F469366

General Info

Members Datasets Scaffolds Average Seq Length
614 273 614 316

Family's Representative Sequence

Representative Sequence 3300035120|Ga0373957_0089798|Ga0373957_0089798_32_1174
Length 359
Sequence LIDMAHTKDYYAVLGMPASATQDEIKKQYRKLAAKHHPDKNQNDPKAAERFKEISEAYQVLGDAEKRKQYDQMRQLGAFGGFGAPNTRRGPQPGGAPFGGPGGQSFRFEDLGDVGIGGLGDLFSSMFGGGTGGRARARGPERGQDVETQLTIPFRTAALGGKVPIELEVNEECATCHGSGAAPGAKVQTCPECQGRGTISFGQGGFAVPSEREMRVRKKMMITVPAGVDNGTKIRLKGQGGRGMRSGPPGDLLISFQVEPDRFFKREGLDVIAPVPINIAQATLGSKISVKALNGKRVAIKIPPGTASGKRFRVRGQGIIKDGQTGDLIVQVEVSVPEKLTEEQEKAMREFADASGLKY

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
167 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
170 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
171 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
172 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
173 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
174 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
175 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
176 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
177 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
178 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
179 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
180 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
181 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
182 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
183 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
184 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
185 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
186 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
187 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
188 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
189 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
190 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
191 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
192 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
193 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
194 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
195 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
196 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
197 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
198 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
199 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
200 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
201 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
202 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
203 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
204 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
205 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
206 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
207 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
208 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
209 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
210 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
211 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
212 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
213 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
214 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
215 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
216 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
217 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
218 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
219 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
220 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
221 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
222 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
223 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
224 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
225 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
226 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
227 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
228 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
229 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
230 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
231 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
232 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
233 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
234 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
235 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
236 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
237 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
238 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
239 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
240 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
241 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
242 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
243 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
244 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
245 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
246 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
247 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
248 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
249 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
250 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
251 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
252 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
256 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
257 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
258 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
259 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
260 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
261 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
262 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
263 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
264 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
265 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
266 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
267 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
268 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
269 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
270 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
271 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
272 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
273 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.75
Rhizosphere 96.09
Stem 0
Stem Tuber 0
Unclassified 0.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10028962 3300003203 Bacteria 2102
2 Ga0070658_10002218 3300005327 Bacteria 16306
3 Ga0070658_10015518 3300005327 Bacteria 6092
4 Ga0070658_10022112 3300005327 Bacteria 5102
5 Ga0070676_10005548 3300005328 Bacteria 6715
6 Ga0070676_10062554 3300005328 Bacteria 2215
7 Ga0070676_10067778 3300005328 Unclassified 2134
8 Ga0070683_100000588 3300005329 Bacteria 25968
9 Ga0070683_100007872 3300005329 Bacteria 9028
10 Ga0070683_100010936 3300005329 Bacteria 7816
11 Ga0070683_100014387 3300005329 Bacteria 6921
12 Ga0070683_100050136 3300005329 Bacteria 3863
13 Ga0070683_100112796 3300005329 Bacteria 2565
14 Ga0070683_100123188 3300005329 Bacteria 2450
15 Ga0070683_100123553 3300005329 Bacteria 2446
16 Ga0070683_100297380 3300005329 Bacteria 1535
17 Ga0070690_100172420 3300005330 Unclassified 1490
18 Ga0070670_100002223 3300005331 Bacteria 15938
19 Ga0070670_100006497 3300005331 Bacteria 9897
20 Ga0070670_100014873 3300005331 Bacteria 6674
21 Ga0068869_100007519 3300005334 Bacteria 6970
22 Ga0068869_100014258 3300005334 Bacteria 5306
23 Ga0070666_10090108 3300005335 Bacteria 2106
24 Ga0070680_100000354 3300005336 Bacteria 30834
25 Ga0070680_100000489 3300005336 Bacteria 27191
26 Ga0070680_100023357 3300005336 Bacteria 4931
27 Ga0070680_100026465 3300005336 Bacteria 4639
28 Ga0070680_100040225 3300005336 Bacteria 3785
29 Ga0070682_100000492 3300005337 Bacteria 24800
30 Ga0070682_100008751 3300005337 Bacteria 5712
31 Ga0070682_100009246 3300005337 Bacteria 5574
32 Ga0068868_100019745 3300005338 Bacteria 5053
33 Ga0068868_100143643 3300005338 Unclassified 1961
34 Ga0070660_100009663 3300005339 Bacteria 6794
35 Ga0070660_100061986 3300005339 Unclassified 2904
36 Ga0070660_100107396 3300005339 Bacteria 2218
37 Ga0070660_100140968 3300005339 Bacteria 1934
38 Ga0070689_100000673 3300005340 Bacteria 20688
39 Ga0070691_10039751 3300005341 Bacteria 2222
40 Ga0070691_10051203 3300005341 Unclassified 1971
41 Ga0070661_100001410 3300005344 Bacteria 16773
42 Ga0070661_100008160 3300005344 Bacteria 7224
43 Ga0070661_100015888 3300005344 Bacteria 5311
44 Ga0070661_100077209 3300005344 Bacteria 2455
45 Ga0070661_100118758 3300005344 Bacteria 1979
46 Ga0070692_10011319 3300005345 Bacteria 4091
47 Ga0070668_100031679 3300005347 Bacteria 4023
48 Ga0070668_100040297 3300005347 Bacteria 3574
49 Ga0070669_100005930 3300005353 Bacteria 8816
50 Ga0070675_100003367 3300005354 Bacteria 12113
51 Ga0070675_100014802 3300005354 Bacteria 6155
52 Ga0070675_100027621 3300005354 Bacteria 4561
