F469366
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 614 | 273 | 614 | 316 |
Family's Representative Sequence
| Representative Sequence | 3300035120|Ga0373957_0089798|Ga0373957_0089798_32_1174 |
| Length | 359 |
| Sequence | LIDMAHTKDYYAVLGMPASATQDEIKKQYRKLAAKHHPDKNQNDPKAAERFKEISEAYQVLGDAEKRKQYDQMRQLGAFGGFGAPNTRRGPQPGGAPFGGPGGQSFRFEDLGDVGIGGLGDLFSSMFGGGTGGRARARGPERGQDVETQLTIPFRTAALGGKVPIELEVNEECATCHGSGAAPGAKVQTCPECQGRGTISFGQGGFAVPSEREMRVRKKMMITVPAGVDNGTKIRLKGQGGRGMRSGPPGDLLISFQVEPDRFFKREGLDVIAPVPINIAQATLGSKISVKALNGKRVAIKIPPGTASGKRFRVRGQGIIKDGQTGDLIVQVEVSVPEKLTEEQEKAMREFADASGLKY |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 37 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 52 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 54 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 55 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 57 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 58 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 59 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 60 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 61 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 62 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 63 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 64 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 65 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 66 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 67 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 72 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 73 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 74 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 75 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 76 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 77 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 78 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 79 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 167 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 170 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 171 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 172 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 173 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 174 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 175 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 176 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 177 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 178 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 179 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 180 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 181 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 182 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 183 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 184 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 185 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 186 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 187 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 188 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 189 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 190 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 191 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 192 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 193 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 194 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 195 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 196 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 197 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 198 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 199 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 200 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 201 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 202 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 203 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 204 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 205 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 206 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 207 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 208 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 209 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 243 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 244 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 245 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 246 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 247 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 248 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 249 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 250 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 251 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 252 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 257 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 260 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 261 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 272 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 273 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 3.75 |
| Rhizosphere | 96.09 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.16 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10028962 | 3300003203 | Bacteria | 2102 |
| 2 | Ga0070658_10002218 | 3300005327 | Bacteria | 16306 |
| 3 | Ga0070658_10015518 | 3300005327 | Bacteria | 6092 |
| 4 | Ga0070658_10022112 | 3300005327 | Bacteria | 5102 |
| 5 | Ga0070676_10005548 | 3300005328 | Bacteria | 6715 |
| 6 | Ga0070676_10062554 | 3300005328 | Bacteria | 2215 |
| 7 | Ga0070676_10067778 | 3300005328 | Unclassified | 2134 |
| 8 | Ga0070683_100000588 | 3300005329 | Bacteria | 25968 |
| 9 | Ga0070683_100007872 | 3300005329 | Bacteria | 9028 |
| 10 | Ga0070683_100010936 | 3300005329 | Bacteria | 7816 |
| 11 | Ga0070683_100014387 | 3300005329 | Bacteria | 6921 |
| 12 | Ga0070683_100050136 | 3300005329 | Bacteria | 3863 |
| 13 | Ga0070683_100112796 | 3300005329 | Bacteria | 2565 |
| 14 | Ga0070683_100123188 | 3300005329 | Bacteria | 2450 |
| 15 | Ga0070683_100123553 | 3300005329 | Bacteria | 2446 |
| 16 | Ga0070683_100297380 | 3300005329 | Bacteria | 1535 |
| 17 | Ga0070690_100172420 | 3300005330 | Unclassified | 1490 |
| 18 | Ga0070670_100002223 | 3300005331 | Bacteria | 15938 |
| 19 | Ga0070670_100006497 | 3300005331 | Bacteria | 9897 |
| 20 | Ga0070670_100014873 | 3300005331 | Bacteria | 6674 |
| 21 | Ga0068869_100007519 | 3300005334 | Bacteria | 6970 |
| 22 | Ga0068869_100014258 | 3300005334 | Bacteria | 5306 |
| 23 | Ga0070666_10090108 | 3300005335 | Bacteria | 2106 |
| 24 | Ga0070680_100000354 | 3300005336 | Bacteria | 30834 |
| 25 | Ga0070680_100000489 | 3300005336 | Bacteria | 27191 |
| 26 | Ga0070680_100023357 | 3300005336 | Bacteria | 4931 |
| 27 | Ga0070680_100026465 | 3300005336 | Bacteria | 4639 |
| 28 | Ga0070680_100040225 | 3300005336 | Bacteria | 3785 |
| 29 | Ga0070682_100000492 | 3300005337 | Bacteria | 24800 |
| 30 | Ga0070682_100008751 | 3300005337 | Bacteria | 5712 |
| 31 | Ga0070682_100009246 | 3300005337 | Bacteria | 5574 |
| 32 | Ga0068868_100019745 | 3300005338 | Bacteria | 5053 |
| 33 | Ga0068868_100143643 | 3300005338 | Unclassified | 1961 |
| 34 | Ga0070660_100009663 | 3300005339 | Bacteria | 6794 |
| 35 | Ga0070660_100061986 | 3300005339 | Unclassified | 2904 |
| 36 | Ga0070660_100107396 | 3300005339 | Bacteria | 2218 |
| 37 | Ga0070660_100140968 | 3300005339 | Bacteria | 1934 |
| 38 | Ga0070689_100000673 | 3300005340 | Bacteria | 20688 |
| 39 | Ga0070691_10039751 | 3300005341 | Bacteria | 2222 |
| 40 | Ga0070691_10051203 | 3300005341 | Unclassified | 1971 |
| 41 | Ga0070661_100001410 | 3300005344 | Bacteria | 16773 |
| 42 | Ga0070661_100008160 | 3300005344 | Bacteria | 7224 |
| 43 | Ga0070661_100015888 | 3300005344 | Bacteria | 5311 |
| 44 | Ga0070661_100077209 | 3300005344 | Bacteria | 2455 |
