662_100000824
733 Ga0070662_100014903
734 Ga0070662_100434603
735 Ga0070681_10105653
736 Ga0070681_10304779
737 Ga0068867_100068167
738 Ga0068867_100468723
739 Ga0070685_10097155
740 Ga0070706_100052568
741 Ga0070706_100085994
742 Ga0070699_100448502
743 Ga0070699_101155325
744 Ga0070679_100138912
745 Ga0070697_100025251
746 Ga0070697_100504701
747 Ga0068853_100062807
748 Ga0070672_100005502
749 Ga0070672_100142681
750 Ga0070686_100028279
751 Ga0070695_100056623
752 Ga0070696_100021450
753 Ga0070696_100030481
754 Ga0070693_100084291
755 Ga0070693_100097970
756 Ga0070704_100024248
757 Ga0070704_100081303
758 Ga0070704_100564480
759 Ga0068855_100014993
760 Ga0068855_100088838
761 Ga0068855_100193450
762 Ga0068855_100870963
763 Ga0068855_101109784
764 Ga0070664_100043756
765 Ga0068857_100010936
766 Ga0068857_100322385
767 Ga0068857_101050013
768 Ga0068854_100000327
769 Ga0068854_100216595
770 Ga0068856_100070794
771 Ga0068856_100081014
772 Ga0070702_100073848
773 Ga0068852_100064660
774 Ga0068852_100262164
775 Ga0068852_100392282
776 Ga0068859_100123820
777 Ga0068859_100276533
778 Ga0068864_100023613
779 Ga0068858_100066703
780 Ga0068858_100540127
781 Ga0068860_100001706
782 Ga0068860_100153619
783 Ga0081455_10004812
784 Ga0081455_10022598
785 Ga0081455_10351787
786 Ga0070717_10188266
787 Ga0070717_10271485
788 Ga0070715_10029224
789 Ga0070716_100013517
790 Ga0070712_100194146
791 Ga0097621_100080613
792 Ga0075428_100173940
793 Ga0075428_101176585
794 Ga0075430_100003406
795 Ga0075431_100029917
796 Ga0075431_100449498
797 Ga0075434_100068274
798 Ga0075429_100076679
799 Ga0068865_100094184
800 Ga0097620_100123819
801 Ga0097620_100276535
802 Ga0105240_10001947
803 Ga0105240_10002550
804 Ga0105240_10064493
805 Ga0111539_10083053
806 Ga0111539_10093864
807 Ga0111539_10221165
808 Ga0111539_11056919
809 Ga0105245_10037440
810 Ga0105245_10057793
811 Ga0114129_10013834
812 Ga0105243_10237328
813 Ga0105241_10418124
814 Ga0105242_10025442
815 Ga0105242_10226462
816 Ga0105242_10334196
817 Ga0105242_10633597
818 Ga0105248_10329294
819 Ga0105248_11429120
820 Ga0105248_11979558
821 Ga0105237_10000145
822 Ga0105237_10296831
823 Ga0105238_10092290
824 Ga0105238_11853297
825 Ga0105249_10001374
826 Ga0105239_10000174
827 Ga0105239_10002323
828 Ga0157345_1027577
829 Ga0157314_1001349
830 Ga0157347_1004001
831 Ga0157373_10116633
832 Ga0157373_10313648
833 Ga0157373_10340412
834 Ga0157373_10392074
835 Ga0157373_10609047
836 Ga0157373_10879373
837 Ga0157371_10011460
838 Ga0157371_10349557
839 Ga0157370_10047184
840 Ga0157369_10095426
841 Ga0157369_10208387
842 Ga0157374_10010001
843 Ga0157374_10321596
844 Ga0157378_10020756
845 Ga0157378_10124306
846 Ga0163162_10001824
847 Ga0163162_10009523
848 Ga0163162_10088338
849 Ga0163162_10091145