53 Ga0070675_100064315 3300005354 Bacteria 3033
54 Ga0070671_100016066 3300005355 Bacteria 6050
55 Ga0070671_100059929 3300005355 Bacteria 3168
56 Ga0070674_100023698 3300005356 Bacteria 3976
57 Ga0070674_100122668 3300005356 Bacteria 1926
58 Ga0070673_100089908 3300005364 Bacteria 2507
59 Ga0070673_100166286 3300005364 Bacteria 1880
60 Ga0070688_100005659 3300005365 Bacteria 6598
61 Ga0070688_100006897 3300005365 Bacteria 6097
62 Ga0070659_100013575 3300005366 Bacteria 6066
63 Ga0070659_100023675 3300005366 Bacteria 4702
64 Ga0070659_100025729 3300005366 Bacteria 4524
65 Ga0070659_100044397 3300005366 Unclassified 3479
66 Ga0070667_100004756 3300005367 Bacteria 11378
67 Ga0070667_100039826 3300005367 Bacteria 3939
68 Ga0070667_100239965 3300005367 Unclassified 1618
69 Ga0070709_10155229 3300005434 Bacteria 1586
70 Ga0070714_100001803 3300005435 Bacteria 15572
71 Ga0070714_100074240 3300005435 Bacteria 2948
72 Ga0070714_100136821 3300005435 Bacteria 2195
73 Ga0070713_100006043 3300005436 Bacteria 8340
74 Ga0070713_100320689 3300005436 Bacteria 1431
75 Ga0070701_10009405 3300005438 Bacteria 4280
76 Ga0070701_10027253 3300005438 Bacteria 2796
77 Ga0070711_100053749 3300005439 Unclassified 2777
78 Ga0070705_100062161 3300005440 Unclassified 2222
79 Ga0070700_100008003 3300005441 Bacteria 5741
80 Ga0070700_100160313 3300005441 Bacteria 1548
81 Ga0070708_100000006 3300005445 Bacteria 150596
82 Ga0070662_100006003 3300005457 Bacteria 7791
83 Ga0070662_100008714 3300005457 Bacteria 6614
84 Ga0070662_100049520 3300005457 Bacteria 3029
85 Ga0070681_10001775 3300005458 Bacteria 19354
86 Ga0070681_10014467 3300005458 Bacteria 7852
87 Ga0070681_10039263 3300005458 Bacteria 4745
88 Ga0070681_10053692 3300005458 Bacteria 4016
89 Ga0068867_100005743 3300005459 Bacteria 8802
90 Ga0068867_100093316 3300005459 Bacteria 2287
91 Ga0068867_100155653 3300005459 Bacteria 1799
92 Ga0070685_10169594 3300005466 Bacteria 1398
93 Ga0070707_100015781 3300005468 Bacteria 7090
94 Ga0070707_100024874 3300005468 Bacteria 5676
95 Ga0070707_100098210 3300005468 Bacteria 2836
96 Ga0070698_100001204 3300005471 Bacteria 28711
97 Ga0070699_100020370 3300005518 Bacteria 5719
98 Ga0070679_100000377 3300005530 Bacteria 37955
99 Ga0070679_100001349 3300005530 Bacteria 21675
100 Ga0070679_100003405 3300005530 Bacteria 14562
101 Ga0070679_100011509 3300005530 Bacteria 8433
102 Ga0070679_100047091 3300005530 Bacteria 4299
103 Ga0070679_100099574 3300005530 Bacteria 2894
104 Ga0070679_100102321 3300005530 Bacteria 2851
105 Ga0070679_100173789 3300005530 Bacteria 2127
106 Ga0070679_100177388 3300005530 Unclassified 2103
107 Ga0070679_100389496 3300005530 Bacteria 1340
108 Ga0070684_100006657 3300005535 Bacteria 8955
109 Ga0070684_100022016 3300005535 Bacteria 5311
110 Ga0070684_100037766 3300005535 Unclassified 4145
111 Ga0070684_100055243 3300005535 Unclassified 3461
112 Ga0070684_100109119 3300005535 Unclassified 2480
113 Ga0070684_100129102 3300005535 Bacteria 2279
114 Ga0070684_100131382 3300005535 Bacteria 2259
115 Ga0070697_100052219 3300005536 Bacteria 3321
116 Ga0068853_100027500 3300005539 Bacteria 4777
117 Ga0068853_100084207 3300005539 Unclassified 2786
118 Ga0070672_100001468 3300005543 Bacteria 14631
119 Ga0070672_100139336 3300005543 Bacteria 2000
120 Ga0070672_100234117 3300005543 Bacteria 1544
121 Ga0070686_100052044 3300005544 Bacteria 2609
122 Ga0070686_100060968 3300005544 Bacteria 2436
123 Ga0070695_100007270 3300005545 Bacteria 6564
124 Ga0070695_100187528 3300005545 Bacteria 1470
125 Ga0070696_100000840 3300005546 Bacteria 19805
126 Ga0070693_100001820 3300005547 Bacteria 9735
127 Ga0070704_100112891 3300005549 Bacteria 2071
128 Ga0068855_100005805 3300005563 Bacteria 15061
129 Ga0068855_100007038 3300005563 Bacteria 13645
130 Ga0068855_100040846 3300005563 Bacteria 5501
131 Ga0070664_100010981 3300005564 Bacteria 7343
132 Ga0070664_100074485 3300005564 Bacteria 2914
133 Ga0070664_100081297 3300005564 Bacteria 2792
134 Ga0070664_100207803 3300005564 Bacteria 1749
135 Ga0068857_100002342 3300005577 Bacteria 15418
136 Ga0068857_100009827 3300005577 Bacteria 8312
137 Ga0068857_100013425 3300005577 Bacteria 7136
138 Ga0068857_100028111 3300005577 Bacteria 4961
139 Ga0068857_100155119 3300005577 Bacteria 2076
140 Ga0068856_100010080 3300005614 Bacteria 9184
141 Ga0068856_100232264 3300005614 Unclassified 1860
142 Ga0070702_100006540 3300005615 Bacteria 5525
143 Ga0070702_100066811 3300005615 Bacteria 2110
144 Ga0068852_100005268 3300005616 Bacteria 9231
145 Ga0068852_100020184 3300005616 Bacteria 5294
146 Ga0068852_100178355 3300005616 Unclassified 1996
147 Ga0068859_100015924 3300005617 Bacteria 7557
148 Ga0068859_100059864 3300005617 Bacteria 3837
149 Ga0068859_100100097 3300005617 Unclassified 2954
150 Ga0068859_100177602 3300005617 Bacteria 2211
151 Ga0068864_100040252 3300005618 Bacteria 3998
152 Ga0068864_100216015 3300005618 Unclassified 1767
153 Ga0068861_100003887 3300005719 Bacteria 9986
154 Ga0068861_100372789 3300005719 Bacteria 1258
155 Ga0068851_10007015 3300005834 Bacteria 5166
156 Ga0068851_10022841 3300005834 Bacteria 3053
157 Ga0068870_10003341 3300005840 Bacteria 6783
158 Ga0068870_10078785 3300005840 Unclassified 1816
159 Ga0068863_100008812 3300005841 Bacteria 9850
160 Ga0068863_100029541 3300005841 Bacteria 5232
161 Ga0068858_100311697 3300005842 Unclassified 1503
162 Ga0068860_100009628 3300005843 Bacteria 9602
163 Ga0068860_100098780 3300005843 Bacteria 2784
164 Ga0068860_100134683 3300005843 Bacteria 2372
165 Ga0068862_100000800 3300005844 Bacteria 31194
166 Ga0068862_100004451 3300005844 Bacteria 11820
167 Ga0081539_10000807 3300005985 Bacteria 60932
168 Ga0070717_10084592 3300006028 Bacteria 2668
169 Ga0070716_100139807 3300006173 Bacteria 1542
170 Ga0070712_100011778 3300006175 Bacteria 5558
171 Ga0070712_100073409 3300006175 Bacteria 2454
172 Ga0097621_100014901 3300006237 Bacteria 5833
173 Ga0097621_100147925 3300006237 Bacteria 2013
174 Ga0068871_100150589 3300006358 Bacteria 1984
175 Ga0075428_100031278 3300006844 Bacteria 5886
176 Ga0075430_100000259 3300006846 Bacteria 37106
177 Ga0075430_100011415 3300006846 Bacteria 7542
178 Ga0075430_100020317 3300006846 Bacteria 5650
179 Ga0075430_100115482 3300006846 Unclassified 2237
180 Ga0075431_100007854 3300006847 Bacteria 10632
181 Ga0075431_100012683 3300006847 Bacteria 8510
182 Ga0075431_100066919 3300006847 Bacteria 3709
183 Ga0075433_10013426 3300006852 Bacteria 6660
184 Ga0075433_10069541 3300006852 Bacteria 3092
185 Ga0075434_100012135 3300006871 Bacteria 8159
186 Ga0075434_100051238 3300006871 Bacteria 4102
187 Ga0075429_100020869 3300006880 Bacteria 5685
188 Ga0075429_100102583 3300006880 Bacteria 2497
189 Ga0068865_100002221 3300006881 Bacteria 11435
190 Ga0068865_100006993 3300006881 Bacteria 6921
191 Ga0097620_100015924 3300006931 Bacteria 7557
192 Ga0097620_100059864 3300006931 Bacteria 3837
193 Ga0097620_100100094 3300006931 Unclassified 2954
194 Ga0097620_100177603 3300006931 Bacteria 2211
195 Ga0105240_10178962 3300009093 Unclassified 2504
196 Ga0105240_10296239 3300009093 Unclassified 1852
197 Ga0111539_10034308 3300009094 Bacteria 6154
198 Ga0111539_10095429 3300009094 Bacteria 3493
199 Ga0111539_10220190 3300009094 Bacteria 2211
200 Ga0111539_10240307 3300009094 Bacteria 2108
201 Ga0111539_10244997 3300009094 Bacteria 2087
202 Ga0111539_10465776 3300009094 Bacteria 1471
203 Ga0105245_10016180 3300009098 Bacteria 6500
204 Ga0105245_10019525 3300009098 Bacteria 5937
205 Ga0105245_10070600 3300009098 Unclassified 3170
206 Ga0114129_10006750 3300009147 Bacteria 16297
207 Ga0114129_10021186 3300009147 Bacteria 9232
208 Ga0114129_10075335 3300009147 Bacteria 4699
209 Ga0105243_10095997 3300009148 Unclassified 2451
210 Ga0105243_10098932 3300009148 Bacteria 2417
211 Ga0105241_10028241 3300009174 Bacteria 4181
212 Ga0105242_10002665 3300009176 Bacteria 13989
213 Ga0105242_10003515 3300009176 Bacteria 12176
214 Ga0105242_10132940 3300009176 Bacteria 2150
215 Ga0105242_10143293 3300009176 Unclassified 2076
216 Ga0105248_10021390 3300009177 Bacteria 7167
217 Ga0105248_10024300 3300009177 Bacteria 6738
218 Ga0105248_10027659 3300009177 Bacteria 6316
219 Ga0105248_10094795 3300009177 Bacteria 3360
220 Ga0105248_10156800 3300009177 Bacteria 2569
221 Ga0105237_10055922 3300009545 Bacteria 3951
222 Ga0105237_10280336 3300009545 Bacteria 1669
223 Ga0105238_10036819 3300009551 Bacteria 4975
224 Ga0105249_10000131 3300009553 Bacteria 99448
225 Ga0105249_10007249 3300009553 Bacteria 9672
226 Ga0105239_10007696 3300010375 Bacteria 12337
227 Ga0105239_10066794 3300010375 Unclassified 3950
228 Ga0105239_10198360 3300010375 Bacteria 2248
229 Ga0105246_10002055 3300011119 Bacteria 12134
230 Ga0157373_10007545 3300013100 Bacteria 8086
231 Ga0157373_10062445 3300013100 Unclassified 2639
232 Ga0157371_10008559 3300013102 Bacteria 8139
233 Ga0157371_10080852 3300013102 Unclassified 2301
234 Ga0157370_10004041 3300013104 Bacteria 17036
235 Ga0157369_10006735 3300013105 Bacteria 13258
236 Ga0157369_10009491 3300013105 Bacteria 11124
237 Ga0157369_10423626 3300013105 Bacteria 1380
238 Ga0157374_10063722 3300013296 Unclassified 3458