| 45 | Ga0070661_100118758 | 3300005344 | Bacteria | 1979 |
| 46 | Ga0070692_10011319 | 3300005345 | Bacteria | 4091 |
| 47 | Ga0070668_100031679 | 3300005347 | Bacteria | 4023 |
| 48 | Ga0070668_100040297 | 3300005347 | Bacteria | 3574 |
| 49 | Ga0070669_100005930 | 3300005353 | Bacteria | 8816 |
| 50 | Ga0070675_100003367 | 3300005354 | Bacteria | 12113 |
| 51 | Ga0070675_100014802 | 3300005354 | Bacteria | 6155 |
| 52 | Ga0070675_100027621 | 3300005354 | Bacteria | 4561 |
| 53 | Ga0070675_100064315 | 3300005354 | Bacteria | 3033 |
| 54 | Ga0070671_100016066 | 3300005355 | Bacteria | 6050 |
| 55 | Ga0070671_100059929 | 3300005355 | Bacteria | 3168 |
| 56 | Ga0070674_100023698 | 3300005356 | Bacteria | 3976 |
| 57 | Ga0070674_100122668 | 3300005356 | Bacteria | 1926 |
| 58 | Ga0070673_100089908 | 3300005364 | Bacteria | 2507 |
| 59 | Ga0070673_100166286 | 3300005364 | Bacteria | 1880 |
| 60 | Ga0070688_100005659 | 3300005365 | Bacteria | 6598 |
| 61 | Ga0070688_100006897 | 3300005365 | Bacteria | 6097 |
| 62 | Ga0070659_100013575 | 3300005366 | Bacteria | 6066 |
| 63 | Ga0070659_100023675 | 3300005366 | Bacteria | 4702 |
| 64 | Ga0070659_100025729 | 3300005366 | Bacteria | 4524 |
| 65 | Ga0070659_100044397 | 3300005366 | Unclassified | 3479 |
| 66 | Ga0070667_100004756 | 3300005367 | Bacteria | 11378 |
| 67 | Ga0070667_100039826 | 3300005367 | Bacteria | 3939 |
| 68 | Ga0070667_100239965 | 3300005367 | Unclassified | 1618 |
| 69 | Ga0070709_10155229 | 3300005434 | Bacteria | 1586 |
| 70 | Ga0070714_100001803 | 3300005435 | Bacteria | 15572 |
| 71 | Ga0070714_100074240 | 3300005435 | Bacteria | 2948 |
| 72 | Ga0070714_100136821 | 3300005435 | Bacteria | 2195 |
| 73 | Ga0070713_100006043 | 3300005436 | Bacteria | 8340 |
| 74 | Ga0070713_100320689 | 3300005436 | Bacteria | 1431 |
| 75 | Ga0070701_10009405 | 3300005438 | Bacteria | 4280 |
| 76 | Ga0070701_10027253 | 3300005438 | Bacteria | 2796 |
| 77 | Ga0070711_100053749 | 3300005439 | Unclassified | 2777 |
| 78 | Ga0070705_100062161 | 3300005440 | Unclassified | 2222 |
| 79 | Ga0070700_100008003 | 3300005441 | Bacteria | 5741 |
| 80 | Ga0070700_100160313 | 3300005441 | Bacteria | 1548 |
| 81 | Ga0070708_100000006 | 3300005445 | Bacteria | 150596 |
| 82 | Ga0070662_100006003 | 3300005457 | Bacteria | 7791 |
| 83 | Ga0070662_100008714 | 3300005457 | Bacteria | 6614 |
| 84 | Ga0070662_100049520 | 3300005457 | Bacteria | 3029 |
| 85 | Ga0070681_10001775 | 3300005458 | Bacteria | 19354 |
| 86 | Ga0070681_10014467 | 3300005458 | Bacteria | 7852 |
| 87 | Ga0070681_10039263 | 3300005458 | Bacteria | 4745 |
| 88 | Ga0070681_10053692 | 3300005458 | Bacteria | 4016 |
| 89 | Ga0068867_100005743 | 3300005459 | Bacteria | 8802 |
| 90 | Ga0068867_100093316 | 3300005459 | Bacteria | 2287 |
| 91 | Ga0068867_100155653 | 3300005459 | Bacteria | 1799 |
| 92 | Ga0070685_10169594 | 3300005466 | Bacteria | 1398 |
| 93 | Ga0070707_100015781 | 3300005468 | Bacteria | 7090 |
| 94 | Ga0070707_100024874 | 3300005468 | Bacteria | 5676 |
| 95 | Ga0070707_100098210 | 3300005468 | Bacteria | 2836 |
| 96 | Ga0070698_100001204 | 3300005471 | Bacteria | 28711 |
| 97 | Ga0070699_100020370 | 3300005518 | Bacteria | 5719 |
| 98 | Ga0070679_100000377 | 3300005530 | Bacteria | 37955 |
| 99 | Ga0070679_100001349 | 3300005530 | Bacteria | 21675 |
| 100 | Ga0070679_100003405 | 3300005530 | Bacteria | 14562 |
| 101 | Ga0070679_100011509 | 3300005530 | Bacteria | 8433 |
| 102 | Ga0070679_100047091 | 3300005530 | Bacteria | 4299 |
| 103 | Ga0070679_100099574 | 3300005530 | Bacteria | 2894 |
| 104 | Ga0070679_100102321 | 3300005530 | Bacteria | 2851 |
| 105 | Ga0070679_100173789 | 3300005530 | Bacteria | 2127 |
| 106 | Ga0070679_100177388 | 3300005530 | Unclassified | 2103 |
| 107 | Ga0070679_100389496 | 3300005530 | Bacteria | 1340 |
| 108 | Ga0070684_100006657 | 3300005535 | Bacteria | 8955 |
| 109 | Ga0070684_100022016 | 3300005535 | Bacteria | 5311 |
| 110 | Ga0070684_100037766 | 3300005535 | Unclassified | 4145 |
| 111 | Ga0070684_100055243 | 3300005535 | Unclassified | 3461 |
| 112 | Ga0070684_100109119 | 3300005535 | Unclassified | 2480 |
| 113 | Ga0070684_100129102 | 3300005535 | Bacteria | 2279 |
| 114 | Ga0070684_100131382 | 3300005535 | Bacteria | 2259 |
| 115 | Ga0070697_100052219 | 3300005536 | Bacteria | 3321 |
| 116 | Ga0068853_100027500 | 3300005539 | Bacteria | 4777 |
| 117 | Ga0068853_100084207 | 3300005539 | Unclassified | 2786 |
| 118 | Ga0070672_100001468 | 3300005543 | Bacteria | 14631 |
| 119 | Ga0070672_100139336 | 3300005543 | Bacteria | 2000 |
| 120 | Ga0070672_100234117 | 3300005543 | Bacteria | 1544 |
| 121 | Ga0070686_100052044 | 3300005544 | Bacteria | 2609 |
| 122 | Ga0070686_100060968 | 3300005544 | Bacteria | 2436 |
| 123 | Ga0070695_100007270 | 3300005545 | Bacteria | 6564 |
| 124 | Ga0070695_100187528 | 3300005545 | Bacteria | 1470 |
| 125 | Ga0070696_100000840 | 3300005546 | Bacteria | 19805 |
| 126 | Ga0070693_100001820 | 3300005547 | Bacteria | 9735 |
| 127 | Ga0070704_100112891 | 3300005549 | Bacteria | 2071 |
| 128 | Ga0068855_100005805 | 3300005563 | Bacteria | 15061 |
| 129 | Ga0068855_100007038 | 3300005563 | Bacteria | 13645 |
| 130 | Ga0068855_100040846 | 3300005563 | Bacteria | 5501 |
| 131 | Ga0070664_100010981 | 3300005564 | Bacteria | 7343 |
| 132 | Ga0070664_100074485 | 3300005564 | Bacteria | 2914 |
| 133 | Ga0070664_100081297 | 3300005564 | Bacteria | 2792 |
| 134 | Ga0070664_100207803 | 3300005564 | Bacteria | 1749 |
| 135 | Ga0068857_100002342 | 3300005577 | Bacteria | 15418 |
| 136 | Ga0068857_100009827 | 3300005577 | Bacteria | 8312 |
| 137 | Ga0068857_100013425 | 3300005577 | Bacteria | 7136 |
| 138 | Ga0068857_100028111 | 3300005577 | Bacteria | 4961 |
| 139 | Ga0068857_100155119 | 3300005577 | Bacteria | 2076 |
| 140 | Ga0068856_100010080 | 3300005614 | Bacteria | 9184 |
| 141 | Ga0068856_100232264 | 3300005614 | Unclassified | 1860 |
| 142 | Ga0070702_100006540 | 3300005615 | Bacteria | 5525 |
| 143 | Ga0070702_100066811 | 3300005615 | Bacteria | 2110 |
| 144 | Ga0068852_100005268 | 3300005616 | Bacteria | 9231 |
| 145 | Ga0068852_100020184 | 3300005616 | Bacteria | 5294 |
| 146 | Ga0068852_100178355 | 3300005616 | Unclassified | 1996 |
| 147 | Ga0068859_100015924 | 3300005617 | Bacteria | 7557 |
| 148 | Ga0068859_100059864 | 3300005617 | Bacteria | 3837 |
| 149 | Ga0068859_100100097 | 3300005617 | Unclassified | 2954 |
| 150 | Ga0068859_100177602 | 3300005617 | Bacteria | 2211 |
| 151 | Ga0068864_100040252 | 3300005618 | Bacteria | 3998 |
| 152 | Ga0068864_100216015 | 3300005618 | Unclassified | 1767 |
| 153 | Ga0068861_100003887 | 3300005719 | Bacteria | 9986 |
| 154 | Ga0068861_100372789 | 3300005719 | Bacteria | 1258 |
| 155 | Ga0068851_10007015 | 3300005834 | Bacteria | 5166 |
| 156 | Ga0068851_10022841 | 3300005834 | Bacteria | 3053 |
| 157 | Ga0068870_10003341 | 3300005840 | Bacteria | 6783 |
| 158 | Ga0068870_10078785 | 3300005840 | Unclassified | 1816 |
| 159 | Ga0068863_100008812 | 3300005841 | Bacteria | 9850 |
| 160 | Ga0068863_100029541 | 3300005841 | Bacteria | 5232 |
| 161 | Ga0068858_100311697 | 3300005842 | Unclassified | 1503 |
| 162 | Ga0068860_100009628 | 3300005843 | Bacteria | 9602 |
| 163 | Ga0068860_100098780 | 3300005843 | Bacteria | 2784 |
| 164 | Ga0068860_100134683 | 3300005843 | Bacteria | 2372 |
| 165 | Ga0068862_100000800 | 3300005844 | Bacteria | 31194 |
| 166 | Ga0068862_100004451 | 3300005844 | Bacteria | 11820 |
| 167 | Ga0081539_10000807 | 3300005985 | Bacteria | 60932 |
| 168 | Ga0070717_10084592 | 3300006028 | Bacteria | 2668 |
| 169 | Ga0070716_100139807 | 3300006173 | Bacteria | 1542 |
| 170 | Ga0070712_100011778 | 3300006175 | Bacteria | 5558 |
| 171 | Ga0070712_100073409 | 3300006175 | Bacteria | 2454 |
| 172 | Ga0097621_100014901 | 3300006237 | Bacteria | 5833 |
| 173 | Ga0097621_100147925 | 3300006237 | Bacteria | 2013 |
| 174 | Ga0068871_100150589 | 3300006358 | Bacteria | 1984 |
| 175 | Ga0075428_100031278 | 3300006844 | Bacteria | 5886 |