850 Ga0163162_10287424
851 Ga0157372_10099392
852 Ga0157372_10459074
853 Ga0157372_10472697
854 Ga0157372_10530387
855 Ga0157372_11670041
856 Ga0157375_10005856
857 Ga0157375_10102170
858 Ga0163163_10056085
859 Ga0182008_10013425
860 Ga0182008_10045457
861 Ga0182008_10200788
862 Ga0157377_10076823
863 Ga0157377_10707249
864 Ga0157376_10016825
865 Ga0182006_1153021
866 Ga0182007_10013113
867 Ga0182007_10049892
868 Ga0182007_10056263
869 Ga0182007_10116689
870 Ga0183369_1003
871 Ga0183368_1002
872 Ga0163161_10012495
873 Ga0163161_10118828
874 Ga0197907_10754485
875 Ga0206353_10701236
876 Ga0209435_100965
877 Ga0209760_100330
878 Ga0209784_100011
879 Ga0209566_102792
880 Ga0209674_100061
881 Ga0209674_100858
882 Ga0209672_106339
883 Ga0207427_100026
884 Ga0207427_100147
885 Ga0207427_100205
886 Ga0207427_101454
887 Ga0207427_106956
888 Ga0209437_100005
889 Ga0209437_100241
890 Ga0209437_100340
891 Ga0209437_100349
892 Ga0209437_116347
893 Ga0209258_100027
894 Ga0209258_102071
895 Ga0207425_1025235
896 Ga0209646_1005902
897 Ga0209646_1027153
898 Ga0209026_1000017
899 Ga0209026_1000018
900 Ga0209026_1003512
901 Ga0209148_1000001
902 Ga0209148_1000002
903 Ga0209759_1001248
904 Ga0209759_1004487
905 Ga0209129_1001119
906 Ga0209233_1000002
907 Ga0209233_1000011
908 Ga0209233_1000315
909 Ga0209565_1000001
910 Ga0209565_1015866
911 Ga0209455_1000019
912 Ga0209673_1000001
913 Ga0209673_1004055
914 Ga0209130_1007366
915 Ga0207673_1000941
916 Ga0209675_1000001
917 Ga0209675_1006701
918 Ga0209675_1045195
919 Ga0209676_1000875
920 Ga0209676_1001240
921 Ga0209676_1010760
922 Ga0209676_1013959
923 Ga0209676_1017043
924 Ga0209025_1000564
925 Ga0209025_1003024
926 Ga0209025_1040121
927 Ga0209025_1119105
928 Ga0209564_1000001
929 Ga0209564_1029549
930 Ga0209564_1042483
931 Ga0209758_1000647
932 Ga0209758_1023925
933 Ga0209050_1009346
934 Ga0209050_1015414
935 Ga0209256_1000006
936 Ga0209256_1002134
937 Ga0209256_1007997
938 Ga0209256_1028829
939 Ga0209051_1045090
940 Ga0209257_1000343
941 Ga0209257_1000738
942 Ga0209257_1011641
943 Ga0209257_1012654
944 Ga0209257_1047071
945 Ga0207697_10000159
946 Ga0207697_10002051
947 Ga0207682_10052540
948 Ga0207692_10026706
949 Ga0207692_10029280
950 Ga0207642_10018374
951 Ga0207688_10003223
952 Ga0207680_10014740
953 Ga0207680_10136531
954 Ga0207647_10005088
955 Ga0207647_10008525
956 Ga0207647_10042160
957 Ga0207685_10032203
958 Ga0207699_10033234
959 Ga0207645_10000188
960 Ga0207645_10005345
961 Ga0207705_10038194
962 Ga0207684_10000595
963 Ga0207707_10172548
964 Ga0207707_10245796
965 Ga0207695_10001062
966 Ga0207695_10001671
967 Ga0207695_10020536
968 Ga0207671_10000028
969 Ga0207671_10142296
970 Ga0207693_10572869
971 Ga0207663_10026116
972 Ga0207663_10311179
973 Ga0207662_10052776