239 Ga0157378_10014701 3300013297 Bacteria 6857
240 Ga0157378_10238440 3300013297 Bacteria 1736
241 Ga0163162_10005364 3300013306 Bacteria 12375
242 Ga0163162_10042337 3300013306 Bacteria 4558
243 Ga0163162_10118948 3300013306 Bacteria 2744
244 Ga0163162_10126037 3300013306 Bacteria 2667
245 Ga0163162_10135773 3300013306 Bacteria 2571
246 Ga0163162_10462887 3300013306 Bacteria 1400
247 Ga0157372_10003116 3300013307 Bacteria 17881
248 Ga0157372_10006551 3300013307 Bacteria 12388
249 Ga0157372_10099810 3300013307 Unclassified 3312
250 Ga0157372_10338733 3300013307 Bacteria 1752
251 Ga0157372_10448677 3300013307 Unclassified 1503
252 Ga0157375_10006108 3300013308 Bacteria 10498
253 Ga0157375_10011285 3300013308 Bacteria 7888
254 Ga0157375_10021245 3300013308 Bacteria 5948
255 Ga0157375_10103854 3300013308 Bacteria 2929
256 Ga0157375_10337410 3300013308 Bacteria 1672
257 Ga0163163_10084033 3300014325 Bacteria 3189
258 Ga0157380_10004528 3300014326 Bacteria 9645
259 Ga0157377_10008970 3300014745 Bacteria 4896
260 Ga0157379_10000965 3300014968 Bacteria 23357
261 Ga0157376_10023306 3300014969 Bacteria 4842
262 Ga0207697_10002065 3300025315 Bacteria 10576
263 Ga0207656_10044004 3300025321 Bacteria 1905
264 Ga0207642_10113519 3300025899 Bacteria 1384
265 Ga0207680_10096221 3300025903 Bacteria 1894
266 Ga0207699_10035209 3300025906 Bacteria 2847
267 Ga0207645_10001564 3300025907 Bacteria 18705
268 Ga0207645_10010773 3300025907 Bacteria 6268
269 Ga0207645_10084523 3300025907 Unclassified 2037
270 Ga0207643_10002102 3300025908 Bacteria 10975
271 Ga0207643_10007907 3300025908 Bacteria 5706
272 Ga0207643_10020933 3300025908 Bacteria 3590
273 Ga0207643_10062594 3300025908 Unclassified 2126
274 Ga0207643_10081472 3300025908 Unclassified 1876
275 Ga0207705_10005895 3300025909 Bacteria 9109
276 Ga0207654_10029751 3300025911 Unclassified 2993
277 Ga0207707_10002464 3300025912 Bacteria 16657
278 Ga0207707_10002809 3300025912 Bacteria 15531
279 Ga0207707_10006733 3300025912 Bacteria 10033
280 Ga0207707_10008243 3300025912 Bacteria 9046
281 Ga0207707_10013189 3300025912 Bacteria 7205
282 Ga0207707_10020108 3300025912 Bacteria 5827
283 Ga0207707_10054644 3300025912 Unclassified 3476
284 Ga0207695_10037328 3300025913 Bacteria 5243
285 Ga0207671_10110096 3300025914 Unclassified 2095
286 Ga0207693_10019977 3300025915 Bacteria 5328
287 Ga0207693_10262703 3300025915 Bacteria 1353
288 Ga0207663_10083442 3300025916 Bacteria 2099
289 Ga0207660_10000027 3300025917 Bacteria 68840
290 Ga0207660_10052342 3300025917 Bacteria 2906
291 Ga0207662_10001820 3300025918 Bacteria 10470
292 Ga0207662_10048640 3300025918 Bacteria 2513
293 Ga0207662_10049712 3300025918 Bacteria 2488
294 Ga0207657_10001987 3300025919 Bacteria 22084
295 Ga0207657_10059375 3300025919 Bacteria 3286
296 Ga0207657_10291048 3300025919 Bacteria 1295
297 Ga0207649_10004071 3300025920 Bacteria 7957
298 Ga0207649_10008386 3300025920 Bacteria 5632
299 Ga0207649_10060588 3300025920 Bacteria 2379
300 Ga0207649_10071271 3300025920 Unclassified 2219
301 Ga0207652_10006228 3300025921 Bacteria 9635
302 Ga0207652_10021261 3300025921 Bacteria 5354
303 Ga0207652_10043947 3300025921 Bacteria 3805
304 Ga0207652_10057977 3300025921 Unclassified 3336
305 Ga0207652_10107395 3300025921 Bacteria 2472
306 Ga0207652_10157487 3300025921 Unclassified 2035
307 Ga0207652_10257756 3300025921 Bacteria 1573
308 Ga0207646_10020564 3300025922 Bacteria 6114
309 Ga0207646_10064178 3300025922 Unclassified 3278
310 Ga0207681_10002224 3300025923 Bacteria 12341
311 Ga0207681_10002478 3300025923 Bacteria 11713
312 Ga0207681_10008973 3300025923 Bacteria 6107
313 Ga0207681_10255181 3300025923 Unclassified 1371
314 Ga0207694_10254674 3300025924 Unclassified 1437
315 Ga0207650_10005419 3300025925 Bacteria 8707
316 Ga0207650_10007569 3300025925 Bacteria 7403
317 Ga0207659_10003670 3300025926 Bacteria 9250
318 Ga0207659_10004848 3300025926 Bacteria 8152
319 Ga0207659_10321075 3300025926 Unclassified 1277
320 Ga0207687_10013206 3300025927 Bacteria 5395
321 Ga0207687_10044874 3300025927 Bacteria 3053
322 Ga0207687_10116289 3300025927 Bacteria 1993
323 Ga0207700_10033091 3300025928 Bacteria 3696
324 Ga0207664_10027237 3300025929 Bacteria 4331
325 Ga0207664_10054702 3300025929 Bacteria 3164
326 Ga0207664_10118955 3300025929 Bacteria 2208
327 Ga0207644_10007827 3300025931 Bacteria 6982
328 Ga0207644_10095893 3300025931 Bacteria 2219
329 Ga0207690_10016616 3300025932 Bacteria 4482
330 Ga0207690_10056537 3300025932 Unclassified 2647
331 Ga0207690_10105294 3300025932 Bacteria 2023
332 Ga0207706_10001172 3300025933 Bacteria 26572
333 Ga0207706_10001727 3300025933 Bacteria 21522
334 Ga0207706_10030971 3300025933 Bacteria 4769
335 Ga0207706_10054081 3300025933 Bacteria 3543
336 Ga0207706_10160860 3300025933 Unclassified 1974
337 Ga0207686_10086885 3300025934 Unclassified 2055
338 Ga0207686_10087241 3300025934 Bacteria 2052
339 Ga0207709_10050412 3300025935 Bacteria 2546
340 Ga0207670_10014841 3300025936 Bacteria 4637
341 Ga0207670_10031206 3300025936 Bacteria 3412
342 Ga0207669_10064686 3300025937 Unclassified 2265
343 Ga0207669_10193613 3300025937 Unclassified 1469
344 Ga0207704_10129567 3300025938 Bacteria 1744
345 Ga0207665_10201970 3300025939 Bacteria 1449
346 Ga0207691_10000638 3300025940 Bacteria 34615
347 Ga0207691_10000761 3300025940 Bacteria 31887
348 Ga0207691_10005766 3300025940 Bacteria 11987
349 Ga0207691_10010422 3300025940 Bacteria 8920
350 Ga0207691_10095316 3300025940 Bacteria 2662
351 Ga0207691_10101075 3300025940 Bacteria 2573
352 Ga0207691_10195316 3300025940 Bacteria 1763
353 Ga0207711_10017100 3300025941 Bacteria 6024
354 Ga0207711_10027868 3300025941 Bacteria 4748
355 Ga0207711_10046092 3300025941 Bacteria 3725
356 Ga0207711_10061730 3300025941 Bacteria 3231
357 Ga0207711_10246015 3300025941 Unclassified 1641
358 Ga0207689_10002056 3300025942 Bacteria 18990
359 Ga0207689_10003790 3300025942 Bacteria 13776
360 Ga0207661_10007529 3300025944 Bacteria 7744
361 Ga0207661_10008476 3300025944 Bacteria 7350
362 Ga0207661_10011257 3300025944 Bacteria 6474
363 Ga0207661_10037718 3300025944 Bacteria 3782
364 Ga0207661_10172498 3300025944 Bacteria 1883
365 Ga0207661_10183135 3300025944 Bacteria 1831
366 Ga0207679_10005509 3300025945 Bacteria 7932
367 Ga0207679_10043833 3300025945 Bacteria 3224
368 Ga0207679_10047652 3300025945 Bacteria 3115
369 Ga0207679_10094610 3300025945 Bacteria 2320
370 Ga0207667_10034783 3300025949 Bacteria 5408
371 Ga0207667_10130531 3300025949 Unclassified 2588
372 Ga0207651_10061880 3300025960 Bacteria 2606
373 Ga0207712_10014017 3300025961 Bacteria 5145
374 Ga0207712_10014341 3300025961 Bacteria 5097
375 Ga0207668_10016237 3300025972 Bacteria 4643
376 Ga0207668_10239798 3300025972 Bacteria 1466
377 Ga0207658_10027985 3300025986 Bacteria 3966
378 Ga0207658_10087090 3300025986 Bacteria 2411
379 Ga0207658_10156360 3300025986 Bacteria 1864
380 Ga0207677_10026811 3300026023 Bacteria 3619
381 Ga0207703_10004720 3300026035 Bacteria 11120
382 Ga0207639_10056943 3300026041 Bacteria 2998
383 Ga0207639_10073917 3300026041 Bacteria 2674
384 Ga0207678_10014153 3300026067 Bacteria 7013
385 Ga0207678_10113869 3300026067 Bacteria 2308
386 Ga0207678_10300489 3300026067 Bacteria 1379
387 Ga0207708_10042376 3300026075 Bacteria 3470
388 Ga0207708_10063356 3300026075 Bacteria 2824
389 Ga0207708_10092301 3300026075 Bacteria 2336
390 Ga0207702_10018881 3300026078 Bacteria 5703
391 Ga0207702_10031714 3300026078 Bacteria 4405
392 Ga0207641_10020169 3300026088 Bacteria 5472
393 Ga0207641_10022683 3300026088 Bacteria 5167
394 Ga0207648_10014800 3300026089 Bacteria 7198
395 Ga0207648_10016629 3300026089 Bacteria 6715
396 Ga0207648_10017643 3300026089 Bacteria 6483
397 Ga0207676_10079245 3300026095 Bacteria 2663
398 Ga0207674_10000208 3300026116 Bacteria 72594
399 Ga0207674_10011064 3300026116 Bacteria 10146
400 Ga0207674_10018952 3300026116 Bacteria 7460
401 Ga0207674_10020881 3300026116 Bacteria 7066
402 Ga0207674_10038096 3300026116 Bacteria 4996
403 Ga0207674_10123235 3300026116 Bacteria 2558
404 Ga0207674_10159922 3300026116 Bacteria 2207
405 Ga0207675_100003791 3300026118 Bacteria 14722
406 Ga0207683_10258525 3300026121 Bacteria 1590
407 Ga0207698_10025723 3300026142 Bacteria 4152
408 Ga0207698_10190767 3300026142 Bacteria 1825
409 Ga0207698_10214030 3300026142 Bacteria 1736
410 Ga0207428_10103782 3300027907 Bacteria 2194
411 Ga0207428_10119856 3300027907 Bacteria 2018
412 Ga0268265_10005142 3300028380 Bacteria 8958
413 Ga0268265_10007327 3300028380 Bacteria 7447
414 Ga0268265_10020036 3300028380 Bacteria 4662
415 Ga0268265_10036233 3300028380 Bacteria 3613
416 Ga0268264_10010283 3300028381 Bacteria 7746
417 Ga0268264_10063710 3300028381 Bacteria 3100
418 Ga0268264_10231499 3300028381 Bacteria 1707
419 Ga0307408_100009869 3300031548 Bacteria 6293
420 Ga0307408_100012846 3300031548 Bacteria 5553
421 Ga0307408_100082073 3300031548 Bacteria 2412
422 Ga0307408_100244337 3300031548 Unclassified 1477
423 Ga0307405_10004685 3300031731 Bacteria 6504
424 Ga0307405_10031029 3300031731 Bacteria 3141
425 Ga0307413_10000384 3300031824 Bacteria 14117