| 176 | Ga0075430_100000259 | 3300006846 | Bacteria | 37106 |
| 177 | Ga0075430_100011415 | 3300006846 | Bacteria | 7542 |
| 178 | Ga0075430_100020317 | 3300006846 | Bacteria | 5650 |
| 179 | Ga0075430_100115482 | 3300006846 | Unclassified | 2237 |
| 180 | Ga0075431_100007854 | 3300006847 | Bacteria | 10632 |
| 181 | Ga0075431_100012683 | 3300006847 | Bacteria | 8510 |
| 182 | Ga0075431_100066919 | 3300006847 | Bacteria | 3709 |
| 183 | Ga0075433_10013426 | 3300006852 | Bacteria | 6660 |
| 184 | Ga0075433_10069541 | 3300006852 | Bacteria | 3092 |
| 185 | Ga0075434_100012135 | 3300006871 | Bacteria | 8159 |
| 186 | Ga0075434_100051238 | 3300006871 | Bacteria | 4102 |
| 187 | Ga0075429_100020869 | 3300006880 | Bacteria | 5685 |
| 188 | Ga0075429_100102583 | 3300006880 | Bacteria | 2497 |
| 189 | Ga0068865_100002221 | 3300006881 | Bacteria | 11435 |
| 190 | Ga0068865_100006993 | 3300006881 | Bacteria | 6921 |
| 191 | Ga0097620_100015924 | 3300006931 | Bacteria | 7557 |
| 192 | Ga0097620_100059864 | 3300006931 | Bacteria | 3837 |
| 193 | Ga0097620_100100094 | 3300006931 | Unclassified | 2954 |
| 194 | Ga0097620_100177603 | 3300006931 | Bacteria | 2211 |
| 195 | Ga0105240_10178962 | 3300009093 | Unclassified | 2504 |
| 196 | Ga0105240_10296239 | 3300009093 | Unclassified | 1852 |
| 197 | Ga0111539_10034308 | 3300009094 | Bacteria | 6154 |
| 198 | Ga0111539_10095429 | 3300009094 | Bacteria | 3493 |
| 199 | Ga0111539_10220190 | 3300009094 | Bacteria | 2211 |
| 200 | Ga0111539_10240307 | 3300009094 | Bacteria | 2108 |
| 201 | Ga0111539_10244997 | 3300009094 | Bacteria | 2087 |
| 202 | Ga0111539_10465776 | 3300009094 | Bacteria | 1471 |
| 203 | Ga0105245_10016180 | 3300009098 | Bacteria | 6500 |
| 204 | Ga0105245_10019525 | 3300009098 | Bacteria | 5937 |
| 205 | Ga0105245_10070600 | 3300009098 | Unclassified | 3170 |
| 206 | Ga0114129_10006750 | 3300009147 | Bacteria | 16297 |
| 207 | Ga0114129_10021186 | 3300009147 | Bacteria | 9232 |
| 208 | Ga0114129_10075335 | 3300009147 | Bacteria | 4699 |
| 209 | Ga0105243_10095997 | 3300009148 | Unclassified | 2451 |
| 210 | Ga0105243_10098932 | 3300009148 | Bacteria | 2417 |
| 211 | Ga0105241_10028241 | 3300009174 | Bacteria | 4181 |
| 212 | Ga0105242_10002665 | 3300009176 | Bacteria | 13989 |
| 213 | Ga0105242_10003515 | 3300009176 | Bacteria | 12176 |
| 214 | Ga0105242_10132940 | 3300009176 | Bacteria | 2150 |
| 215 | Ga0105242_10143293 | 3300009176 | Unclassified | 2076 |
| 216 | Ga0105248_10021390 | 3300009177 | Bacteria | 7167 |
| 217 | Ga0105248_10024300 | 3300009177 | Bacteria | 6738 |
| 218 | Ga0105248_10027659 | 3300009177 | Bacteria | 6316 |
| 219 | Ga0105248_10094795 | 3300009177 | Bacteria | 3360 |
| 220 | Ga0105248_10156800 | 3300009177 | Bacteria | 2569 |
| 221 | Ga0105237_10055922 | 3300009545 | Bacteria | 3951 |
| 222 | Ga0105237_10280336 | 3300009545 | Bacteria | 1669 |
| 223 | Ga0105238_10036819 | 3300009551 | Bacteria | 4975 |
| 224 | Ga0105249_10000131 | 3300009553 | Bacteria | 99448 |
| 225 | Ga0105249_10007249 | 3300009553 | Bacteria | 9672 |
| 226 | Ga0105239_10007696 | 3300010375 | Bacteria | 12337 |
| 227 | Ga0105239_10066794 | 3300010375 | Unclassified | 3950 |
| 228 | Ga0105239_10198360 | 3300010375 | Bacteria | 2248 |
| 229 | Ga0105246_10002055 | 3300011119 | Bacteria | 12134 |
| 230 | Ga0157373_10007545 | 3300013100 | Bacteria | 8086 |
| 231 | Ga0157373_10062445 | 3300013100 | Unclassified | 2639 |
| 232 | Ga0157371_10008559 | 3300013102 | Bacteria | 8139 |
| 233 | Ga0157371_10080852 | 3300013102 | Unclassified | 2301 |
| 234 | Ga0157370_10004041 | 3300013104 | Bacteria | 17036 |
| 235 | Ga0157369_10006735 | 3300013105 | Bacteria | 13258 |
| 236 | Ga0157369_10009491 | 3300013105 | Bacteria | 11124 |
| 237 | Ga0157369_10423626 | 3300013105 | Bacteria | 1380 |
| 238 | Ga0157374_10063722 | 3300013296 | Unclassified | 3458 |
| 239 | Ga0157378_10014701 | 3300013297 | Bacteria | 6857 |
| 240 | Ga0157378_10238440 | 3300013297 | Bacteria | 1736 |
| 241 | Ga0163162_10005364 | 3300013306 | Bacteria | 12375 |
| 242 | Ga0163162_10042337 | 3300013306 | Bacteria | 4558 |
| 243 | Ga0163162_10118948 | 3300013306 | Bacteria | 2744 |
| 244 | Ga0163162_10126037 | 3300013306 | Bacteria | 2667 |
| 245 | Ga0163162_10135773 | 3300013306 | Bacteria | 2571 |
| 246 | Ga0163162_10462887 | 3300013306 | Bacteria | 1400 |
| 247 | Ga0157372_10003116 | 3300013307 | Bacteria | 17881 |
| 248 | Ga0157372_10006551 | 3300013307 | Bacteria | 12388 |
| 249 | Ga0157372_10099810 | 3300013307 | Unclassified | 3312 |
| 250 | Ga0157372_10338733 | 3300013307 | Bacteria | 1752 |
| 251 | Ga0157372_10448677 | 3300013307 | Unclassified | 1503 |
| 252 | Ga0157375_10006108 | 3300013308 | Bacteria | 10498 |
| 253 | Ga0157375_10011285 | 3300013308 | Bacteria | 7888 |
| 254 | Ga0157375_10021245 | 3300013308 | Bacteria | 5948 |
| 255 | Ga0157375_10103854 | 3300013308 | Bacteria | 2929 |
| 256 | Ga0157375_10337410 | 3300013308 | Bacteria | 1672 |
| 257 | Ga0163163_10084033 | 3300014325 | Bacteria | 3189 |
| 258 | Ga0157380_10004528 | 3300014326 | Bacteria | 9645 |
| 259 | Ga0157377_10008970 | 3300014745 | Bacteria | 4896 |
| 260 | Ga0157379_10000965 | 3300014968 | Bacteria | 23357 |
| 261 | Ga0157376_10023306 | 3300014969 | Bacteria | 4842 |
| 262 | Ga0207697_10002065 | 3300025315 | Bacteria | 10576 |
| 263 | Ga0207656_10044004 | 3300025321 | Bacteria | 1905 |
| 264 | Ga0207642_10113519 | 3300025899 | Bacteria | 1384 |
| 265 | Ga0207680_10096221 | 3300025903 | Bacteria | 1894 |
| 266 | Ga0207699_10035209 | 3300025906 | Bacteria | 2847 |
| 267 | Ga0207645_10001564 | 3300025907 | Bacteria | 18705 |
| 268 | Ga0207645_10010773 | 3300025907 | Bacteria | 6268 |
| 269 | Ga0207645_10084523 | 3300025907 | Unclassified | 2037 |
| 270 | Ga0207643_10002102 | 3300025908 | Bacteria | 10975 |
| 271 | Ga0207643_10007907 | 3300025908 | Bacteria | 5706 |
| 272 | Ga0207643_10020933 | 3300025908 | Bacteria | 3590 |
| 273 | Ga0207643_10062594 | 3300025908 | Unclassified | 2126 |
| 274 | Ga0207643_10081472 | 3300025908 | Unclassified | 1876 |
| 275 | Ga0207705_10005895 | 3300025909 | Bacteria | 9109 |
| 276 | Ga0207654_10029751 | 3300025911 | Unclassified | 2993 |
| 277 | Ga0207707_10002464 | 3300025912 | Bacteria | 16657 |
| 278 | Ga0207707_10002809 | 3300025912 | Bacteria | 15531 |
| 279 | Ga0207707_10006733 | 3300025912 | Bacteria | 10033 |
| 280 | Ga0207707_10008243 | 3300025912 | Bacteria | 9046 |
| 281 | Ga0207707_10013189 | 3300025912 | Bacteria | 7205 |
| 282 | Ga0207707_10020108 | 3300025912 | Bacteria | 5827 |
| 283 | Ga0207707_10054644 | 3300025912 | Unclassified | 3476 |
| 284 | Ga0207695_10037328 | 3300025913 | Bacteria | 5243 |
| 285 | Ga0207671_10110096 | 3300025914 | Unclassified | 2095 |
| 286 | Ga0207693_10019977 | 3300025915 | Bacteria | 5328 |
| 287 | Ga0207693_10262703 | 3300025915 | Bacteria | 1353 |
| 288 | Ga0207663_10083442 | 3300025916 | Bacteria | 2099 |
| 289 | Ga0207660_10000027 | 3300025917 | Bacteria | 68840 |
| 290 | Ga0207660_10052342 | 3300025917 | Bacteria | 2906 |
| 291 | Ga0207662_10001820 | 3300025918 | Bacteria | 10470 |
| 292 | Ga0207662_10048640 | 3300025918 | Bacteria | 2513 |
| 293 | Ga0207662_10049712 | 3300025918 | Bacteria | 2488 |
| 294 | Ga0207657_10001987 | 3300025919 | Bacteria | 22084 |
| 295 | Ga0207657_10059375 | 3300025919 | Bacteria | 3286 |
| 296 | Ga0207657_10291048 | 3300025919 | Bacteria | 1295 |
| 297 | Ga0207649_10004071 | 3300025920 | Bacteria | 7957 |
| 298 | Ga0207649_10008386 | 3300025920 | Bacteria | 5632 |
| 299 | Ga0207649_10060588 | 3300025920 | Bacteria | 2379 |
| 300 | Ga0207649_10071271 | 3300025920 | Unclassified | 2219 |
| 301 | Ga0207652_10006228 | 3300025921 | Bacteria | 9635 |
| 302 | Ga0207652_10021261 | 3300025921 | Bacteria | 5354 |
| 303 | Ga0207652_10043947 | 3300025921 | Bacteria | 3805 |
| 304 | Ga0207652_10057977 | 3300025921 | Unclassified | 3336 |
| 305 | Ga0207652_10107395 | 3300025921 | Bacteria | 2472 |
| 306 | Ga0207652_10157487 | 3300025921 | Unclassified | 2035 |