974 Ga0207657_10014776
975 Ga0207657_10079639
976 Ga0207657_10176916
977 Ga0207649_10120725
978 Ga0207646_10495730
979 Ga0207681_10000346
980 Ga0207681_10045775
981 Ga0207694_10049824
982 Ga0207650_10006763
983 Ga0207659_10001566
984 Ga0207659_10659957
985 Ga0207687_10575687
986 Ga0207700_10102883
987 Ga0207700_10113021
988 Ga0207700_10122183
989 Ga0207664_10000132
990 Ga0207664_10000170
991 Ga0207664_10125400
992 Ga0207664_10300410
993 Ga0207644_10012665
994 Ga0207644_10033242
995 Ga0207690_10000534
996 Ga0207690_10023745
997 Ga0207690_10153502
998 Ga0207690_10250310
999 Ga0207706_10000656
1000 Ga0207706_10015955
1001 Ga0207706_10042484
1002 Ga0207706_10366683
1003 Ga0207709_10274710
1004 Ga0207670_10045495
1005 Ga0207670_10083558
1006 Ga0207670_10122370
1007 Ga0207669_10008892
1008 Ga0207665_10019553
1009 Ga0207691_10082314
1010 Ga0207691_10252435
1011 Ga0207711_10046396
1012 Ga0207711_10761785
1013 Ga0207689_10055035
1014 Ga0207679_10004813
1015 Ga0207667_10001299
1016 Ga0207667_10016517
1017 Ga0207667_10122592
1018 Ga0207667_10196747
1019 Ga0207651_10013358
1020 Ga0207668_10002313
1021 Ga0207668_10020705
1022 Ga0207640_10000313
1023 Ga0207640_10000713
1024 Ga0207658_10003941
1025 Ga0207658_10031933
1026 Ga0207658_10038570
1027 Ga0207677_10004906
1028 Ga0207677_10028286
1029 Ga0207677_10034188
1030 Ga0207703_10251262
1031 Ga0207639_10173684
1032 Ga0207678_10142217
1033 Ga0207708_10351668
1034 Ga0207702_10149867
1035 Ga0207641_10051040
1036 Ga0207648_10121618
1037 Ga0207676_10011408
1038 Ga0207674_10000091
1039 Ga0207674_10012340
1040 Ga0207674_10036136
1041 Ga0207674_10088243
1042 Ga0207683_10051991
1043 Ga0207698_10017795
1044 Ga0207698_11256621
1045 Ga0207698_11496840
1046 Ga0207428_10245193
1047 Ga0268266_10497727
1048 Ga0268264_10105113
1049 Ga0265338_10753051
1050 Ga0307413_10450048
1051 Ga0307406_10003526
1052 Ga0307406_10038443
1053 Ga0307416_100293873
1054 Ga0307414_10555634
1055 Ga0307411_10775547
1056 Ga0307507_10350648
1057 Ga0373943_0023573
1058 Ga0373946_0140307
1059 Ga0373931_0947090
1060 Ga0373935_0062892
1061 Ga0373925_0504939
1062 Ga0395899_0057282
1063 Ga0395899_0057761
1064 Ga0395899_0415327
1065 Ga0395900_0004220
1066 Ga0395898_0008857
1067 Ga0395898_0026299
1068 Ga0395898_0040683
1069 Ga0395898_0066638
1070 Ga0395898_0205699
1071 Ga0395905_0182111
1072 Ga0395901_0000667
1073 Ga0395901_0013437
1074 Ga0395901_0060007
1075 Ga0395901_0098124
1076 Ga0395901_0346162
1077 Ga0395901_0365120
1078 Ga0395901_0391962
1079 Ga0439436_0004115
1080 Ga0439436_0008877
1081 Ga0439439_0018752
1082 Ga0439465_0012328
1083 Ga0451835_1124474
1084 Ga0439431_0073660
1085 Ga0439437_004370
1086 Ga0439449_0092480
1087 Ga0439451_012943
1088 Ga0439452_021211
1089 Ga0439462_0019562
1090 Ga0439446_0056598
1091 Ga0439446_0057602