426 Ga0307413_10004902 3300031824 Bacteria 5890
427 Ga0307413_10041492 3300031824 Bacteria 2695
428 Ga0307413_10046201 3300031824 Bacteria 2587
429 Ga0307413_10053408 3300031824 Bacteria 2446
430 Ga0307410_10001224 3300031852 Bacteria 11400
431 Ga0307410_10011172 3300031852 Archaea 5122
432 Ga0307410_10027657 3300031852 Bacteria 3587
433 Ga0307410_10029421 3300031852 Bacteria 3498
434 Ga0307410_10065170 3300031852 Bacteria 2505
435 Ga0307406_10158389 3300031901 Bacteria 1624
436 Ga0307407_10002241 3300031903 Bacteria 7471
437 Ga0307407_10003959 3300031903 Bacteria 6186
438 Ga0307407_10163728 3300031903 Bacteria 1458
439 Ga0307412_10028465 3300031911 Bacteria 3496
440 Ga0307412_10050356 3300031911 Unclassified 2748
441 Ga0307409_100005851 3300031995 Bacteria 7141
442 Ga0307409_100122242 3300031995 Bacteria 2207
443 Ga0307409_100217842 3300031995 Bacteria 1721
444 Ga0307416_100000541 3300032002 Bacteria 19240
445 Ga0307416_100002606 3300032002 Bacteria 10414
446 Ga0307416_100008974 3300032002 Bacteria 6502
447 Ga0307416_100084627 3300032002 Bacteria 2696
448 Ga0307416_100095237 3300032002 Bacteria 2570
449 Ga0307416_100162302 3300032002 Unclassified 2067
450 Ga0307414_10022563 3300032004 Bacteria 3974
451 Ga0307414_10025192 3300032004 Bacteria 3806
452 Ga0307414_10100190 3300032004 Unclassified 2178
453 Ga0307411_10001294 3300032005 Bacteria 10050
454 Ga0307411_10002798 3300032005 Bacteria 7857
455 Ga0307411_10004205 3300032005 Bacteria 6844
456 Ga0307411_10007734 3300032005 Bacteria 5506
457 Ga0307411_10082541 3300032005 Bacteria 2217
458 Ga0307415_100000895 3300032126 Bacteria 13628
459 Ga0307415_100048880 3300032126 Bacteria 2856
460 Ga0307415_100058185 3300032126 Bacteria 2660
461 Ga0307415_100084793 3300032126 Bacteria 2274
462 Ga0373926_0002772 3300035083 Bacteria 5586
463 Ga0373934_0004878 3300035086 Bacteria 4963
464 Ga0373934_0059671 3300035086 Bacteria 1518
465 Ga0373944_0004135 3300035089 Unclassified 3769
466 Ga0373936_0013214 3300035113 Bacteria 3150
467 Ga0373954_0057986 3300035118 Bacteria 1824
468 Ga0373956_0010255 3300035119 Bacteria 3835
469 Ga0373956_0018712 3300035119 Bacteria 2935
470 Ga0373957_0038499 3300035120 Bacteria 1791
471 Ga0373957_0089798 3300035120 Unclassified 1220
472 Ga0373943_0002090 3300035170 Bacteria 9071
473 Ga0373955_0004323 3300035172 Bacteria 6278
474 Ga0373931_0125317 3300035691 Bacteria 1472
475 Ga0373935_0002652 3300035692 Bacteria 10282
476 Ga0373927_0001791 3300035695 Bacteria 16037
477 Ga0373933_0004718 3300035724 Bacteria 7457
478 Ga0373947_0000698 3300035725 Bacteria 20023
479 Ga0373947_0018423 3300035725 Bacteria 4018
480 Ga0373937_0003528 3300036401 Bacteria 13163
481 Ga0373937_0005107 3300036401 Bacteria 11181
482 Ga0373937_0043034 3300036401 Bacteria 4122
483 Ga0373937_0114765 3300036401 Bacteria 2507
484 Ga0373925_0003620 3300037068 Bacteria 11901
485 Ga0373925_0019388 3300037068 Bacteria 4947
486 Ga0373925_0082298 3300037068 Bacteria 2449
487 Ga0395899_0024455 3300037312 Bacteria 4566
488 Ga0395905_0005015 3300037471 Bacteria 13637
489 Ga0395901_0004304 3300038443 Bacteria 14362
490 Ga0436365_1313802 3300039437 Bacteria 1762
491 Ga0439439_0002484 3300041406 Bacteria 3927
492 Ga0439446_0025411 3300042156 Unclassified 1693
493 Ga0439434_0006631 3300042435 Bacteria 3386
494 Ga0451577_0000001 3300042876 Bacteria 2461803
495 Ga0466966_0031762 3300044684 Bacteria 3424
496 Ga0466959_0171968 3300045049 Bacteria 1519
497 Ga0451576_0042270 3300045051 Bacteria 4812
498 Ga0451576_0211027 3300045051 Unclassified 2028
499 Ga0466967_0083237 3300045976 Bacteria 2893
500 Ga0495629_0004819 3300046459 Bacteria 10121
501 Ga0495629_0111905 3300046459 Unclassified 1903
502 Ga0495629_0112747 3300046459 Bacteria 1896
503 Ga0495651_0083453 3300046462 Bacteria 2409
504 Ga0495580_0000874 3300046472 Bacteria 26072
505 Ga0495580_0012607 3300046472 Bacteria 6480
506 Ga0495580_0028823 3300046472 Bacteria 4034
507 Ga0495582_0000142 3300046473 Bacteria 38514
508 Ga0495639_0000663 3300046475 Bacteria 15927
509 Ga0495664_0012098 3300046477 Bacteria 4881
510 Ga0495594_0016573 3300046499 Bacteria 3885
511 Ga0495594_0089037 3300046499 Unclassified 1728
512 Ga0495594_0114643 3300046499 Bacteria 1521
513 Ga0495608_0062335 3300046511 Bacteria 2450
514 Ga0495628_0018170 3300046516 Bacteria 5831
515 Ga0495630_0003191 3300046517 Bacteria 11401
516 Ga0495630_0024540 3300046517 Bacteria 4457
517 Ga0495630_0081562 3300046517 Bacteria 2441
518 Ga0495663_0006558 3300046525 Bacteria 3212
519 Ga0495652_0018708 3300046529 Bacteria 6174
520 Ga0495665_0000009 3300046531 Bacteria 75094
521 Ga0495665_0004906 3300046531 Bacteria 7211
522 Ga0495640_0047471 3300046533 Bacteria 2972
523 Ga0495586_0021906 3300046535 Bacteria 3410
524 Ga0495587_0002876 3300046536 Bacteria 11533
525 Ga0495587_0015658 3300046536 Bacteria 4730
526 Ga0495621_0009880 3300046539 Bacteria 2911
527 Ga0495645_0000316 3300046543 Bacteria 34637
528 Ga0495645_0028533 3300046543 Unclassified 4056
529 Ga0495667_0108423 3300046559 Bacteria 1794
530 Ga0495635_0054946 3300046663 Bacteria 2743
531 Ga0495588_0001281 3300046674 Bacteria 10768
532 Ga0495599_0000646 3300046678 Bacteria 19723
533 Ga0495599_0024374 3300046678 Bacteria 3784
534 Ga0495623_0034978 3300046679 Bacteria 3221
535 Ga0495646_0086317 3300046680 Bacteria 1820
536 Ga0495658_0000131 3300046683 Bacteria 41245
537 Ga0495658_0013031 3300046683 Bacteria 4226
538 Ga0495581_0000366 3300047315 Bacteria 22649
539 Ga0495581_0017214 3300047315 Bacteria 4200
540 Ga0495581_0132429 3300047315 Bacteria 1453
541 Ga0495604_0006036 3300047317 Bacteria 9613
542 Ga0495674_0017454 3300047319 Bacteria 6678
543 Ga0495675_0005499 3300047444 Bacteria 7730
544 Ga0495675_0008607 3300047444 Bacteria 6326
545 Ga0495685_054249 3300047447 Bacteria 1356
546 Ga0495684_0005686 3300047471 Bacteria 9706
547 Ga0495684_0015720 3300047471 Bacteria 5824
548 Ga0495593_0000040 3300047673 Bacteria 52326
549 Ga0495593_0079871 3300047673 Bacteria 1693
550 Ga0495614_0002014 3300048089 Bacteria 8934
551 Ga0496102_0290593 3300048905 Bacteria 1541
552 Ga0496104_0014754 3300048907 Bacteria 7061
553 Ga0496104_0117817 3300048907 Unclassified 2549
554 Ga0496104_0166462 3300048907 Bacteria 2114
555 Ga0496104_0219545 3300048907 Unclassified 1813
556 Ga0496105_0084700 3300048908 Bacteria 2619
557 Ga0496106_0130930 3300048909 Unclassified 1967
558 Ga0496106_0187077 3300048909 Bacteria 1645
559 Ga0496108_0038642 3300048911 Bacteria 3976
560 Ga0496108_0146747 3300048911 Unclassified 2034
561 Ga0496108_0160804 3300048911 Bacteria 1941
562 Ga0496108_0271275 3300048911 Bacteria 1477
563 Ga0496109_0060384 3300048912 Bacteria 3464
564 Ga0496109_0343217 3300048912 Unclassified 1410
565 Ga0496110_0004901 3300048913 Bacteria 10443
566 Ga0496111_0003621 3300048914 Bacteria 9579
567 Ga0496112_0006799 3300048915 Bacteria 10079
568 Ga0496112_0188469 3300048915 Bacteria 2025
569 Ga0496112_0195626 3300048915 Bacteria 1983
570 Ga0496112_0241528 3300048915 Bacteria 1759
571 Ga0496113_0004608 3300048916 Bacteria 8500
572 Ga0496113_0006110 3300048916 Bacteria 7599
573 Ga0496113_0038333 3300048916 Bacteria 3523
574 Ga0501032_0009000 3300049569 Bacteria 7259
575 Ga0501033_0009596 3300049570 Bacteria 7447
576 Ga0501047_0003790 3300049581 Bacteria 14231
577 Ga0501047_0026840 3300049581 Bacteria 5544
578 Ga0501047_0158235 3300049581 Bacteria 2138
579 Ga0501067_0010510 3300049583 Bacteria 5126
580 Ga0501067_0087429 3300049583 Bacteria 1729
581 Ga0501069_0155351 3300049585 Bacteria 1316
582 Ga0501070_0019688 3300049586 Bacteria 5659
583 Ga0501044_0002752 3300049823 Bacteria 20012
584 nmdc:mga05p37_3651_c1 3300050507 Bacteria 17997
585 nmdc:mga05p37_58807_c1 3300050507 Bacteria 4734
586 nmdc:mga09592_144004_c1 3300050508 Unclassified 2055
587 nmdc:mga09592_197745_c1 3300050508 Bacteria 1741
588 nmdc:mga09592_379188_c1 3300050508 Bacteria 1223
589 nmdc:mga0qj67_17021_c1 3300050509 Bacteria 5522
590 nmdc:mga0qj67_17304_c1 3300050509 Bacteria 5479
591 nmdc:mga0qj67_53175_c1 3300050509 Unclassified 3206
592 nmdc:mga0qj67_931_c1 3300050509 Bacteria 20144
593 nmdc:mga06r32_17846_c1 3300050510 Bacteria 6485
594 nmdc:mga08y16_127867_c1 3300050511 Bacteria 2643
595 nmdc:mga08y16_168565_c1 3300050511 Bacteria 2275
596 nmdc:mga08y16_316116_c1 3300050511 Bacteria 1608
597 nmdc:mga0n895_250535_c1 3300050512 Unclassified 1797
598 nmdc:mga0n895_339117_c1 3300050512 Bacteria 1523
599 nmdc:mga0n895_478145_c1 3300050512 Unclassified 1256
600 nmdc:mga0n895_57823_c1 3300050512 Bacteria 3823
601 nmdc:mga0n895_72899_c1 3300050512 Bacteria 3408
602 nmdc:mga0n895_8015_c1 3300050512 Bacteria 9111
603 nmdc:mga0rr50_24806_c1 3300050513 Bacteria 4159
604 nmdc:mga0a205_4663_c2 3300050515 Bacteria 10613
605 nmdc:mga0a205_89215_c1 3300050515 Bacteria 2980
606 Ga0495601_0046087 3300053077 Bacteria 2744
607 Ga0495601_0173112 3300053077 Unclassified 1411
608 Ga0495612_0078174 3300053078 Bacteria 1387
609 Ga0495595_0125096 3300053084 Bacteria 1254
610 Ga0495619_0141262 3300053085 Unclassified 1658
611 Ga0590071_000641 3300059421 Bacteria 9939
612 Ga0590071_004054 3300059421 Bacteria 3577
613 Ga0590075_013216 3300059424 Bacteria 2010
614 Ga0590077_015541 3300059426 Bacteria 1592