| 307 | Ga0207652_10257756 | 3300025921 | Bacteria | 1573 |
| 308 | Ga0207646_10020564 | 3300025922 | Bacteria | 6114 |
| 309 | Ga0207646_10064178 | 3300025922 | Unclassified | 3278 |
| 310 | Ga0207681_10002224 | 3300025923 | Bacteria | 12341 |
| 311 | Ga0207681_10002478 | 3300025923 | Bacteria | 11713 |
| 312 | Ga0207681_10008973 | 3300025923 | Bacteria | 6107 |
| 313 | Ga0207681_10255181 | 3300025923 | Unclassified | 1371 |
| 314 | Ga0207694_10254674 | 3300025924 | Unclassified | 1437 |
| 315 | Ga0207650_10005419 | 3300025925 | Bacteria | 8707 |
| 316 | Ga0207650_10007569 | 3300025925 | Bacteria | 7403 |
| 317 | Ga0207659_10003670 | 3300025926 | Bacteria | 9250 |
| 318 | Ga0207659_10004848 | 3300025926 | Bacteria | 8152 |
| 319 | Ga0207659_10321075 | 3300025926 | Unclassified | 1277 |
| 320 | Ga0207687_10013206 | 3300025927 | Bacteria | 5395 |
| 321 | Ga0207687_10044874 | 3300025927 | Bacteria | 3053 |
| 322 | Ga0207687_10116289 | 3300025927 | Bacteria | 1993 |
| 323 | Ga0207700_10033091 | 3300025928 | Bacteria | 3696 |
| 324 | Ga0207664_10027237 | 3300025929 | Bacteria | 4331 |
| 325 | Ga0207664_10054702 | 3300025929 | Bacteria | 3164 |
| 326 | Ga0207664_10118955 | 3300025929 | Bacteria | 2208 |
| 327 | Ga0207644_10007827 | 3300025931 | Bacteria | 6982 |
| 328 | Ga0207644_10095893 | 3300025931 | Bacteria | 2219 |
| 329 | Ga0207690_10016616 | 3300025932 | Bacteria | 4482 |
| 330 | Ga0207690_10056537 | 3300025932 | Unclassified | 2647 |
| 331 | Ga0207690_10105294 | 3300025932 | Bacteria | 2023 |
| 332 | Ga0207706_10001172 | 3300025933 | Bacteria | 26572 |
| 333 | Ga0207706_10001727 | 3300025933 | Bacteria | 21522 |
| 334 | Ga0207706_10030971 | 3300025933 | Bacteria | 4769 |
| 335 | Ga0207706_10054081 | 3300025933 | Bacteria | 3543 |
| 336 | Ga0207706_10160860 | 3300025933 | Unclassified | 1974 |
| 337 | Ga0207686_10086885 | 3300025934 | Unclassified | 2055 |
| 338 | Ga0207686_10087241 | 3300025934 | Bacteria | 2052 |
| 339 | Ga0207709_10050412 | 3300025935 | Bacteria | 2546 |
| 340 | Ga0207670_10014841 | 3300025936 | Bacteria | 4637 |
| 341 | Ga0207670_10031206 | 3300025936 | Bacteria | 3412 |
| 342 | Ga0207669_10064686 | 3300025937 | Unclassified | 2265 |
| 343 | Ga0207669_10193613 | 3300025937 | Unclassified | 1469 |
| 344 | Ga0207704_10129567 | 3300025938 | Bacteria | 1744 |
| 345 | Ga0207665_10201970 | 3300025939 | Bacteria | 1449 |
| 346 | Ga0207691_10000638 | 3300025940 | Bacteria | 34615 |
| 347 | Ga0207691_10000761 | 3300025940 | Bacteria | 31887 |
| 348 | Ga0207691_10005766 | 3300025940 | Bacteria | 11987 |
| 349 | Ga0207691_10010422 | 3300025940 | Bacteria | 8920 |
| 350 | Ga0207691_10095316 | 3300025940 | Bacteria | 2662 |
| 351 | Ga0207691_10101075 | 3300025940 | Bacteria | 2573 |
| 352 | Ga0207691_10195316 | 3300025940 | Bacteria | 1763 |
| 353 | Ga0207711_10017100 | 3300025941 | Bacteria | 6024 |
| 354 | Ga0207711_10027868 | 3300025941 | Bacteria | 4748 |
| 355 | Ga0207711_10046092 | 3300025941 | Bacteria | 3725 |
| 356 | Ga0207711_10061730 | 3300025941 | Bacteria | 3231 |
| 357 | Ga0207711_10246015 | 3300025941 | Unclassified | 1641 |
| 358 | Ga0207689_10002056 | 3300025942 | Bacteria | 18990 |
| 359 | Ga0207689_10003790 | 3300025942 | Bacteria | 13776 |
| 360 | Ga0207661_10007529 | 3300025944 | Bacteria | 7744 |
| 361 | Ga0207661_10008476 | 3300025944 | Bacteria | 7350 |
| 362 | Ga0207661_10011257 | 3300025944 | Bacteria | 6474 |
| 363 | Ga0207661_10037718 | 3300025944 | Bacteria | 3782 |
| 364 | Ga0207661_10172498 | 3300025944 | Bacteria | 1883 |
| 365 | Ga0207661_10183135 | 3300025944 | Bacteria | 1831 |
| 366 | Ga0207679_10005509 | 3300025945 | Bacteria | 7932 |
| 367 | Ga0207679_10043833 | 3300025945 | Bacteria | 3224 |
| 368 | Ga0207679_10047652 | 3300025945 | Bacteria | 3115 |
| 369 | Ga0207679_10094610 | 3300025945 | Bacteria | 2320 |
| 370 | Ga0207667_10034783 | 3300025949 | Bacteria | 5408 |
| 371 | Ga0207667_10130531 | 3300025949 | Unclassified | 2588 |
| 372 | Ga0207651_10061880 | 3300025960 | Bacteria | 2606 |
| 373 | Ga0207712_10014017 | 3300025961 | Bacteria | 5145 |
| 374 | Ga0207712_10014341 | 3300025961 | Bacteria | 5097 |
| 375 | Ga0207668_10016237 | 3300025972 | Bacteria | 4643 |
| 376 | Ga0207668_10239798 | 3300025972 | Bacteria | 1466 |
| 377 | Ga0207658_10027985 | 3300025986 | Bacteria | 3966 |
| 378 | Ga0207658_10087090 | 3300025986 | Bacteria | 2411 |
| 379 | Ga0207658_10156360 | 3300025986 | Bacteria | 1864 |
| 380 | Ga0207677_10026811 | 3300026023 | Bacteria | 3619 |
| 381 | Ga0207703_10004720 | 3300026035 | Bacteria | 11120 |
| 382 | Ga0207639_10056943 | 3300026041 | Bacteria | 2998 |
| 383 | Ga0207639_10073917 | 3300026041 | Bacteria | 2674 |
| 384 | Ga0207678_10014153 | 3300026067 | Bacteria | 7013 |
| 385 | Ga0207678_10113869 | 3300026067 | Bacteria | 2308 |
| 386 | Ga0207678_10300489 | 3300026067 | Bacteria | 1379 |
| 387 | Ga0207708_10042376 | 3300026075 | Bacteria | 3470 |
| 388 | Ga0207708_10063356 | 3300026075 | Bacteria | 2824 |
| 389 | Ga0207708_10092301 | 3300026075 | Bacteria | 2336 |
| 390 | Ga0207702_10018881 | 3300026078 | Bacteria | 5703 |
| 391 | Ga0207702_10031714 | 3300026078 | Bacteria | 4405 |
| 392 | Ga0207641_10020169 | 3300026088 | Bacteria | 5472 |
| 393 | Ga0207641_10022683 | 3300026088 | Bacteria | 5167 |
| 394 | Ga0207648_10014800 | 3300026089 | Bacteria | 7198 |
| 395 | Ga0207648_10016629 | 3300026089 | Bacteria | 6715 |
| 396 | Ga0207648_10017643 | 3300026089 | Bacteria | 6483 |
| 397 | Ga0207676_10079245 | 3300026095 | Bacteria | 2663 |
| 398 | Ga0207674_10000208 | 3300026116 | Bacteria | 72594 |
| 399 | Ga0207674_10011064 | 3300026116 | Bacteria | 10146 |
| 400 | Ga0207674_10018952 | 3300026116 | Bacteria | 7460 |
| 401 | Ga0207674_10020881 | 3300026116 | Bacteria | 7066 |
| 402 | Ga0207674_10038096 | 3300026116 | Bacteria | 4996 |
| 403 | Ga0207674_10123235 | 3300026116 | Bacteria | 2558 |
| 404 | Ga0207674_10159922 | 3300026116 | Bacteria | 2207 |
| 405 | Ga0207675_100003791 | 3300026118 | Bacteria | 14722 |
| 406 | Ga0207683_10258525 | 3300026121 | Bacteria | 1590 |
| 407 | Ga0207698_10025723 | 3300026142 | Bacteria | 4152 |
| 408 | Ga0207698_10190767 | 3300026142 | Bacteria | 1825 |
| 409 | Ga0207698_10214030 | 3300026142 | Bacteria | 1736 |
| 410 | Ga0207428_10103782 | 3300027907 | Bacteria | 2194 |
| 411 | Ga0207428_10119856 | 3300027907 | Bacteria | 2018 |
| 412 | Ga0268265_10005142 | 3300028380 | Bacteria | 8958 |
| 413 | Ga0268265_10007327 | 3300028380 | Bacteria | 7447 |
| 414 | Ga0268265_10020036 | 3300028380 | Bacteria | 4662 |
| 415 | Ga0268265_10036233 | 3300028380 | Bacteria | 3613 |
| 416 | Ga0268264_10010283 | 3300028381 | Bacteria | 7746 |
| 417 | Ga0268264_10063710 | 3300028381 | Bacteria | 3100 |
| 418 | Ga0268264_10231499 | 3300028381 | Bacteria | 1707 |
| 419 | Ga0307408_100009869 | 3300031548 | Bacteria | 6293 |
| 420 | Ga0307408_100012846 | 3300031548 | Bacteria | 5553 |
| 421 | Ga0307408_100082073 | 3300031548 | Bacteria | 2412 |
| 422 | Ga0307408_100244337 | 3300031548 | Unclassified | 1477 |
| 423 | Ga0307405_10004685 | 3300031731 | Bacteria | 6504 |
| 424 | Ga0307405_10031029 | 3300031731 | Bacteria | 3141 |
| 425 | Ga0307413_10000384 | 3300031824 | Bacteria | 14117 |
| 426 | Ga0307413_10004902 | 3300031824 | Bacteria | 5890 |
| 427 | Ga0307413_10041492 | 3300031824 | Bacteria | 2695 |
| 428 | Ga0307413_10046201 | 3300031824 | Bacteria | 2587 |
| 429 | Ga0307413_10053408 | 3300031824 | Bacteria | 2446 |
| 430 | Ga0307410_10001224 | 3300031852 | Bacteria | 11400 |
| 431 | Ga0307410_10011172 | 3300031852 | Archaea | 5122 |
| 432 | Ga0307410_10027657 | 3300031852 | Bacteria | 3587 |
| 433 | Ga0307410_10029421 | 3300031852 | Bacteria | 3498 |
| 434 | Ga0307410_10065170 | 3300031852 | Bacteria | 2505 |
| 435 | Ga0307406_10158389 | 3300031901 | Bacteria | 1624 |
| 436 | Ga0307407_10002241 | 3300031903 | Bacteria | 7471 |
| 437 | Ga0307407_10003959 | 3300031903 | Bacteria | 6186 |
| 438 | Ga0307407_10163728 | 3300031903 | Bacteria | 1458 |
| 439 | Ga0307412_10028465 | 3300031911 | Bacteria | 3496 |