1092 Ga0439434_0131618
1093 Ga0466969_0164579
1094 Ga0466972_0041093
1095 Ga0466982_0000007
1096 Ga0466965_0045915
1097 Ga0466966_0001249
1098 Ga0466964_0053229
1099 Ga0466971_0004245
1100 Ga0466968_0009931
1101 Ga0466970_0008624
1102 Ga0466970_0222300
1103 Ga0466960_0075668
1104 Ga0466960_0116669
1105 Ga0466959_0266607
1106 Ga0466959_0308850
1107 Ga0466959_0342454
1108 Ga0451576_0109456
1109 Ga0466958_0116383
1110 Ga0495629_0216372
1111 Ga0495638_0000082
1112 Ga0495638_0000104
1113 Ga0495638_0120739
1114 Ga0495650_0000443
1115 Ga0495580_0106896
1116 Ga0495639_0478601
1117 Ga0495662_0032056
1118 Ga0495606_0000113
1119 Ga0495630_0436132
1120 Ga0495640_0134264
1121 Ga0495597_0235949
1122 Ga0495635_0222450
1123 Ga0495588_0408263
1124 Ga0495669_0329134
1125 Ga0495613_0598927
1126 Ga0495649_0004395
1127 Ga0495600_0158582
1128 Ga0495674_0078351
1129 Ga0495680_0212743
1130 Ga0495684_0189897
1131 Ga0495684_0258470
1132 Ga0496100_0396396
1133 Ga0496100_0443469
1134 Ga0496101_0003479
1135 Ga0496101_0004032
1136 Ga0496101_0124570
1137 Ga0496101_0727372
1138 Ga0496102_0032832
1139 Ga0496103_0034644
1140 Ga0496104_0016434
1141 Ga0496104_0023548
1142 Ga0496104_0214829
1143 Ga0496104_0495223
1144 Ga0496105_0081850
1145 Ga0496105_0186334
1146 Ga0496105_0231105
1147 Ga0496106_0027368
1148 Ga0496107_0070330
1149 Ga0496107_0400004
1150 Ga0496109_0447213
1151 Ga0496110_0257191
1152 Ga0496111_0302581
1153 Ga0496112_0080727
1154 Ga0496112_0175257
1155 Ga0496113_0022495
1156 Ga0496113_0362845
1157 Ga0496114_0054979
1158 Ga0496115_0000670
1159 Ga0496115_0001663
1160 Ga0496115_0003761
1161 Ga0496115_0011255
1162 Ga0496115_0130818
1163 Ga0496116_0051651
1164 Ga0496117_0053334
1165 Ga0496117_0058859
1166 Ga0496118_0001339
1167 Ga0496118_0001517
1168 Ga0496119_0000926
1169 Ga0496119_0028238
1170 Ga0496120_0000054
1171 Ga0496120_0000154
1172 Ga0496121_0005127
1173 Ga0496121_0024345
1174 Ga0496121_0026560
1175 Ga0496121_0056632
1176 Ga0496121_0073080
1177 Ga0496126_0000411
1178 Ga0496126_0159477
1179 Ga0495678_210303
1180 Ga0501031_0507305
1181 Ga0501031_0739901
1182 Ga0501033_0125704
1183 Ga0501033_0664458
1184 Ga0501034_0053598
1185 Ga0501036_0513914
1186 Ga0501037_0085496
1187 Ga0501038_0150946
1188 Ga0501043_0052664
1189 Ga0501043_0070994
1190 Ga0501046_0331324
1191 Ga0501047_0006972
1192 Ga0501047_0045443
1193 Ga0501047_0470674
1194 Ga0501048_0011435
1195 Ga0501067_0289461
1196 Ga0501070_0290608
1197 Ga0501035_0033227
1198 Ga0501035_0686464
1199 Ga0501044_0082470
1200 Ga0501044_0425105
1201 nmdc:mga05p37_21905_c1
1202 nmdc:mga09592_23157_c1
1203 nmdc:mga0qj67_47783_c1
1204 nmdc:mga06r32_1112778_c1
1205 nmdc:mga06r32_450971_c1
1206 nmdc:mga06r32_60891_c1
1207 nmdc:mga08y16_214276_c1
1208 nmdc:mga08y16_23115_c2
1209 nmdc:mga08y16_452034_c1