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046525 Ga0495663_0006558 Ga0495663_0006558_2176_3033 226
2 3300050508 nmdc:mga09592_379188_c1 nmdc:mga09592_379188_c1_28_987 254
3 3300013306 Ga0163162_10126037 Ga0163162_101260372 269
4 3300026067 Ga0207678_10300489 Ga0207678_103004892 271
5 3300005546 Ga0070696_100000840 Ga0070696_10000084014 272
6 3300042876 Ga0451577_0000001 Ga0451577_0000001_574710_575813 272
7 3300005354 Ga0070675_100003367 Ga0070675_10000336711 273
8 3300005365 Ga0070688_100005659 Ga0070688_1000056595 273
9 3300005840 Ga0068870_10003341 Ga0068870_100033419 273
10 3300009094 Ga0111539_10465776 Ga0111539_104657761 273
11 3300013308 Ga0157375_10103854 Ga0157375_101038543 273
12 3300025908 Ga0207643_10007907 Ga0207643_100079076 273
13 3300025919 Ga0207657_10291048 Ga0207657_102910482 273
14 3300025932 Ga0207690_10105294 Ga0207690_101052942 273
15 3300025940 Ga0207691_10005766 Ga0207691_1000576611 273
16 3300005355 Ga0070671_100016066 Ga0070671_1000160666 274
17 3300005577 Ga0068857_100155119 Ga0068857_1001551192 274
18 3300026116 Ga0207674_10123235 Ga0207674_101232353 274
19 3300046539 Ga0495621_0009880 Ga0495621_0009880_910_2046 274
20 3300047447 Ga0495685_054249 Ga0495685_054249_109_1245 274
21 3300005435 Ga0070714_100001803 Ga0070714_1000018033 275
22 3300025929 Ga0207664_10027237 Ga0207664_100272371 275
23 3300025912 Ga0207707_10006733 Ga0207707_100067339 278
24 3300025912 Ga0207707_10008243 Ga0207707_100082439 278
25 3300025921 Ga0207652_10043947 Ga0207652_100439474 278
26 3300005341 Ga0070691_10039751 Ga0070691_100397512 279
27 3300005441 Ga0070700_100008003 Ga0070700_1000080038 279
28 3300005457 Ga0070662_100006003 Ga0070662_1000060031 279
29 3300005535 Ga0070684_100055243 Ga0070684_1000552433 279
30 3300005719 Ga0068861_100372789 Ga0068861_1003727891 279
31 3300006881 Ga0068865_100002221 Ga0068865_10000222110 279
32 3300009098 Ga0105245_10016180 Ga0105245_100161802 279
33 3300013297 Ga0157378_10014701 Ga0157378_100147013 279
34 3300025907 Ga0207645_10010773 Ga0207645_100107735 279
35 3300025927 Ga0207687_10044874 Ga0207687_100448743 279
36 3300025933 Ga0207706_10001172 Ga0207706_100011725 279
37 3300025941 Ga0207711_10246015 Ga0207711_102460151 279
38 3300026023 Ga0207677_10026811 Ga0207677_100268114 279
39 3300026075 Ga0207708_10042376 Ga0207708_100423763 279
40 3300045051 Ga0451576_0211027 Ga0451576_0211027_617_1768 279
41 3300048907 Ga0496104_0219545 Ga0496104_0219545_533_1684 279
42 3300048911 Ga0496108_0146747 Ga0496108_0146747_811_1962 279
43 3300048912 Ga0496109_0343217 Ga0496109_0343217_40_1191 279
44 3300048915 Ga0496112_0006799 Ga0496112_0006799_6496_7647 279
45 3300048916 Ga0496113_0006110 Ga0496113_0006110_680_1831 279
46 3300013306 Ga0163162_10135773 Ga0163162_101357732 281
47 3300050512 nmdc:mga0n895_478145_c1 nmdc:mga0n895_478145_c1_12_1163 281
48 3300005327 Ga0070658_10022112 Ga0070658_100221122 282
49 3300005329 Ga0070683_100014387 Ga0070683_1000143874 282
50 3300005347 Ga0070668_100040297 Ga0070668_1000402972 282
51 3300005353 Ga0070669_100005930 Ga0070669_10000593010 282
52 3300005366 Ga0070659_100044397 Ga0070659_1000443972 282
53 3300005438 Ga0070701_10027253 Ga0070701_100272532 282
54 3300005459 Ga0068867_100155653 Ga0068867_1001556532 282
55 3300005468 Ga0070707_100015781 Ga0070707_1000157819 282
56 3300005543 Ga0070672_100139336 Ga0070672_1001393362 282
57 3300005549 Ga0070704_100112891 Ga0070704_1001128912 282
58 3300005577 Ga0068857_100009827 Ga0068857_1000098272 282
59 3300005577 Ga0068857_100028111 Ga0068857_1000281113 282
60 3300005834 Ga0068851_10022841 Ga0068851_100228411 282
61 3300005843 Ga0068860_100098780 Ga0068860_1000987802 282
62 3300005844 Ga0068862_100000800 Ga0068862_10000080010 282
63 3300009094 Ga0111539_10095429 Ga0111539_100954293 282
64 3300009553 Ga0105249_10000131 Ga0105249_1000013149 282
65 3300013105 Ga0157369_10423626 Ga0157369_104236261 282
66 3300013306 Ga0163162_10118948 Ga0163162_101189482 282
67 3300014326 Ga0157380_10004528 Ga0157380_100045285 282
68 3300025908 Ga0207643_10002102 Ga0207643_1000210210 282
69 3300025922 Ga0207646_10020564 Ga0207646_100205642 282
70 3300025923 Ga0207681_10002224 Ga0207681_1000222410 282
71 3300025933 Ga0207706_10054081 Ga0207706_100540813 282
72 3300025940 Ga0207691_10095316 Ga0207691_100953162 282
73 3300025961 Ga0207712_10014341 Ga0207712_100143412 282
74 3300025972 Ga0207668_10239798 Ga0207668_102397981 282
75 3300026075 Ga0207708_10092301 Ga0207708_100923012 282
76 3300026116 Ga0207674_10020881 Ga0207674_100208816 282
77 3300026116 Ga0207674_10038096 Ga0207674_100380963 282
78 3300026121 Ga0207683_10258525 Ga0207683_102585252 282
79 3300027907 Ga0207428_10103782 Ga0207428_101037822 282
80 3300028380 Ga0268265_10005142 Ga0268265_100051426 282
81 3300028381 Ga0268264_10231499 Ga0268264_102314992 282
82 3300048915 Ga0496112_0188469 Ga0496112_0188469_485_1636 282
83 3300048916 Ga0496113_0038333 Ga0496113_0038333_1513_2664 282
84 3300050511 nmdc:mga08y16_127867_c1 nmdc:mga08y16_127867_c1_322_1476 282
85 3300050512 nmdc:mga0n895_72899_c1 nmdc:mga0n895_72899_c1_279_1373 282
86 3300046679 Ga0495623_0034978 Ga0495623_0034978_187_1317 283
87 3300005356 Ga0070674_100023698 Ga0070674_1000236983 284
88 3300005468 Ga0070707_100098210 Ga0070707_1000982103 284
89 3300005518 Ga0070699_100020370 Ga0070699_1000203705 284
90 3300005536 Ga0070697_100052219 Ga0070697_1000522194 284
91 3300005564 Ga0070664_100074485 Ga0070664_1000744853 284
92 3300006852 Ga0075433_10069541 Ga0075433_100695413 284
93 3300009147 Ga0114129_10006750 Ga0114129_1000675011 284
94 3300025937 Ga0207669_10064686 Ga0207669_100646863 284
95 3300025945 Ga0207679_10047652 Ga0207679_100476523 284
96 3300050507 nmdc:mga05p37_3651_c1 nmdc:mga05p37_3651_c1_3555_4709 284
97 3300050512 nmdc:mga0n895_339117_c1 nmdc:mga0n895_339117_c1_155_1309 284
98 3300050513 nmdc:mga0rr50_24806_c1 nmdc:mga0rr50_24806_c1_2822_3976 284
99 3300013100 Ga0157373_10007545 Ga0157373_100075457 285
100 3300036401 Ga0373937_0043034 Ga0373937_0043034_2414_3553 285
101 3300009177 Ga0105248_10094795 Ga0105248_100947953 286
102 3300025911 Ga0207654_10029751 Ga0207654_100297513 286
103 3300005355 Ga0070671_100059929 Ga0070671_1000599292 287
104 3300006880 Ga0075429_100020869 Ga0075429_1000208694 287
105 3300009147 Ga0114129_10021186 Ga0114129_100211861 287
106 3300025931 Ga0207644_10007827 Ga0207644_100078272 287
107 3300026067 Ga0207678_10113869 Ga0207678_101138692 287
108 3300032002 Ga0307416_100162302 Ga0307416_1001623021 287
109 3300048907 Ga0496104_0117817 Ga0496104_0117817_737_1888 287
110 3300048908 Ga0496105_0084700 Ga0496105_0084700_700_1851 287
111 3300050508 nmdc:mga09592_144004_c1 nmdc:mga09592_144004_c1_142_1281 287
112 3300005530 Ga0070679_100173789 Ga0070679_1001737892 288
113 3300005543 Ga0070672_100234117 Ga0070672_1002341172 288
114 3300009177 Ga0105248_10156800 Ga0105248_101568003 288
115 3300025940 Ga0207691_10195316 Ga0207691_101953162 288
116 3300031548 Ga0307408_100082073 Ga0307408_1000820733 288
117 3300031731 Ga0307405_10004685 Ga0307405_100046858 288
118 3300031824 Ga0307413_10000384 Ga0307413_100003849 288
119 3300031824 Ga0307413_10046201 Ga0307413_100462013 288
120 3300031852 Ga0307410_10001224 Ga0307410_100012243 288
121 3300031852 Ga0307410_10065170 Ga0307410_100651703 288
122 3300031903 Ga0307407_10002241 Ga0307407_1000224110 288
123 3300031911 Ga0307412_10028465 Ga0307412_100284651 288
124 3300031995 Ga0307409_100005851 Ga0307409_1000058516 288
125 3300032002 Ga0307416_100000541 Ga0307416_1000005419 288
126 3300032004 Ga0307414_10022563 Ga0307414_100225634 288
127 3300032004 Ga0307414_10100190 Ga0307414_101001902 288
128 3300032005 Ga0307411_10002798 Ga0307411_100027986 288
129 3300032005 Ga0307411_10004205 Ga0307411_100042053 288
130 3300032005 Ga0307411_10082541 Ga0307411_100825413 288
131 3300032126 Ga0307415_100000895 Ga0307415_10000089513 288
132 3300032126 Ga0307415_100048880 Ga0307415_1000488802 288
133 3300032126 Ga0307415_100084793 Ga0307415_1000847932 288
134 3300005338 Ga0068868_100143643 Ga0068868_1001436432 289
135 3300013297 Ga0157378_10238440 Ga0157378_102384402 289
136 3300025931 Ga0207644_10095893 Ga0207644_100958932 289
137 3300031903 Ga0307407_10163728 Ga0307407_101637282 289
138 3300031995 Ga0307409_100122242 Ga0307409_1001222422 289
139 3300048909 Ga0496106_0130930 Ga0496106_0130930_427_1578 289
140 3300048909 Ga0496106_0187077 Ga0496106_0187077_407_1501 289
141 3300005616 Ga0068852_100178355 Ga0068852_1001783552 290
142 3300025899 Ga0207642_10113519 Ga0207642_101135192 290
143 3300025940 Ga0207691_10101075 Ga0207691_101010752 290
144 3300026089 Ga0207648_10014800 Ga0207648_1001480010 290
145 3300005329 Ga0070683_100007872 Ga0070683_1000078722 291
146 3300005330 Ga0070690_100172420 Ga0070690_1001724201 291
147 3300005331 Ga0070670_100014873 Ga0070670_1000148731 291
148 3300005334 Ga0068869_100014258 Ga0068869_1000142582 291
149 3300005336 Ga0070680_100026465 Ga0070680_1000264651 291
150 3300005337 Ga0070682_100009246 Ga0070682_1000092463 291
151 3300005339 Ga0070660_100061986 Ga0070660_1000619861 291
152 3300005344 Ga0070661_100001410 Ga0070661_10000141014 291
153 3300005354 Ga0070675_100014802 Ga0070675_1000148023 291
154 3300005366 Ga0070659_100013575 Ga0070659_1000135752 291
155 3300005440 Ga0070705_100062161 Ga0070705_1000621612 291
156 3300005457 Ga0070662_100049520 Ga0070662_1000495202 291