| 440 | Ga0307412_10050356 | 3300031911 | Unclassified | 2748 |
| 441 | Ga0307409_100005851 | 3300031995 | Bacteria | 7141 |
| 442 | Ga0307409_100122242 | 3300031995 | Bacteria | 2207 |
| 443 | Ga0307409_100217842 | 3300031995 | Bacteria | 1721 |
| 444 | Ga0307416_100000541 | 3300032002 | Bacteria | 19240 |
| 445 | Ga0307416_100002606 | 3300032002 | Bacteria | 10414 |
| 446 | Ga0307416_100008974 | 3300032002 | Bacteria | 6502 |
| 447 | Ga0307416_100084627 | 3300032002 | Bacteria | 2696 |
| 448 | Ga0307416_100095237 | 3300032002 | Bacteria | 2570 |
| 449 | Ga0307416_100162302 | 3300032002 | Unclassified | 2067 |
| 450 | Ga0307414_10022563 | 3300032004 | Bacteria | 3974 |
| 451 | Ga0307414_10025192 | 3300032004 | Bacteria | 3806 |
| 452 | Ga0307414_10100190 | 3300032004 | Unclassified | 2178 |
| 453 | Ga0307411_10001294 | 3300032005 | Bacteria | 10050 |
| 454 | Ga0307411_10002798 | 3300032005 | Bacteria | 7857 |
| 455 | Ga0307411_10004205 | 3300032005 | Bacteria | 6844 |
| 456 | Ga0307411_10007734 | 3300032005 | Bacteria | 5506 |
| 457 | Ga0307411_10082541 | 3300032005 | Bacteria | 2217 |
| 458 | Ga0307415_100000895 | 3300032126 | Bacteria | 13628 |
| 459 | Ga0307415_100048880 | 3300032126 | Bacteria | 2856 |
| 460 | Ga0307415_100058185 | 3300032126 | Bacteria | 2660 |
| 461 | Ga0307415_100084793 | 3300032126 | Bacteria | 2274 |
| 462 | Ga0373926_0002772 | 3300035083 | Bacteria | 5586 |
| 463 | Ga0373934_0004878 | 3300035086 | Bacteria | 4963 |
| 464 | Ga0373934_0059671 | 3300035086 | Bacteria | 1518 |
| 465 | Ga0373944_0004135 | 3300035089 | Unclassified | 3769 |
| 466 | Ga0373936_0013214 | 3300035113 | Bacteria | 3150 |
| 467 | Ga0373954_0057986 | 3300035118 | Bacteria | 1824 |
| 468 | Ga0373956_0010255 | 3300035119 | Bacteria | 3835 |
| 469 | Ga0373956_0018712 | 3300035119 | Bacteria | 2935 |
| 470 | Ga0373957_0038499 | 3300035120 | Bacteria | 1791 |
| 471 | Ga0373957_0089798 | 3300035120 | Unclassified | 1220 |
| 472 | Ga0373943_0002090 | 3300035170 | Bacteria | 9071 |
| 473 | Ga0373955_0004323 | 3300035172 | Bacteria | 6278 |
| 474 | Ga0373931_0125317 | 3300035691 | Bacteria | 1472 |
| 475 | Ga0373935_0002652 | 3300035692 | Bacteria | 10282 |
| 476 | Ga0373927_0001791 | 3300035695 | Bacteria | 16037 |
| 477 | Ga0373933_0004718 | 3300035724 | Bacteria | 7457 |
| 478 | Ga0373947_0000698 | 3300035725 | Bacteria | 20023 |
| 479 | Ga0373947_0018423 | 3300035725 | Bacteria | 4018 |
| 480 | Ga0373937_0003528 | 3300036401 | Bacteria | 13163 |
| 481 | Ga0373937_0005107 | 3300036401 | Bacteria | 11181 |
| 482 | Ga0373937_0043034 | 3300036401 | Bacteria | 4122 |
| 483 | Ga0373937_0114765 | 3300036401 | Bacteria | 2507 |
| 484 | Ga0373925_0003620 | 3300037068 | Bacteria | 11901 |
| 485 | Ga0373925_0019388 | 3300037068 | Bacteria | 4947 |
| 486 | Ga0373925_0082298 | 3300037068 | Bacteria | 2449 |
| 487 | Ga0395899_0024455 | 3300037312 | Bacteria | 4566 |
| 488 | Ga0395905_0005015 | 3300037471 | Bacteria | 13637 |
| 489 | Ga0395901_0004304 | 3300038443 | Bacteria | 14362 |
| 490 | Ga0436365_1313802 | 3300039437 | Bacteria | 1762 |
| 491 | Ga0439439_0002484 | 3300041406 | Bacteria | 3927 |
| 492 | Ga0439446_0025411 | 3300042156 | Unclassified | 1693 |
| 493 | Ga0439434_0006631 | 3300042435 | Bacteria | 3386 |
| 494 | Ga0451577_0000001 | 3300042876 | Bacteria | 2461803 |
| 495 | Ga0466966_0031762 | 3300044684 | Bacteria | 3424 |
| 496 | Ga0466959_0171968 | 3300045049 | Bacteria | 1519 |
| 497 | Ga0451576_0042270 | 3300045051 | Bacteria | 4812 |
| 498 | Ga0451576_0211027 | 3300045051 | Unclassified | 2028 |
| 499 | Ga0466967_0083237 | 3300045976 | Bacteria | 2893 |
| 500 | Ga0495629_0004819 | 3300046459 | Bacteria | 10121 |
| 501 | Ga0495629_0111905 | 3300046459 | Unclassified | 1903 |
| 502 | Ga0495629_0112747 | 3300046459 | Bacteria | 1896 |
| 503 | Ga0495651_0083453 | 3300046462 | Bacteria | 2409 |
| 504 | Ga0495580_0000874 | 3300046472 | Bacteria | 26072 |
| 505 | Ga0495580_0012607 | 3300046472 | Bacteria | 6480 |
| 506 | Ga0495580_0028823 | 3300046472 | Bacteria | 4034 |
| 507 | Ga0495582_0000142 | 3300046473 | Bacteria | 38514 |
| 508 | Ga0495639_0000663 | 3300046475 | Bacteria | 15927 |
| 509 | Ga0495664_0012098 | 3300046477 | Bacteria | 4881 |
| 510 | Ga0495594_0016573 | 3300046499 | Bacteria | 3885 |
| 511 | Ga0495594_0089037 | 3300046499 | Unclassified | 1728 |
| 512 | Ga0495594_0114643 | 3300046499 | Bacteria | 1521 |
| 513 | Ga0495608_0062335 | 3300046511 | Bacteria | 2450 |
| 514 | Ga0495628_0018170 | 3300046516 | Bacteria | 5831 |
| 515 | Ga0495630_0003191 | 3300046517 | Bacteria | 11401 |
| 516 | Ga0495630_0024540 | 3300046517 | Bacteria | 4457 |
| 517 | Ga0495630_0081562 | 3300046517 | Bacteria | 2441 |
| 518 | Ga0495663_0006558 | 3300046525 | Bacteria | 3212 |
| 519 | Ga0495652_0018708 | 3300046529 | Bacteria | 6174 |
| 520 | Ga0495665_0000009 | 3300046531 | Bacteria | 75094 |
| 521 | Ga0495665_0004906 | 3300046531 | Bacteria | 7211 |
| 522 | Ga0495640_0047471 | 3300046533 | Bacteria | 2972 |
| 523 | Ga0495586_0021906 | 3300046535 | Bacteria | 3410 |
| 524 | Ga0495587_0002876 | 3300046536 | Bacteria | 11533 |
| 525 | Ga0495587_0015658 | 3300046536 | Bacteria | 4730 |
| 526 | Ga0495621_0009880 | 3300046539 | Bacteria | 2911 |
| 527 | Ga0495645_0000316 | 3300046543 | Bacteria | 34637 |
| 528 | Ga0495645_0028533 | 3300046543 | Unclassified | 4056 |
| 529 | Ga0495667_0108423 | 3300046559 | Bacteria | 1794 |
| 530 | Ga0495635_0054946 | 3300046663 | Bacteria | 2743 |
| 531 | Ga0495588_0001281 | 3300046674 | Bacteria | 10768 |
| 532 | Ga0495599_0000646 | 3300046678 | Bacteria | 19723 |
| 533 | Ga0495599_0024374 | 3300046678 | Bacteria | 3784 |
| 534 | Ga0495623_0034978 | 3300046679 | Bacteria | 3221 |
| 535 | Ga0495646_0086317 | 3300046680 | Bacteria | 1820 |
| 536 | Ga0495658_0000131 | 3300046683 | Bacteria | 41245 |
| 537 | Ga0495658_0013031 | 3300046683 | Bacteria | 4226 |
| 538 | Ga0495581_0000366 | 3300047315 | Bacteria | 22649 |
| 539 | Ga0495581_0017214 | 3300047315 | Bacteria | 4200 |
| 540 | Ga0495581_0132429 | 3300047315 | Bacteria | 1453 |
| 541 | Ga0495604_0006036 | 3300047317 | Bacteria | 9613 |
| 542 | Ga0495674_0017454 | 3300047319 | Bacteria | 6678 |
| 543 | Ga0495675_0005499 | 3300047444 | Bacteria | 7730 |
| 544 | Ga0495675_0008607 | 3300047444 | Bacteria | 6326 |
| 545 | Ga0495685_054249 | 3300047447 | Bacteria | 1356 |
| 546 | Ga0495684_0005686 | 3300047471 | Bacteria | 9706 |
| 547 | Ga0495684_0015720 | 3300047471 | Bacteria | 5824 |
| 548 | Ga0495593_0000040 | 3300047673 | Bacteria | 52326 |
| 549 | Ga0495593_0079871 | 3300047673 | Bacteria | 1693 |
| 550 | Ga0495614_0002014 | 3300048089 | Bacteria | 8934 |
| 551 | Ga0496102_0290593 | 3300048905 | Bacteria | 1541 |
| 552 | Ga0496104_0014754 | 3300048907 | Bacteria | 7061 |
| 553 | Ga0496104_0117817 | 3300048907 | Unclassified | 2549 |
| 554 | Ga0496104_0166462 | 3300048907 | Bacteria | 2114 |
| 555 | Ga0496104_0219545 | 3300048907 | Unclassified | 1813 |
| 556 | Ga0496105_0084700 | 3300048908 | Bacteria | 2619 |
| 557 | Ga0496106_0130930 | 3300048909 | Unclassified | 1967 |
| 558 | Ga0496106_0187077 | 3300048909 | Bacteria | 1645 |
| 559 | Ga0496108_0038642 | 3300048911 | Bacteria | 3976 |
| 560 | Ga0496108_0146747 | 3300048911 | Unclassified | 2034 |
| 561 | Ga0496108_0160804 | 3300048911 | Bacteria | 1941 |
| 562 | Ga0496108_0271275 | 3300048911 | Bacteria | 1477 |
| 563 | Ga0496109_0060384 | 3300048912 | Bacteria | 3464 |
| 564 | Ga0496109_0343217 | 3300048912 | Unclassified | 1410 |
| 565 | Ga0496110_0004901 | 3300048913 | Bacteria | 10443 |
| 566 | Ga0496111_0003621 | 3300048914 | Bacteria | 9579 |
| 567 | Ga0496112_0006799 | 3300048915 | Bacteria | 10079 |
| 568 | Ga0496112_0188469 | 3300048915 | Bacteria | 2025 |
| 569 | Ga0496112_0195626 | 3300048915 | Bacteria | 1983 |
| 570 | Ga0496112_0241528 | 3300048915 | Bacteria | 1759 |
| 571 | Ga0496113_0004608 | 3300048916 | Bacteria | 8500 |
| 572 | Ga0496113_0006110 | 3300048916 | Bacteria | 7599 |