1210 nmdc:mga08y16_806754_c1
1211 nmdc:mga0n895_299_c1
1212 nmdc:mga0n895_831465_c1
1213 nmdc:mga0rr50_627859_c1
1214 nmdc:mga08x19_34941_c1
1215 Ga0495601_0408152
1216 Ga0466962_0001663
1217 Ga0466962_0055718
1218 2538834265
1219 2643895621
1220 2644477802
1221 2687582045
1222 2884411630
1223 2895397399
1224 2928965079
1225 2939614970
1226 2941490852
1227 2995950268
1228 8003015072

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00156

Pribosyltran

Phosphoribosyl transferase domain

65

201

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lza-assembly1.cif.gz_B crystal structure of adenine phosphoribosyltransferase from thermoanaerobacter pseudethanolicus atcc 33223, nysgrc target 029700. 0.9778 2 171
4lza-assembly1.cif.gz_A crystal structure of adenine phosphoribosyltransferase from thermoanaerobacter pseudethanolicus atcc 33223, nysgrc target 029700. 0.9771 2 171
6fd6-assembly1.cif.gz_B crystal structure of human aprt-tyr105phe variant in complex with adenine, prpp and mg2+, 30 days post crystallization (with amp and ppi products fully generated) 0.9747 2 171
6fci-assembly1.cif.gz_A crystal structure of human aprt wild type in complex with adenine, prpp and mg2+ 0.9721 2 171
4lza-assembly1.cif.gz_B crystal structure of adenine phosphoribosyltransferase from thermoanaerobacter pseudethanolicus atcc 33223, nysgrc target 029700. 0.9666 2 171
ID Description Score Start End Superfamily
af_P69503_1_183_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9715 2 171 3.40.50.2020
af_P12426_6_182_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9671 2 171 3.40.50.2020
af_P91455_5_184_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9646 2 171 3.40.50.2020
af_A0A0P0WCD3_31_176_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9611 2 135 3.40.50.2020
af_P69503_1_183_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9605 2 171 3.40.50.2020
ID Description Score Start End GO Terms
AF-A0A2V5NXW0-F1-model_v4 Adenine phosphoribosyltransferase (EC 2.4.2.7) 0.9955 18 171 GO:0002055
GO:0003999
GO:0005737
GO:0006166
GO:0006168
GO:0016208
GO:0044209
AF-A0A2V5XUF2-F1-model_v4 Adenine phosphoribosyltransferase (EC 2.4.2.7) 0.9925 18 171 GO:0002055
GO:0003999
GO:0005737
GO:0006166
GO:0006168
GO:0016208
GO:0044209
AF-A0A3N9N2P7-F1-model_v4 Adenine phosphoribosyltransferase (APRT) (EC 2.4.2.7) 0.9894 2 171 GO:0002055
GO:0003999
GO:0005737
GO:0006166
GO:0006168
GO:0016208
GO:0044209
AF-A0A2V6D3R0-F1-model_v4 adenine phosphoribosyltransferase (EC 2.4.2.7) 0.9893 63 171 GO:0002055
GO:0003999
GO:0005737
GO:0006166
GO:0006168
GO:0016208
GO:0044209
AF-A0A2V5NXW0-F1-model_v4 Adenine phosphoribosyltransferase (EC 2.4.2.7) 0.9891 18 171 GO:0002055
GO:0003999
GO:0005737
GO:0006166
GO:0006168
GO:0016208
GO:0044209

Map