157 3300005458 Ga0070681_10053692 Ga0070681_100536921 291
158 3300005530 Ga0070679_100011509 Ga0070679_1000115092 291
159 3300005547 Ga0070693_100001820 Ga0070693_1000018206 291
160 3300005563 Ga0068855_100040846 Ga0068855_1000408462 291
161 3300005564 Ga0070664_100010981 Ga0070664_1000109812 291
162 3300005577 Ga0068857_100013425 Ga0068857_1000134252 291
163 3300005614 Ga0068856_100232264 Ga0068856_1002322641 291
164 3300005615 Ga0070702_100006540 Ga0070702_1000065404 291
165 3300005617 Ga0068859_100100097 Ga0068859_1001000971 291
166 3300005618 Ga0068864_100040252 Ga0068864_1000402521 291
167 3300005840 Ga0068870_10078785 Ga0068870_100787852 291
168 3300005841 Ga0068863_100008812 Ga0068863_10000881212 291
169 3300006237 Ga0097621_100014901 Ga0097621_1000149018 291
170 3300006931 Ga0097620_100100094 Ga0097620_1001000941 291
171 3300009098 Ga0105245_10019525 Ga0105245_100195255 291
172 3300009098 Ga0105245_10070600 Ga0105245_100706003 291
173 3300009148 Ga0105243_10095997 Ga0105243_100959973 291
174 3300009174 Ga0105241_10028241 Ga0105241_100282413 291
175 3300009176 Ga0105242_10002665 Ga0105242_1000266513 291
176 3300009176 Ga0105242_10143293 Ga0105242_101432932 291
177 3300009177 Ga0105248_10024300 Ga0105248_100243009 291
178 3300010375 Ga0105239_10066794 Ga0105239_100667942 291
179 3300011119 Ga0105246_10002055 Ga0105246_1000205511 291
180 3300013100 Ga0157373_10062445 Ga0157373_100624451 291
181 3300013102 Ga0157371_10080852 Ga0157371_100808522 291
182 3300013296 Ga0157374_10063722 Ga0157374_100637222 291
183 3300013307 Ga0157372_10099810 Ga0157372_100998102 291
184 3300013308 Ga0157375_10021245 Ga0157375_100212456 291
185 3300014325 Ga0163163_10084033 Ga0163163_100840333 291
186 3300014969 Ga0157376_10023306 Ga0157376_100233065 291
187 3300025908 Ga0207643_10081472 Ga0207643_100814722 291
188 3300025912 Ga0207707_10020108 Ga0207707_100201085 291
189 3300025921 Ga0207652_10057977 Ga0207652_100579773 291
190 3300025925 Ga0207650_10007569 Ga0207650_1000756910 291
191 3300025927 Ga0207687_10013206 Ga0207687_100132065 291
192 3300025932 Ga0207690_10056537 Ga0207690_100565371 291
193 3300025933 Ga0207706_10160860 Ga0207706_101608602 291
194 3300025934 Ga0207686_10086885 Ga0207686_100868851 291
195 3300025934 Ga0207686_10087241 Ga0207686_100872412 291
196 3300025936 Ga0207670_10014841 Ga0207670_100148413 291
197 3300025941 Ga0207711_10017100 Ga0207711_100171005 291
198 3300025941 Ga0207711_10027868 Ga0207711_100278683 291
199 3300025942 Ga0207689_10003790 Ga0207689_1000379011 291
200 3300025944 Ga0207661_10007529 Ga0207661_100075293 291
201 3300025945 Ga0207679_10005509 Ga0207679_1000550910 291
202 3300025949 Ga0207667_10034783 Ga0207667_100347836 291
203 3300026041 Ga0207639_10073917 Ga0207639_100739172 291
204 3300026078 Ga0207702_10018881 Ga0207702_100188812 291
205 3300026088 Ga0207641_10022683 Ga0207641_100226836 291
206 3300026116 Ga0207674_10000208 Ga0207674_1000020837 291
207 3300042156 Ga0439446_0025411 Ga0439446_0025411_426_1517 291
208 3300049581 Ga0501047_0158235 Ga0501047_0158235_389_1501 291
209 3300053077 Ga0495601_0173112 Ga0495601_0173112_217_1362 291
210 3300005327 Ga0070658_10015518 Ga0070658_100155185 292
211 3300005616 Ga0068852_100005268 Ga0068852_10000526810 292
212 3300005842 Ga0068858_100311697 Ga0068858_1003116972 292
213 3300013105 Ga0157369_10006735 Ga0157369_1000673511 292
214 3300013306 Ga0163162_10462887 Ga0163162_104628872 292
215 3300013307 Ga0157372_10448677 Ga0157372_104486771 292
216 3300025908 Ga0207643_10062594 Ga0207643_100625942 292
217 3300025918 Ga0207662_10049712 Ga0207662_100497122 292
218 3300025972 Ga0207668_10016237 Ga0207668_100162372 292
219 3300026142 Ga0207698_10025723 Ga0207698_100257234 292
220 3300028380 Ga0268265_10020036 Ga0268265_100200362 292
221 3300035691 Ga0373931_0125317 Ga0373931_0125317_49_1206 292
222 3300048907 Ga0496104_0014754 Ga0496104_0014754_4025_5119 292
223 3300048913 Ga0496110_0004901 Ga0496110_0004901_7654_8748 292
224 3300048915 Ga0496112_0195626 Ga0496112_0195626_549_1610 293
225 3300005458 Ga0070681_10001775 Ga0070681_100017755 294
226 3300005530 Ga0070679_100001349 Ga0070679_10000134918 294
227 3300009545 Ga0105237_10280336 Ga0105237_102803362 294
228 3300010375 Ga0105239_10007696 Ga0105239_100076963 294
229 3300025912 Ga0207707_10002809 Ga0207707_1000280917 294
230 3300025921 Ga0207652_10006228 Ga0207652_100062288 294
231 3300049583 Ga0501067_0010510 Ga0501067_0010510_72_1178 294
232 3300049585 Ga0501069_0155351 Ga0501069_0155351_104_1210 294
233 3300046472 Ga0495580_0028823 Ga0495580_0028823_99_1244 295
234 3300046499 Ga0495594_0089037 Ga0495594_0089037_542_1687 295
235 3300049569 Ga0501032_0009000 Ga0501032_0009000_249_1406 295
236 3300049581 Ga0501047_0003790 Ga0501047_0003790_7445_8602 295
237 3300049586 Ga0501070_0019688 Ga0501070_0019688_2293_3450 295
238 3300039437 Ga0436365_1313802 Ga0436365_1313802_297_1439 296
239 3300059421 Ga0590071_000641 Ga0590071_000641_7053_8150 296
240 3300059426 Ga0590077_015541 Ga0590077_015541_308_1405 296
241 3300005336 Ga0070680_100000354 Ga0070680_10000035410 297
242 3300005337 Ga0070682_100000492 Ga0070682_1000004923 297
243 3300005347 Ga0070668_100031679 Ga0070668_1000316792 297
244 3300005356 Ga0070674_100122668 Ga0070674_1001226682 297
245 3300005367 Ga0070667_100039826 Ga0070667_1000398263 297
246 3300005459 Ga0068867_100005743 Ga0068867_1000057435 297
247 3300005530 Ga0070679_100000377 Ga0070679_10000037725 297
248 3300005843 Ga0068860_100134683 Ga0068860_1001346832 297
249 3300006881 Ga0068865_100006993 Ga0068865_1000069932 297
250 3300009148 Ga0105243_10098932 Ga0105243_100989321 297
251 3300013306 Ga0163162_10042337 Ga0163162_100423372 297
252 3300025912 Ga0207707_10002464 Ga0207707_100024648 297
253 3300025917 Ga0207660_10052342 Ga0207660_100523422 297
254 3300025921 Ga0207652_10021261 Ga0207652_100212612 297
255 3300025935 Ga0207709_10050412 Ga0207709_100504122 297
256 3300025938 Ga0207704_10129567 Ga0207704_101295672 297
257 3300025940 Ga0207691_10010422 Ga0207691_100104225 297
258 3300025941 Ga0207711_10046092 Ga0207711_100460922 297
259 3300025986 Ga0207658_10087090 Ga0207658_100870902 297
260 3300026089 Ga0207648_10016629 Ga0207648_100166294 297
261 3300028381 Ga0268264_10063710 Ga0268264_100637102 297
262 3300005364 Ga0070673_100089908 Ga0070673_1000899082 298
263 3300005530 Ga0070679_100102321 Ga0070679_1001023213 298
264 3300005544 Ga0070686_100052044 Ga0070686_1000520443 298
265 3300005545 Ga0070695_100007270 Ga0070695_1000072703 298
266 3300005615 Ga0070702_100066811 Ga0070702_1000668111 298
267 3300009094 Ga0111539_10220190 Ga0111539_102201902 298
268 3300009094 Ga0111539_10240307 Ga0111539_102403072 298
269 3300013308 Ga0157375_10011285 Ga0157375_100112853 298
270 3300025918 Ga0207662_10048640 Ga0207662_100486403 298
271 3300025939 Ga0207665_10201970 Ga0207665_102019702 298
272 3300025949 Ga0207667_10130531 Ga0207667_101305311 298
273 3300026116 Ga0207674_10159922 Ga0207674_101599222 298
274 3300048915 Ga0496112_0241528 Ga0496112_0241528_417_1553 298
275 3300050511 nmdc:mga08y16_168565_c1 nmdc:mga08y16_168565_c1_1056_2186 298
276 3300005327 Ga0070658_10002218 Ga0070658_1000221810 299
277 3300005337 Ga0070682_100008751 Ga0070682_1000087511 299
278 3300005339 Ga0070660_100009663 Ga0070660_1000096632 299
279 3300005344 Ga0070661_100077209 Ga0070661_1000772093 299
280 3300005366 Ga0070659_100025729 Ga0070659_1000257295 299
281 3300005563 Ga0068855_100007038 Ga0068855_1000070382 299
282 3300013307 Ga0157372_10006551 Ga0157372_100065516 299
283 3300025909 Ga0207705_10005895 Ga0207705_1000589511 299
284 3300025919 Ga0207657_10001987 Ga0207657_1000198717 299
285 3300025923 Ga0207681_10008973 Ga0207681_100089732 299
286 3300025927 Ga0207687_10116289 Ga0207687_101162892 299
287 3300044684 Ga0466966_0031762 Ga0466966_0031762_1675_2814 299
288 3300045049 Ga0466959_0171968 Ga0466959_0171968_188_1327 299
289 3300049583 Ga0501067_0087429 Ga0501067_0087429_518_1621 299
290 3300050511 nmdc:mga08y16_316116_c1 nmdc:mga08y16_316116_c1_58_1152 299
291 3300005336 Ga0070680_100040225 Ga0070680_1000402253 300
292 3300005339 Ga0070660_100140968 Ga0070660_1001409682 300
293 3300005458 Ga0070681_10039263 Ga0070681_100392632 300
294 3300048911 Ga0496108_0038642 Ga0496108_0038642_740_1834 300
295 3300048912 Ga0496109_0060384 Ga0496109_0060384_945_2039 300
296 3300048914 Ga0496111_0003621 Ga0496111_0003621_603_1697 300
297 3300048916 Ga0496113_0004608 Ga0496113_0004608_2794_3888 300
298 3300009176 Ga0105242_10003515 Ga0105242_1000351510 301
299 3300025926 Ga0207659_10321075 Ga0207659_103210752 301
300 3300005530 Ga0070679_100099574 Ga0070679_1000995742 302
301 3300005617 Ga0068859_100015924 Ga0068859_1000159249 302
302 3300006931 Ga0097620_100015924 Ga0097620_1000159249 302
303 3300025921 Ga0207652_10257756 Ga0207652_102577562 302
304 3300031548 Ga0307408_100244337 Ga0307408_1002443372 302
305 3300059421 Ga0590071_004054 Ga0590071_004054_125_1219 302
306 3300059424 Ga0590075_013216 Ga0590075_013216_508_1602 302
307 3300048907 Ga0496104_0166462 Ga0496104_0166462_421_1512 303
308 3300005329 Ga0070683_100123188 Ga0070683_1001231882 304
309 3300005535 Ga0070684_100006657 Ga0070684_1000066578 304
310 3300005564 Ga0070664_100207803 Ga0070664_1002078032 304
311 3300006846 Ga0075430_100011415 Ga0075430_1000114158 304
312 3300031824 Ga0307413_10041492 Ga0307413_100414923 304