| 573 | Ga0496113_0038333 | 3300048916 | Bacteria | 3523 |
| 574 | Ga0501032_0009000 | 3300049569 | Bacteria | 7259 |
| 575 | Ga0501033_0009596 | 3300049570 | Bacteria | 7447 |
| 576 | Ga0501047_0003790 | 3300049581 | Bacteria | 14231 |
| 577 | Ga0501047_0026840 | 3300049581 | Bacteria | 5544 |
| 578 | Ga0501047_0158235 | 3300049581 | Bacteria | 2138 |
| 579 | Ga0501067_0010510 | 3300049583 | Bacteria | 5126 |
| 580 | Ga0501067_0087429 | 3300049583 | Bacteria | 1729 |
| 581 | Ga0501069_0155351 | 3300049585 | Bacteria | 1316 |
| 582 | Ga0501070_0019688 | 3300049586 | Bacteria | 5659 |
| 583 | Ga0501044_0002752 | 3300049823 | Bacteria | 20012 |
| 584 | nmdc:mga05p37_3651_c1 | 3300050507 | Bacteria | 17997 |
| 585 | nmdc:mga05p37_58807_c1 | 3300050507 | Bacteria | 4734 |
| 586 | nmdc:mga09592_144004_c1 | 3300050508 | Unclassified | 2055 |
| 587 | nmdc:mga09592_197745_c1 | 3300050508 | Bacteria | 1741 |
| 588 | nmdc:mga09592_379188_c1 | 3300050508 | Bacteria | 1223 |
| 589 | nmdc:mga0qj67_17021_c1 | 3300050509 | Bacteria | 5522 |
| 590 | nmdc:mga0qj67_17304_c1 | 3300050509 | Bacteria | 5479 |
| 591 | nmdc:mga0qj67_53175_c1 | 3300050509 | Unclassified | 3206 |
| 592 | nmdc:mga0qj67_931_c1 | 3300050509 | Bacteria | 20144 |
| 593 | nmdc:mga06r32_17846_c1 | 3300050510 | Bacteria | 6485 |
| 594 | nmdc:mga08y16_127867_c1 | 3300050511 | Bacteria | 2643 |
| 595 | nmdc:mga08y16_168565_c1 | 3300050511 | Bacteria | 2275 |
| 596 | nmdc:mga08y16_316116_c1 | 3300050511 | Bacteria | 1608 |
| 597 | nmdc:mga0n895_250535_c1 | 3300050512 | Unclassified | 1797 |
| 598 | nmdc:mga0n895_339117_c1 | 3300050512 | Bacteria | 1523 |
| 599 | nmdc:mga0n895_478145_c1 | 3300050512 | Unclassified | 1256 |
| 600 | nmdc:mga0n895_57823_c1 | 3300050512 | Bacteria | 3823 |
| 601 | nmdc:mga0n895_72899_c1 | 3300050512 | Bacteria | 3408 |
| 602 | nmdc:mga0n895_8015_c1 | 3300050512 | Bacteria | 9111 |
| 603 | nmdc:mga0rr50_24806_c1 | 3300050513 | Bacteria | 4159 |
| 604 | nmdc:mga0a205_4663_c2 | 3300050515 | Bacteria | 10613 |
| 605 | nmdc:mga0a205_89215_c1 | 3300050515 | Bacteria | 2980 |
| 606 | Ga0495601_0046087 | 3300053077 | Bacteria | 2744 |
| 607 | Ga0495601_0173112 | 3300053077 | Unclassified | 1411 |
| 608 | Ga0495612_0078174 | 3300053078 | Bacteria | 1387 |
| 609 | Ga0495595_0125096 | 3300053084 | Bacteria | 1254 |
| 610 | Ga0495619_0141262 | 3300053085 | Unclassified | 1658 |
| 611 | Ga0590071_000641 | 3300059421 | Bacteria | 9939 |
| 612 | Ga0590071_004054 | 3300059421 | Bacteria | 3577 |
| 613 | Ga0590075_013216 | 3300059424 | Bacteria | 2010 |
| 614 | Ga0590077_015541 | 3300059426 | Bacteria | 1592 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046525 | Ga0495663_0006558 | Ga0495663_0006558_2176_3033 | 226 |
| 2 | 3300050508 | nmdc:mga09592_379188_c1 | nmdc:mga09592_379188_c1_28_987 | 254 |
| 3 | 3300013306 | Ga0163162_10126037 | Ga0163162_101260372 | 269 |
| 4 | 3300026067 | Ga0207678_10300489 | Ga0207678_103004892 | 271 |
| 5 | 3300005546 | Ga0070696_100000840 | Ga0070696_10000084014 | 272 |
| 6 | 3300042876 | Ga0451577_0000001 | Ga0451577_0000001_574710_575813 | 272 |
| 7 | 3300005354 | Ga0070675_100003367 | Ga0070675_10000336711 | 273 |
| 8 | 3300005365 | Ga0070688_100005659 | Ga0070688_1000056595 | 273 |
| 9 | 3300005840 | Ga0068870_10003341 | Ga0068870_100033419 | 273 |
| 10 | 3300009094 | Ga0111539_10465776 | Ga0111539_104657761 | 273 |
| 11 | 3300013308 | Ga0157375_10103854 | Ga0157375_101038543 | 273 |
| 12 | 3300025908 | Ga0207643_10007907 | Ga0207643_100079076 | 273 |
| 13 | 3300025919 | Ga0207657_10291048 | Ga0207657_102910482 | 273 |
| 14 | 3300025932 | Ga0207690_10105294 | Ga0207690_101052942 | 273 |
| 15 | 3300025940 | Ga0207691_10005766 | Ga0207691_1000576611 | 273 |
| 16 | 3300005355 | Ga0070671_100016066 | Ga0070671_1000160666 | 274 |
| 17 | 3300005577 | Ga0068857_100155119 | Ga0068857_1001551192 | 274 |
| 18 | 3300026116 | Ga0207674_10123235 | Ga0207674_101232353 | 274 |
| 19 | 3300046539 | Ga0495621_0009880 | Ga0495621_0009880_910_2046 | 274 |
| 20 | 3300047447 | Ga0495685_054249 | Ga0495685_054249_109_1245 | 274 |
| 21 | 3300005435 | Ga0070714_100001803 | Ga0070714_1000018033 | 275 |
| 22 | 3300025929 | Ga0207664_10027237 | Ga0207664_100272371 | 275 |
| 23 | 3300025912 | Ga0207707_10006733 | Ga0207707_100067339 | 278 |
| 24 | 3300025912 | Ga0207707_10008243 | Ga0207707_100082439 | 278 |
| 25 | 3300025921 | Ga0207652_10043947 | Ga0207652_100439474 | 278 |
| 26 | 3300005341 | Ga0070691_10039751 | Ga0070691_100397512 | 279 |
| 27 | 3300005441 | Ga0070700_100008003 | Ga0070700_1000080038 | 279 |
| 28 | 3300005457 | Ga0070662_100006003 | Ga0070662_1000060031 | 279 |
| 29 | 3300005535 | Ga0070684_100055243 | Ga0070684_1000552433 | 279 |
| 30 | 3300005719 | Ga0068861_100372789 | Ga0068861_1003727891 | 279 |
| 31 | 3300006881 | Ga0068865_100002221 | Ga0068865_10000222110 | 279 |
| 32 | 3300009098 | Ga0105245_10016180 | Ga0105245_100161802 | 279 |
| 33 | 3300013297 | Ga0157378_10014701 | Ga0157378_100147013 | 279 |
| 34 | 3300025907 | Ga0207645_10010773 | Ga0207645_100107735 | 279 |
| 35 | 3300025927 | Ga0207687_10044874 | Ga0207687_100448743 | 279 |
| 36 | 3300025933 | Ga0207706_10001172 | Ga0207706_100011725 | 279 |
| 37 | 3300025941 | Ga0207711_10246015 | Ga0207711_102460151 | 279 |
| 38 | 3300026023 | Ga0207677_10026811 | Ga0207677_100268114 | 279 |
| 39 | 3300026075 | Ga0207708_10042376 | Ga0207708_100423763 | 279 |
| 40 | 3300045051 | Ga0451576_0211027 | Ga0451576_0211027_617_1768 | 279 |
| 41 | 3300048907 | Ga0496104_0219545 | Ga0496104_0219545_533_1684 | 279 |
| 42 | 3300048911 | Ga0496108_0146747 | Ga0496108_0146747_811_1962 | 279 |
| 43 | 3300048912 | Ga0496109_0343217 | Ga0496109_0343217_40_1191 | 279 |
| 44 | 3300048915 | Ga0496112_0006799 | Ga0496112_0006799_6496_7647 | 279 |
| 45 | 3300048916 | Ga0496113_0006110 | Ga0496113_0006110_680_1831 | 279 |
| 46 | 3300013306 | Ga0163162_10135773 | Ga0163162_101357732 | 281 |
| 47 | 3300050512 | nmdc:mga0n895_478145_c1 | nmdc:mga0n895_478145_c1_12_1163 | 281 |
| 48 | 3300005327 | Ga0070658_10022112 | Ga0070658_100221122 | 282 |
| 49 | 3300005329 | Ga0070683_100014387 | Ga0070683_1000143874 | 282 |
| 50 | 3300005347 | Ga0070668_100040297 | Ga0070668_1000402972 | 282 |
| 51 | 3300005353 | Ga0070669_100005930 | Ga0070669_10000593010 | 282 |
| 52 | 3300005366 | Ga0070659_100044397 | Ga0070659_1000443972 | 282 |
| 53 | 3300005438 | Ga0070701_10027253 | Ga0070701_100272532 | 282 |
| 54 | 3300005459 | Ga0068867_100155653 | Ga0068867_1001556532 | 282 |
| 55 | 3300005468 | Ga0070707_100015781 | Ga0070707_1000157819 | 282 |
| 56 | 3300005543 | Ga0070672_100139336 | Ga0070672_1001393362 | 282 |
| 57 | 3300005549 | Ga0070704_100112891 | Ga0070704_1001128912 | 282 |
| 58 | 3300005577 | Ga0068857_100009827 | Ga0068857_1000098272 | 282 |
| 59 | 3300005577 | Ga0068857_100028111 | Ga0068857_1000281113 | 282 |
| 60 | 3300005834 | Ga0068851_10022841 | Ga0068851_100228411 | 282 |
| 61 | 3300005843 | Ga0068860_100098780 | Ga0068860_1000987802 | 282 |
| 62 | 3300005844 | Ga0068862_100000800 | Ga0068862_10000080010 | 282 |
| 63 | 3300009094 | Ga0111539_10095429 | Ga0111539_100954293 | 282 |
| 64 | 3300009553 | Ga0105249_10000131 | Ga0105249_1000013149 | 282 |
| 65 | 3300013105 | Ga0157369_10423626 | Ga0157369_104236261 | 282 |
| 66 | 3300013306 | Ga0163162_10118948 | Ga0163162_101189482 | 282 |
| 67 | 3300014326 | Ga0157380_10004528 | Ga0157380_100045285 | 282 |
| 68 | 3300025908 | Ga0207643_10002102 | Ga0207643_1000210210 | 282 |
| 69 | 3300025922 | Ga0207646_10020564 | Ga0207646_100205642 | 282 |
| 70 | 3300025923 | Ga0207681_10002224 | Ga0207681_1000222410 | 282 |
| 71 | 3300025933 | Ga0207706_10054081 | Ga0207706_100540813 | 282 |
| 72 | 3300025940 | Ga0207691_10095316 | Ga0207691_100953162 | 282 |
| 73 | 3300025961 | Ga0207712_10014341 | Ga0207712_100143412 | 282 |
| 74 | 3300025972 | Ga0207668_10239798 | Ga0207668_102397981 | 282 |
| 75 | 3300026075 | Ga0207708_10092301 | Ga0207708_100923012 | 282 |
| 76 | 3300026116 | Ga0207674_10020881 | Ga0207674_100208816 | 282 |
| 77 | 3300026116 | Ga0207674_10038096 | Ga0207674_100380963 | 282 |
| 78 | 3300026121 | Ga0207683_10258525 | Ga0207683_102585252 | 282 |
| 79 | 3300027907 | Ga0207428_10103782 | Ga0207428_101037822 | 282 |
| 80 | 3300028380 | Ga0268265_10005142 | Ga0268265_100051426 | 282 |
| 81 | 3300028381 | Ga0268264_10231499 | Ga0268264_102314992 | 282 |
| 82 | 3300048915 | Ga0496112_0188469 | Ga0496112_0188469_485_1636 | 282 |
| 83 | 3300048916 | Ga0496113_0038333 | Ga0496113_0038333_1513_2664 | 282 |
| 84 | 3300050511 | nmdc:mga08y16_127867_c1 | nmdc:mga08y16_127867_c1_322_1476 | 282 |
| 85 | 3300050512 | nmdc:mga0n895_72899_c1 | nmdc:mga0n895_72899_c1_279_1373 | 282 |
| 86 | 3300046679 | Ga0495623_0034978 | Ga0495623_0034978_187_1317 | 283 |
| 87 | 3300005356 | Ga0070674_100023698 | Ga0070674_1000236983 | 284 |
| 88 | 3300005468 | Ga0070707_100098210 | Ga0070707_1000982103 | 284 |
| 89 | 3300005518 | Ga0070699_100020370 | Ga0070699_1000203705 | 284 |
| 90 | 3300005536 | Ga0070697_100052219 | Ga0070697_1000522194 | 284 |
| 91 | 3300005564 | Ga0070664_100074485 | Ga0070664_1000744853 | 284 |
| 92 | 3300006852 | Ga0075433_10069541 | Ga0075433_100695413 | 284 |
| 93 | 3300009147 | Ga0114129_10006750 | Ga0114129_1000675011 | 284 |
| 94 | 3300025937 | Ga0207669_10064686 | Ga0207669_100646863 | 284 |
| 95 | 3300025945 | Ga0207679_10047652 | Ga0207679_100476523 | 284 |
| 96 | 3300050507 | nmdc:mga05p37_3651_c1 | nmdc:mga05p37_3651_c1_3555_4709 | 284 |
| 97 | 3300050512 | nmdc:mga0n895_339117_c1 | nmdc:mga0n895_339117_c1_155_1309 | 284 |
| 98 | 3300050513 | nmdc:mga0rr50_24806_c1 | nmdc:mga0rr50_24806_c1_2822_3976 | 284 |
| 99 | 3300013100 | Ga0157373_10007545 | Ga0157373_100075457 | 285 |
| 100 | 3300036401 | Ga0373937_0043034 | Ga0373937_0043034_2414_3553 | 285 |
| 101 | 3300009177 | Ga0105248_10094795 | Ga0105248_100947953 | 286 |
| 102 | 3300025911 | Ga0207654_10029751 | Ga0207654_100297513 | 286 |
| 103 | 3300005355 | Ga0070671_100059929 | Ga0070671_1000599292 | 287 |
| 104 | 3300006880 | Ga0075429_100020869 | Ga0075429_1000208694 | 287 |
| 105 | 3300009147 | Ga0114129_10021186 | Ga0114129_100211861 | 287 |
| 106 | 3300025931 | Ga0207644_10007827 | Ga0207644_100078272 | 287 |
| 107 | 3300026067 | Ga0207678_10113869 | Ga0207678_101138692 | 287 |
| 108 | 3300032002 | Ga0307416_100162302 | Ga0307416_1001623021 | 287 |
| 109 | 3300048907 | Ga0496104_0117817 | Ga0496104_0117817_737_1888 | 287 |
| 110 | 3300048908 | Ga0496105_0084700 | Ga0496105_0084700_700_1851 | 287 |
| 111 | 3300050508 | nmdc:mga09592_144004_c1 | nmdc:mga09592_144004_c1_142_1281 | 287 |
| 112 | 3300005530 | Ga0070679_100173789 | Ga0070679_1001737892 | 288 |
| 113 | 3300005543 | Ga0070672_100234117 | Ga0070672_1002341172 | 288 |
| 114 | 3300009177 | Ga0105248_10156800 | Ga0105248_101568003 | 288 |
| 115 | 3300025940 | Ga0207691_10195316 | Ga0207691_101953162 | 288 |
| 116 | 3300031548 | Ga0307408_100082073 | Ga0307408_1000820733 | 288 |
| 117 | 3300031731 | Ga0307405_10004685 | Ga0307405_100046858 | 288 |
| 118 | 3300031824 | Ga0307413_10000384 | Ga0307413_100003849 | 288 |
| 119 | 3300031824 | Ga0307413_10046201 | Ga0307413_100462013 | 288 |
| 120 | 3300031852 | Ga0307410_10001224 | Ga0307410_100012243 | 288 |
| 121 | 3300031852 | Ga0307410_10065170 | Ga0307410_100651703 | 288 |
| 122 | 3300031903 | Ga0307407_10002241 | Ga0307407_1000224110 | 288 |
| 123 | 3300031911 | Ga0307412_10028465 | Ga0307412_100284651 | 288 |
| 124 | 3300031995 | Ga0307409_100005851 | Ga0307409_1000058516 | 288 |
| 125 | 3300032002 | Ga0307416_100000541 | Ga0307416_1000005419 | 288 |
| 126 | 3300032004 | Ga0307414_10022563 | Ga0307414_100225634 | 288 |
| 127 | 3300032004 | Ga0307414_10100190 | Ga0307414_101001902 | 288 |
| 128 | 3300032005 | Ga0307411_10002798 | Ga0307411_100027986 | 288 |
| 129 | 3300032005 | Ga0307411_10004205 | Ga0307411_100042053 | 288 |
| 130 | 3300032005 | Ga0307411_10082541 | Ga0307411_100825413 | 288 |
| 131 | 3300032126 | Ga0307415_100000895 | Ga0307415_10000089513 | 288 |
| 132 | 3300032126 | Ga0307415_100048880 | Ga0307415_1000488802 | 288 |
| 133 | 3300032126 | Ga0307415_100084793 | Ga0307415_1000847932 | 288 |
| 134 | 3300005338 | Ga0068868_100143643 | Ga0068868_1001436432 | 289 |
| 135 | 3300013297 | Ga0157378_10238440 | Ga0157378_102384402 | 289 |
| 136 | 3300025931 | Ga0207644_10095893 | Ga0207644_100958932 | 289 |
| 137 | 3300031903 | Ga0307407_10163728 | Ga0307407_101637282 | 289 |
| 138 | 3300031995 | Ga0307409_100122242 | Ga0307409_1001222422 | 289 |
| 139 | 3300048909 | Ga0496106_0130930 | Ga0496106_0130930_427_1578 | 289 |
| 140 | 3300048909 | Ga0496106_0187077 | Ga0496106_0187077_407_1501 | 289 |
| 141 | 3300005616 | Ga0068852_100178355 | Ga0068852_1001783552 | 290 |
| 142 | 3300025899 | Ga0207642_10113519 | Ga0207642_101135192 | 290 |
| 143 | 3300025940 | Ga0207691_10101075 | Ga0207691_101010752 | 290 |
| 144 | 3300026089 | Ga0207648_10014800 | Ga0207648_1001480010 | 290 |
| 145 | 3300005329 | Ga0070683_100007872 | Ga0070683_1000078722 | 291 |
| 146 | 3300005330 | Ga0070690_100172420 | Ga0070690_1001724201 | 291 |
| 147 | 3300005331 | Ga0070670_100014873 | Ga0070670_1000148731 | 291 |
| 148 | 3300005334 | Ga0068869_100014258 | Ga0068869_1000142582 | 291 |
| 149 | 3300005336 | Ga0070680_100026465 | Ga0070680_1000264651 | 291 |
| 150 | 3300005337 | Ga0070682_100009246 | Ga0070682_1000092463 | 291 |
| 151 | 3300005339 | Ga0070660_100061986 | Ga0070660_1000619861 | 291 |
| 152 | 3300005344 | Ga0070661_100001410 | Ga0070661_10000141014 | 291 |
| 153 | 3300005354 | Ga0070675_100014802 | Ga0070675_1000148023 | 291 |
| 154 | 3300005366 | Ga0070659_100013575 | Ga0070659_1000135752 | 291 |
| 155 | 3300005440 | Ga0070705_100062161 | Ga0070705_1000621612 | 291 |
| 156 | 3300005457 | Ga0070662_100049520 | Ga0070662_1000495202 | 291 |
| 157 | 3300005458 | Ga0070681_10053692 | Ga0070681_100536921 | 291 |
| 158 | 3300005530 | Ga0070679_100011509 | Ga0070679_1000115092 | 291 |
| 159 | 3300005547 | Ga0070693_100001820 | Ga0070693_1000018206 | 291 |
| 160 | 3300005563 | Ga0068855_100040846 | Ga0068855_1000408462 | 291 |
| 161 | 3300005564 | Ga0070664_100010981 | Ga0070664_1000109812 | 291 |
| 162 | 3300005577 | Ga0068857_100013425 | Ga0068857_1000134252 | 291 |
| 163 | 3300005614 | Ga0068856_100232264 | Ga0068856_1002322641 | 291 |
| 164 | 3300005615 | Ga0070702_100006540 | Ga0070702_1000065404 | 291 |
| 165 | 3300005617 | Ga0068859_100100097 | Ga0068859_1001000971 | 291 |
| 166 | 3300005618 | Ga0068864_100040252 | Ga0068864_1000402521 | 291 |
| 167 | 3300005840 | Ga0068870_10078785 | Ga0068870_100787852 | 291 |
| 168 | 3300005841 | Ga0068863_100008812 | Ga0068863_10000881212 | 291 |
| 169 | 3300006237 | Ga0097621_100014901 | Ga0097621_1000149018 | 291 |
| 170 | 3300006931 | Ga0097620_100100094 | Ga0097620_1001000941 | 291 |
| 171 | 3300009098 | Ga0105245_10019525 | Ga0105245_100195255 | 291 |
| 172 | 3300009098 | Ga0105245_10070600 | Ga0105245_100706003 | 291 |
| 173 | 3300009148 | Ga0105243_10095997 | Ga0105243_100959973 | 291 |
| 174 | 3300009174 | Ga0105241_10028241 | Ga0105241_100282413 | 291 |
| 175 | 3300009176 | Ga0105242_10002665 | Ga0105242_1000266513 | 291 |
| 176 | 3300009176 | Ga0105242_10143293 | Ga0105242_101432932 | 291 |
| 177 | 3300009177 | Ga0105248_10024300 | Ga0105248_100243009 | 291 |
| 178 | 3300010375 | Ga0105239_10066794 | Ga0105239_100667942 | 291 |
| 179 | 3300011119 | Ga0105246_10002055 | Ga0105246_1000205511 | 291 |
| 180 | 3300013100 | Ga0157373_10062445 | Ga0157373_100624451 | 291 |
| 181 | 3300013102 | Ga0157371_10080852 | Ga0157371_100808522 | 291 |
| 182 | 3300013296 | Ga0157374_10063722 | Ga0157374_100637222 | 291 |
| 183 | 3300013307 | Ga0157372_10099810 | Ga0157372_100998102 | 291 |
| 184 | 3300013308 | Ga0157375_10021245 | Ga0157375_100212456 | 291 |
| 185 | 3300014325 | Ga0163163_10084033 | Ga0163163_100840333 | 291 |
| 186 | 3300014969 | Ga0157376_10023306 | Ga0157376_100233065 | 291 |
| 187 | 3300025908 | Ga0207643_10081472 | Ga0207643_100814722 | 291 |