313 3300032002 Ga0307416_100008974 Ga0307416_1000089748 304
314 3300032126 Ga0307415_100058185 Ga0307415_1000581853 304
315 3300045976 Ga0466967_0083237 Ga0466967_0083237_216_1358 304
316 3300050509 nmdc:mga0qj67_17021_c1 nmdc:mga0qj67_17021_c1_343_1479 304
317 3300026142 Ga0207698_10214030 Ga0207698_102140301 305
318 3300048905 Ga0496102_0290593 Ga0496102_0290593_351_1457 305
319 3300005331 Ga0070670_100006497 Ga0070670_1000064971 306
320 3300005530 Ga0070679_100177388 Ga0070679_1001773882 306
321 3300005618 Ga0068864_100216015 Ga0068864_1002160152 306
322 3300006358 Ga0068871_100150589 Ga0068871_1001505892 306
323 3300025912 Ga0207707_10054644 Ga0207707_100546443 306
324 3300025920 Ga0207649_10060588 Ga0207649_100605882 306
325 3300025921 Ga0207652_10157487 Ga0207652_101574872 306
326 3300025925 Ga0207650_10005419 Ga0207650_100054192 306
327 3300026095 Ga0207676_10079245 Ga0207676_100792453 306
328 3300005344 Ga0070661_100118758 Ga0070661_1001187582 307
329 3300005468 Ga0070707_100024874 Ga0070707_1000248746 307
330 3300005471 Ga0070698_100001204 Ga0070698_10000120413 307
331 3300005617 Ga0068859_100177602 Ga0068859_1001776022 307
332 3300006846 Ga0075430_100115482 Ga0075430_1001154822 307
333 3300006847 Ga0075431_100012683 Ga0075431_10001268310 307
334 3300006931 Ga0097620_100177603 Ga0097620_1001776032 307
335 3300025922 Ga0207646_10064178 Ga0207646_100641782 307
336 3300028380 Ga0268265_10036233 Ga0268265_100362333 307
337 3300037068 Ga0373925_0082298 Ga0373925_0082298_308_1462 307
338 3300046499 Ga0495594_0114643 Ga0495594_0114643_277_1422 307
339 3300046517 Ga0495630_0024540 Ga0495630_0024540_1750_2904 307
340 3300046535 Ga0495586_0021906 Ga0495586_0021906_948_2102 307
341 3300047315 Ga0495581_0017214 Ga0495581_0017214_2092_3237 307
342 3300047471 Ga0495684_0015720 Ga0495684_0015720_4082_5236 307
343 3300047673 Ga0495593_0079871 Ga0495593_0079871_476_1621 307
344 3300005329 Ga0070683_100050136 Ga0070683_1000501362 308
345 3300005563 Ga0068855_100005805 Ga0068855_10000580511 308
346 3300006028 Ga0070717_10084592 Ga0070717_100845923 308
347 3300009093 Ga0105240_10178962 Ga0105240_101789621 308
348 3300025913 Ga0207695_10037328 Ga0207695_100373286 308
349 3300046459 Ga0495629_0004819 Ga0495629_0004819_690_1832 308
350 3300046683 Ga0495658_0013031 Ga0495658_0013031_175_1317 308
351 3300005328 Ga0070676_10067778 Ga0070676_100677782 310
352 3300005434 Ga0070709_10155229 Ga0070709_101552291 310
353 3300005435 Ga0070714_100074240 Ga0070714_1000742402 310
354 3300005435 Ga0070714_100136821 Ga0070714_1001368212 310
355 3300005436 Ga0070713_100006043 Ga0070713_1000060435 310
356 3300005439 Ga0070711_100053749 Ga0070711_1000537493 310
357 3300006173 Ga0070716_100139807 Ga0070716_1001398071 310
358 3300006175 Ga0070712_100011778 Ga0070712_1000117783 310
359 3300025906 Ga0207699_10035209 Ga0207699_100352093 310
360 3300025907 Ga0207645_10084523 Ga0207645_100845232 310
361 3300025915 Ga0207693_10019977 Ga0207693_100199772 310
362 3300025916 Ga0207663_10083442 Ga0207663_100834422 310
363 3300025923 Ga0207681_10255181 Ga0207681_102551811 310
364 3300025928 Ga0207700_10033091 Ga0207700_100330914 310
365 3300025929 Ga0207664_10054702 Ga0207664_100547023 310
366 3300025929 Ga0207664_10118955 Ga0207664_101189553 310
367 3300035083 Ga0373926_0002772 Ga0373926_0002772_38_1159 310
368 3300035089 Ga0373944_0004135 Ga0373944_0004135_270_1391 310
369 3300035113 Ga0373936_0013214 Ga0373936_0013214_18_1139 310
370 3300035170 Ga0373943_0002090 Ga0373943_0002090_1014_2135 310
371 3300035692 Ga0373935_0002652 Ga0373935_0002652_5169_6290 310
372 3300035695 Ga0373927_0001791 Ga0373927_0001791_328_1449 310
373 3300035725 Ga0373947_0000698 Ga0373947_0000698_4126_5247 310
374 3300037068 Ga0373925_0003620 Ga0373925_0003620_5000_6121 310
375 3300046459 Ga0495629_0111905 Ga0495629_0111905_153_1274 310
376 3300046472 Ga0495580_0000874 Ga0495580_0000874_2325_3446 310
377 3300046473 Ga0495582_0000142 Ga0495582_0000142_16971_18092 310
378 3300046475 Ga0495639_0000663 Ga0495639_0000663_12387_13508 310
379 3300046517 Ga0495630_0003191 Ga0495630_0003191_7350_8471 310
380 3300046531 Ga0495665_0000009 Ga0495665_0000009_37387_38508 310
381 3300046663 Ga0495635_0054946 Ga0495635_0054946_1313_2434 310
382 3300046674 Ga0495588_0001281 Ga0495588_0001281_9088_10209 310
383 3300046683 Ga0495658_0000131 Ga0495658_0000131_31770_32891 310
384 3300047315 Ga0495581_0000366 Ga0495581_0000366_4275_5396 310
385 3300047673 Ga0495593_0000040 Ga0495593_0000040_22899_24020 310
386 3300048089 Ga0495614_0002014 Ga0495614_0002014_2197_3318 310
387 3300009094 Ga0111539_10244997 Ga0111539_102449971 311
388 3300050512 nmdc:mga0n895_250535_c1 nmdc:mga0n895_250535_c1_200_1306 311
389 3300005329 Ga0070683_100112796 Ga0070683_1001127962 312
390 3300005530 Ga0070679_100003405 Ga0070679_10000340511 312
391 3300025921 Ga0207652_10107395 Ga0207652_101073952 312
392 3300025933 Ga0207706_10030971 Ga0207706_100309712 312
393 3300025944 Ga0207661_10172498 Ga0207661_101724982 312
394 3300037312 Ga0395899_0024455 Ga0395899_0024455_2977_4125 312
395 3300037471 Ga0395905_0005015 Ga0395905_0005015_6108_7256 312
396 3300038443 Ga0395901_0004304 Ga0395901_0004304_6752_7900 312
397 3300046459 Ga0495629_0112747 Ga0495629_0112747_298_1443 312
398 3300006237 Ga0097621_100147925 Ga0097621_1001479252 313
399 3300035725 Ga0373947_0018423 Ga0373947_0018423_2033_3187 313
400 3300037068 Ga0373925_0019388 Ga0373925_0019388_3662_4804 313
401 3300046472 Ga0495580_0012607 Ga0495580_0012607_4720_5862 313
402 3300046499 Ga0495594_0016573 Ga0495594_0016573_2664_3806 313
403 3300046517 Ga0495630_0081562 Ga0495630_0081562_51_1193 313
404 3300046531 Ga0495665_0004906 Ga0495665_0004906_566_1708 313
405 3300046533 Ga0495640_0047471 Ga0495640_0047471_1728_2870 313
406 3300047315 Ga0495581_0132429 Ga0495581_0132429_131_1273 313
407 3300047319 Ga0495674_0017454 Ga0495674_0017454_286_1428 313
408 3300053085 Ga0495619_0141262 Ga0495619_0141262_476_1618 313
409 3300005336 Ga0070680_100000489 Ga0070680_10000048926 314
410 3300025917 Ga0207660_10000027 Ga0207660_1000002725 314
411 3300036401 Ga0373937_0114765 Ga0373937_0114765_1249_2385 314
412 3300031548 Ga0307408_100012846 Ga0307408_1000128463 315
413 3300031731 Ga0307405_10031029 Ga0307405_100310293 315
414 3300031824 Ga0307413_10004902 Ga0307413_100049023 315
415 3300031824 Ga0307413_10053408 Ga0307413_100534083 315
416 3300031852 Ga0307410_10011172 Ga0307410_100111722 315
417 3300031903 Ga0307407_10003959 Ga0307407_100039595 315
418 3300031911 Ga0307412_10050356 Ga0307412_100503561 315
419 3300031995 Ga0307409_100217842 Ga0307409_1002178422 315
420 3300032002 Ga0307416_100002606 Ga0307416_1000026064 315
421 3300032002 Ga0307416_100095237 Ga0307416_1000952373 315
422 3300032005 Ga0307411_10001294 Ga0307411_100012945 315
423 3300041406 Ga0439439_0002484 Ga0439439_0002484_1458_2591 315
424 3300042435 Ga0439434_0006631 Ga0439434_0006631_1705_2838 315
425 3300005328 Ga0070676_10062554 Ga0070676_100625542 316
426 3300005329 Ga0070683_100123553 Ga0070683_1001235533 316
427 3300005329 Ga0070683_100297380 Ga0070683_1002973801 316
428 3300005331 Ga0070670_100002223 Ga0070670_10000222310 316
429 3300005336 Ga0070680_100023357 Ga0070680_1000233575 316
430 3300005341 Ga0070691_10051203 Ga0070691_100512031 316
431 3300005344 Ga0070661_100008160 Ga0070661_1000081604 316
432 3300005354 Ga0070675_100064315 Ga0070675_1000643154 316
433 3300005367 Ga0070667_100239965 Ga0070667_1002399652 316
434 3300005458 Ga0070681_10014467 Ga0070681_100144676 316
435 3300005530 Ga0070679_100047091 Ga0070679_1000470913 316
436 3300005535 Ga0070684_100129102 Ga0070684_1001291022 316
437 3300005539 Ga0068853_100084207 Ga0068853_1000842074 316
438 3300005577 Ga0068857_100002342 Ga0068857_10000234211 316
439 3300006847 Ga0075431_100007854 Ga0075431_1000078546 316
440 3300009093 Ga0105240_10296239 Ga0105240_102962391 316
441 3300009177 Ga0105248_10021390 Ga0105248_100213908 316
442 3300009545 Ga0105237_10055922 Ga0105237_100559223 316
443 3300009551 Ga0105238_10036819 Ga0105238_100368194 316
444 3300013105 Ga0157369_10009491 Ga0157369_1000949110 316
445 3300013307 Ga0157372_10003116 Ga0157372_1000311612 316
446 3300013308 Ga0157375_10337410 Ga0157375_103374102 316
447 3300025908 Ga0207643_10020933 Ga0207643_100209332 316
448 3300025912 Ga0207707_10013189 Ga0207707_100131896 316
449 3300025914 Ga0207671_10110096 Ga0207671_101100962 316
450 3300025920 Ga0207649_10008386 Ga0207649_100083865 316
451 3300025920 Ga0207649_10071271 Ga0207649_100712712 316
452 3300025924 Ga0207694_10254674 Ga0207694_102546742 316
453 3300025926 Ga0207659_10004848 Ga0207659_100048489 316
454 3300025940 Ga0207691_10000761 Ga0207691_1000076122 316
455 3300025941 Ga0207711_10061730 Ga0207711_100617303 316
456 3300025944 Ga0207661_10037718 Ga0207661_100377183 316
457 3300025944 Ga0207661_10183135 Ga0207661_101831352 316
458 3300025986 Ga0207658_10156360 Ga0207658_101563602 316
459 3300026116 Ga0207674_10011064 Ga0207674_100110647 316
460 3300048911 Ga0496108_0271275 Ga0496108_0271275_122_1210 316
461 3300050509 nmdc:mga0qj67_17304_c1 nmdc:mga0qj67_17304_c1_1143_2294 316
462 3300050510 nmdc:mga06r32_17846_c1 nmdc:mga06r32_17846_c1_4097_5248 316
463 3300005436 Ga0070713_100320689 Ga0070713_1003206892 317
464 3300005535 Ga0070684_100109119 Ga0070684_1001091193 317
465 3300013307 Ga0157372_10338733 Ga0157372_103387332 317
466 3300005328 Ga0070676_10005548 Ga0070676_100055483 318
467 3300005329 Ga0070683_100010936 Ga0070683_1000109366 318
468 3300005334 Ga0068869_100007519 Ga0068869_1000075199 318
469 3300005335 Ga0070666_10090108 Ga0070666_100901082 318
470 3300005338 Ga0068868_100019745 Ga0068868_1000197453 318
471 3300005339 Ga0070660_100107396 Ga0070660_1001073963 318
472 3300005340 Ga0070689_100000673 Ga0070689_1000006733 318
473 3300005344 Ga0070661_100015888 Ga0070661_1000158886 318
474 3300005345 Ga0070692_10011319 Ga0070692_100113194 318
475 3300005354 Ga0070675_100027621 Ga0070675_1000276212 318
476 3300005364 Ga0070673_100166286 Ga0070673_1001662861 318
477 3300005365 Ga0070688_100006897 Ga0070688_1000068972 318
478 3300005366 Ga0070659_100023675 Ga0070659_1000236751 318
479 3300005367 Ga0070667_100004756 Ga0070667_10000475610 318
480 3300005438 Ga0070701_10009405 Ga0070701_100094053 318
481 3300005441 Ga0070700_100160313 Ga0070700_1001603132 318
482 3300005457 Ga0070662_100008714 Ga0070662_1000087146 318
483 3300005466 Ga0070685_10169594 Ga0070685_101695942 318
484 3300005535 Ga0070684_100022016 Ga0070684_1000220161 318
485 3300005535 Ga0070684_100131382 Ga0070684_1001313822 318
486 3300005539 Ga0068853_100027500 Ga0068853_1000275005 318
487 3300005543 Ga0070672_100001468 Ga0070672_10000146817 318
488 3300005544 Ga0070686_100060968 Ga0070686_1000609683 318
489 3300005545 Ga0070695_100187528 Ga0070695_1001875282 318
490 3300005564 Ga0070664_100081297 Ga0070664_1000812971 318
491 3300005616 Ga0068852_100020184 Ga0068852_1000201843 318
492 3300005617 Ga0068859_100059864 Ga0068859_1000598644 318
493 3300005719 Ga0068861_100003887 Ga0068861_1000038873 318
494 3300005834 Ga0068851_10007015 Ga0068851_100070155 318
495 3300005841 Ga0068863_100029541 Ga0068863_1000295413 318
496 3300005843 Ga0068860_100009628 Ga0068860_1000096289 318
497 3300005844 Ga0068862_100004451 Ga0068862_1000044519 318
498 3300006175 Ga0070712_100073409 Ga0070712_1000734093 318
499 3300006871 Ga0075434_100051238 Ga0075434_1000512382 318
500 3300006931 Ga0097620_100059864 Ga0097620_1000598644 318
501 3300009094 Ga0111539_10034308 Ga0111539_100343083 318
502 3300009177 Ga0105248_10027659 Ga0105248_100276592 318
503 3300009553 Ga0105249_10007249 Ga0105249_100072492 318
504 3300010375 Ga0105239_10198360 Ga0105239_101983602 318
505 3300013102 Ga0157371_10008559 Ga0157371_100085596 318
506 3300013104 Ga0157370_10004041 Ga0157370_100040418 318
507 3300013306 Ga0163162_10005364 Ga0163162_100053643 318
508 3300013308 Ga0157375_10006108 Ga0157375_100061089 318
509 3300014745 Ga0157377_10008970 Ga0157377_100089703 318
510 3300014968 Ga0157379_10000965 Ga0157379_100009655 318
511 3300025315 Ga0207697_10002065 Ga0207697_1000206511 318
512 3300025321 Ga0207656_10044004 Ga0207656_100440042 318
513 3300025903 Ga0207680_10096221 Ga0207680_100962213 318
514 3300025907 Ga0207645_10001564 Ga0207645_1000156415 318
515 3300025915 Ga0207693_10262703 Ga0207693_102627031 318
516 3300025918 Ga0207662_10001820 Ga0207662_1000182011 318
517 3300025919 Ga0207657_10059375 Ga0207657_100593753 318
518 3300025920 Ga0207649_10004071 Ga0207649_100040717 318
519 3300025923 Ga0207681_10002478 Ga0207681_1000247811 318
520 3300025926 Ga0207659_10003670 Ga0207659_1000367010 318
521 3300025932 Ga0207690_10016616 Ga0207690_100166163 318
522 3300025933 Ga0207706_10001727 Ga0207706_100017276 318
523 3300025936 Ga0207670_10031206 Ga0207670_100312062 318
524 3300025940 Ga0207691_10000638 Ga0207691_100006382 318
525 3300025942 Ga0207689_10002056 Ga0207689_1000205618 318
526 3300025944 Ga0207661_10011257 Ga0207661_100112575 318
527 3300025945 Ga0207679_10043833 Ga0207679_100438332 318
528 3300025945 Ga0207679_10094610 Ga0207679_100946103 318
529 3300025960 Ga0207651_10061880 Ga0207651_100618802 318
530 3300025961 Ga0207712_10014017 Ga0207712_100140173 318
531 3300025986 Ga0207658_10027985 Ga0207658_100279854 318
532 3300026035 Ga0207703_10004720 Ga0207703_1000472011 318
533 3300026067 Ga0207678_10014153 Ga0207678_100141533 318
534 3300026075 Ga0207708_10063356 Ga0207708_100633562 318
535 3300026088 Ga0207641_10020169 Ga0207641_100201695 318
536 3300026116 Ga0207674_10018952 Ga0207674_100189523 318
537 3300026118 Ga0207675_100003791 Ga0207675_1000037918 318
538 3300026142 Ga0207698_10190767 Ga0207698_101907672 318
539 3300027907 Ga0207428_10119856 Ga0207428_101198562 318
540 3300028380 Ga0268265_10007327 Ga0268265_1000732710 318
541 3300028381 Ga0268264_10010283 Ga0268264_100102835 318
542 3300031548 Ga0307408_100009869 Ga0307408_1000098694 318
543 3300031852 Ga0307410_10029421 Ga0307410_100294212 318
544 3300031901 Ga0307406_10158389 Ga0307406_101583892 318
545 3300032002 Ga0307416_100084627 Ga0307416_1000846272 318
546 3300035118 Ga0373954_0057986 Ga0373954_0057986_469_1605 318
547 3300035119 Ga0373956_0018712 Ga0373956_0018712_851_1987 318
548 3300045051 Ga0451576_0042270 Ga0451576_0042270_2380_3531 318
549 3300048911 Ga0496108_0160804 Ga0496108_0160804_105_1256 318
550 3300050512 nmdc:mga0n895_57823_c1 nmdc:mga0n895_57823_c1_930_2081 318
551 3300050515 nmdc:mga0a205_89215_c1 nmdc:mga0a205_89215_c1_382_1533 318
552 3300006846 Ga0075430_100020317 Ga0075430_1000203174 319
553 3300006847 Ga0075431_100066919 Ga0075431_1000669194 319
554 3300006880 Ga0075429_100102583 Ga0075429_1001025832 319
555 3300050508 nmdc:mga09592_197745_c1 nmdc:mga09592_197745_c1_489_1634 319
556 3300050509 nmdc:mga0qj67_53175_c1 nmdc:mga0qj67_53175_c1_1635_2780 319
557 3300031852 Ga0307410_10027657 Ga0307410_100276572 320
558 3300032004 Ga0307414_10025192 Ga0307414_100251922 320
559 3300032005 Ga0307411_10007734 Ga0307411_100077345 320
560 3300026041 Ga0207639_10056943 Ga0207639_100569433 321
561 3300046511 Ga0495608_0062335 Ga0495608_0062335_275_1408 321
562 3300006852 Ga0075433_10013426 Ga0075433_100134263 322
563 3300006871 Ga0075434_100012135 Ga0075434_1000121359 322
564 3300009147 Ga0114129_10075335 Ga0114129_100753352 322
565 3300035086 Ga0373934_0004878 Ga0373934_0004878_847_1980 322
566 3300035120 Ga0373957_0038499 Ga0373957_0038499_98_1231 322
567 3300036401 Ga0373937_0005107 Ga0373937_0005107_8613_9746 322
568 3300046477 Ga0495664_0012098 Ga0495664_0012098_684_1817 322
569 3300046516 Ga0495628_0018170 Ga0495628_0018170_1380_2513 322
570 3300046529 Ga0495652_0018708 Ga0495652_0018708_1714_2847 322
571 3300046536 Ga0495587_0015658 Ga0495587_0015658_1965_3098 322
572 3300046543 Ga0495645_0028533 Ga0495645_0028533_977_2110 322
573 3300046678 Ga0495599_0000646 Ga0495599_0000646_6258_7391 322
574 3300046680 Ga0495646_0086317 Ga0495646_0086317_225_1358 322
575 3300047317 Ga0495604_0006036 Ga0495604_0006036_3201_4334 322
576 3300047444 Ga0495675_0008607 Ga0495675_0008607_1497_2630 322
577 3300047471 Ga0495684_0005686 Ga0495684_0005686_6938_8071 322
578 3300050507 nmdc:mga05p37_58807_c1 nmdc:mga05p37_58807_c1_3149_4300 322
579 3300050512 nmdc:mga0n895_8015_c1 nmdc:mga0n895_8015_c1_1322_2473 322
580 3300050515 nmdc:mga0a205_4663_c2 nmdc:mga0a205_4663_c2_7098_8249 322
581 3300053077 Ga0495601_0046087 Ga0495601_0046087_972_2105 322
582 3300053078 Ga0495612_0078174 Ga0495612_0078174_201_1334 322
583 3300053084 Ga0495595_0125096 Ga0495595_0125096_75_1208 322
584 3300006846 Ga0075430_100000259 Ga0075430_10000025919 323
585 3300050509 nmdc:mga0qj67_931_c1 nmdc:mga0qj67_931_c1_12564_13730 323
586 3300005329 Ga0070683_100000588 Ga0070683_10000058827 325
587 3300005459 Ga0068867_100093316 Ga0068867_1000933162 325
588 3300005535 Ga0070684_100037766 Ga0070684_1000377665 325
589 3300006844 Ga0075428_100031278 Ga0075428_1000312785 325
590 3300025937 Ga0207669_10193613 Ga0207669_101936132 325
591 3300025944 Ga0207661_10008476 Ga0207661_100084767 325
592 3300026089 Ga0207648_10017643 Ga0207648_100176434 325
593 3300049570 Ga0501033_0009596 Ga0501033_0009596_5351_6484 325
594 3300049823 Ga0501044_0002752 Ga0501044_0002752_5351_6484 325
595 3300009176 Ga0105242_10132940 Ga0105242_101329402 326
596 3300005614 Ga0068856_100010080 Ga0068856_1000100808 327
597 3300026078 Ga0207702_10031714 Ga0207702_100317144 327
598 3300047444 Ga0495675_0005499 Ga0495675_0005499_774_1907 328
599 3300005445 Ga0070708_100000006 Ga0070708_10000000697 329
600 3300005530 Ga0070679_100389496 Ga0070679_1003894961 329
601 3300035086 Ga0373934_0059671 Ga0373934_0059671_213_1346 329
602 3300035119 Ga0373956_0010255 Ga0373956_0010255_1471_2604 329
603 3300035120 Ga0373957_0089798 Ga0373957_0089798_32_1174 329
604 3300035172 Ga0373955_0004323 Ga0373955_0004323_3695_4828 329
605 3300035724 Ga0373933_0004718 Ga0373933_0004718_5074_6207 329
606 3300036401 Ga0373937_0003528 Ga0373937_0003528_5656_6789 329
607 3300046462 Ga0495651_0083453 Ga0495651_0083453_1045_2178 329
608 3300046536 Ga0495587_0002876 Ga0495587_0002876_437_1570 329
609 3300046543 Ga0495645_0000316 Ga0495645_0000316_28443_29576 329
610 3300046559 Ga0495667_0108423 Ga0495667_0108423_571_1704 329
611 3300046678 Ga0495599_0024374 Ga0495599_0024374_2173_3306 329
612 3300049581 Ga0501047_0026840 Ga0501047_0026840_1567_2700 329
613 3300003203 JGI25406J46586_10028962 JGI25406J46586_100289622 334
614 3300005985 Ga0081539_10000807 Ga0081539_100008073 334

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00226

DnaJ

DnaJ domain

9

71

0.99

PF01556

DnaJ_C

DnaJ C terminal domain

146

337

0.97

Feature Viewer

pLDDT pTM Quality
72.18 0.47 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map