| 188 | 3300025912 | Ga0207707_10020108 | Ga0207707_100201085 | 291 |
| 189 | 3300025921 | Ga0207652_10057977 | Ga0207652_100579773 | 291 |
| 190 | 3300025925 | Ga0207650_10007569 | Ga0207650_1000756910 | 291 |
| 191 | 3300025927 | Ga0207687_10013206 | Ga0207687_100132065 | 291 |
| 192 | 3300025932 | Ga0207690_10056537 | Ga0207690_100565371 | 291 |
| 193 | 3300025933 | Ga0207706_10160860 | Ga0207706_101608602 | 291 |
| 194 | 3300025934 | Ga0207686_10086885 | Ga0207686_100868851 | 291 |
| 195 | 3300025934 | Ga0207686_10087241 | Ga0207686_100872412 | 291 |
| 196 | 3300025936 | Ga0207670_10014841 | Ga0207670_100148413 | 291 |
| 197 | 3300025941 | Ga0207711_10017100 | Ga0207711_100171005 | 291 |
| 198 | 3300025941 | Ga0207711_10027868 | Ga0207711_100278683 | 291 |
| 199 | 3300025942 | Ga0207689_10003790 | Ga0207689_1000379011 | 291 |
| 200 | 3300025944 | Ga0207661_10007529 | Ga0207661_100075293 | 291 |
| 201 | 3300025945 | Ga0207679_10005509 | Ga0207679_1000550910 | 291 |
| 202 | 3300025949 | Ga0207667_10034783 | Ga0207667_100347836 | 291 |
| 203 | 3300026041 | Ga0207639_10073917 | Ga0207639_100739172 | 291 |
| 204 | 3300026078 | Ga0207702_10018881 | Ga0207702_100188812 | 291 |
| 205 | 3300026088 | Ga0207641_10022683 | Ga0207641_100226836 | 291 |
| 206 | 3300026116 | Ga0207674_10000208 | Ga0207674_1000020837 | 291 |
| 207 | 3300042156 | Ga0439446_0025411 | Ga0439446_0025411_426_1517 | 291 |
| 208 | 3300049581 | Ga0501047_0158235 | Ga0501047_0158235_389_1501 | 291 |
| 209 | 3300053077 | Ga0495601_0173112 | Ga0495601_0173112_217_1362 | 291 |
| 210 | 3300005327 | Ga0070658_10015518 | Ga0070658_100155185 | 292 |
| 211 | 3300005616 | Ga0068852_100005268 | Ga0068852_10000526810 | 292 |
| 212 | 3300005842 | Ga0068858_100311697 | Ga0068858_1003116972 | 292 |
| 213 | 3300013105 | Ga0157369_10006735 | Ga0157369_1000673511 | 292 |
| 214 | 3300013306 | Ga0163162_10462887 | Ga0163162_104628872 | 292 |
| 215 | 3300013307 | Ga0157372_10448677 | Ga0157372_104486771 | 292 |
| 216 | 3300025908 | Ga0207643_10062594 | Ga0207643_100625942 | 292 |
| 217 | 3300025918 | Ga0207662_10049712 | Ga0207662_100497122 | 292 |
| 218 | 3300025972 | Ga0207668_10016237 | Ga0207668_100162372 | 292 |
| 219 | 3300026142 | Ga0207698_10025723 | Ga0207698_100257234 | 292 |
| 220 | 3300028380 | Ga0268265_10020036 | Ga0268265_100200362 | 292 |
| 221 | 3300035691 | Ga0373931_0125317 | Ga0373931_0125317_49_1206 | 292 |
| 222 | 3300048907 | Ga0496104_0014754 | Ga0496104_0014754_4025_5119 | 292 |
| 223 | 3300048913 | Ga0496110_0004901 | Ga0496110_0004901_7654_8748 | 292 |
| 224 | 3300048915 | Ga0496112_0195626 | Ga0496112_0195626_549_1610 | 293 |
| 225 | 3300005458 | Ga0070681_10001775 | Ga0070681_100017755 | 294 |
| 226 | 3300005530 | Ga0070679_100001349 | Ga0070679_10000134918 | 294 |
| 227 | 3300009545 | Ga0105237_10280336 | Ga0105237_102803362 | 294 |
| 228 | 3300010375 | Ga0105239_10007696 | Ga0105239_100076963 | 294 |
| 229 | 3300025912 | Ga0207707_10002809 | Ga0207707_1000280917 | 294 |
| 230 | 3300025921 | Ga0207652_10006228 | Ga0207652_100062288 | 294 |
| 231 | 3300049583 | Ga0501067_0010510 | Ga0501067_0010510_72_1178 | 294 |
| 232 | 3300049585 | Ga0501069_0155351 | Ga0501069_0155351_104_1210 | 294 |
| 233 | 3300046472 | Ga0495580_0028823 | Ga0495580_0028823_99_1244 | 295 |
| 234 | 3300046499 | Ga0495594_0089037 | Ga0495594_0089037_542_1687 | 295 |
| 235 | 3300049569 | Ga0501032_0009000 | Ga0501032_0009000_249_1406 | 295 |
| 236 | 3300049581 | Ga0501047_0003790 | Ga0501047_0003790_7445_8602 | 295 |
| 237 | 3300049586 | Ga0501070_0019688 | Ga0501070_0019688_2293_3450 | 295 |
| 238 | 3300039437 | Ga0436365_1313802 | Ga0436365_1313802_297_1439 | 296 |
| 239 | 3300059421 | Ga0590071_000641 | Ga0590071_000641_7053_8150 | 296 |
| 240 | 3300059426 | Ga0590077_015541 | Ga0590077_015541_308_1405 | 296 |
| 241 | 3300005336 | Ga0070680_100000354 | Ga0070680_10000035410 | 297 |
| 242 | 3300005337 | Ga0070682_100000492 | Ga0070682_1000004923 | 297 |
| 243 | 3300005347 | Ga0070668_100031679 | Ga0070668_1000316792 | 297 |
| 244 | 3300005356 | Ga0070674_100122668 | Ga0070674_1001226682 | 297 |
| 245 | 3300005367 | Ga0070667_100039826 | Ga0070667_1000398263 | 297 |
| 246 | 3300005459 | Ga0068867_100005743 | Ga0068867_1000057435 | 297 |
| 247 | 3300005530 | Ga0070679_100000377 | Ga0070679_10000037725 | 297 |
| 248 | 3300005843 | Ga0068860_100134683 | Ga0068860_1001346832 | 297 |
| 249 | 3300006881 | Ga0068865_100006993 | Ga0068865_1000069932 | 297 |
| 250 | 3300009148 | Ga0105243_10098932 | Ga0105243_100989321 | 297 |
| 251 | 3300013306 | Ga0163162_10042337 | Ga0163162_100423372 | 297 |
| 252 | 3300025912 | Ga0207707_10002464 | Ga0207707_100024648 | 297 |
| 253 | 3300025917 | Ga0207660_10052342 | Ga0207660_100523422 | 297 |
| 254 | 3300025921 | Ga0207652_10021261 | Ga0207652_100212612 | 297 |
| 255 | 3300025935 | Ga0207709_10050412 | Ga0207709_100504122 | 297 |
| 256 | 3300025938 | Ga0207704_10129567 | Ga0207704_101295672 | 297 |
| 257 | 3300025940 | Ga0207691_10010422 | Ga0207691_100104225 | 297 |
| 258 | 3300025941 | Ga0207711_10046092 | Ga0207711_100460922 | 297 |
| 259 | 3300025986 | Ga0207658_10087090 | Ga0207658_100870902 | 297 |
| 260 | 3300026089 | Ga0207648_10016629 | Ga0207648_100166294 | 297 |
| 261 | 3300028381 | Ga0268264_10063710 | Ga0268264_100637102 | 297 |
| 262 | 3300005364 | Ga0070673_100089908 | Ga0070673_1000899082 | 298 |
| 263 | 3300005530 | Ga0070679_100102321 | Ga0070679_1001023213 | 298 |
| 264 | 3300005544 | Ga0070686_100052044 | Ga0070686_1000520443 | 298 |
| 265 | 3300005545 | Ga0070695_100007270 | Ga0070695_1000072703 | 298 |
| 266 | 3300005615 | Ga0070702_100066811 | Ga0070702_1000668111 | 298 |
| 267 | 3300009094 | Ga0111539_10220190 | Ga0111539_102201902 | 298 |
| 268 | 3300009094 | Ga0111539_10240307 | Ga0111539_102403072 | 298 |
| 269 | 3300013308 | Ga0157375_10011285 | Ga0157375_100112853 | 298 |
| 270 | 3300025918 | Ga0207662_10048640 | Ga0207662_100486403 | 298 |
| 271 | 3300025939 | Ga0207665_10201970 | Ga0207665_102019702 | 298 |
| 272 | 3300025949 | Ga0207667_10130531 | Ga0207667_101305311 | 298 |
| 273 | 3300026116 | Ga0207674_10159922 | Ga0207674_101599222 | 298 |
| 274 | 3300048915 | Ga0496112_0241528 | Ga0496112_0241528_417_1553 | 298 |
| 275 | 3300050511 | nmdc:mga08y16_168565_c1 | nmdc:mga08y16_168565_c1_1056_2186 | 298 |
| 276 | 3300005327 | Ga0070658_10002218 | Ga0070658_1000221810 | 299 |
| 277 | 3300005337 | Ga0070682_100008751 | Ga0070682_1000087511 | 299 |
| 278 | 3300005339 | Ga0070660_100009663 | Ga0070660_1000096632 | 299 |
| 279 | 3300005344 | Ga0070661_100077209 | Ga0070661_1000772093 | 299 |
| 280 | 3300005366 | Ga0070659_100025729 | Ga0070659_1000257295 | 299 |
| 281 | 3300005563 | Ga0068855_100007038 | Ga0068855_1000070382 | 299 |
| 282 | 3300013307 | Ga0157372_10006551 | Ga0157372_100065516 | 299 |
| 283 | 3300025909 | Ga0207705_10005895 | Ga0207705_1000589511 | 299 |
| 284 | 3300025919 | Ga0207657_10001987 | Ga0207657_1000198717 | 299 |
| 285 | 3300025923 | Ga0207681_10008973 | Ga0207681_100089732 | 299 |
| 286 | 3300025927 | Ga0207687_10116289 | Ga0207687_101162892 | 299 |
| 287 | 3300044684 | Ga0466966_0031762 | Ga0466966_0031762_1675_2814 | 299 |
| 288 | 3300045049 | Ga0466959_0171968 | Ga0466959_0171968_188_1327 | 299 |
| 289 | 3300049583 | Ga0501067_0087429 | Ga0501067_0087429_518_1621 | 299 |
| 290 | 3300050511 | nmdc:mga08y16_316116_c1 | nmdc:mga08y16_316116_c1_58_1152 | 299 |
| 291 | 3300005336 | Ga0070680_100040225 | Ga0070680_1000402253 | 300 |
| 292 | 3300005339 | Ga0070660_100140968 | Ga0070660_1001409682 | 300 |
| 293 | 3300005458 | Ga0070681_10039263 | Ga0070681_100392632 | 300 |
| 294 | 3300048911 | Ga0496108_0038642 | Ga0496108_0038642_740_1834 | 300 |
| 295 | 3300048912 | Ga0496109_0060384 | Ga0496109_0060384_945_2039 | 300 |
| 296 | 3300048914 | Ga0496111_0003621 | Ga0496111_0003621_603_1697 | 300 |
| 297 | 3300048916 | Ga0496113_0004608 | Ga0496113_0004608_2794_3888 | 300 |
| 298 | 3300009176 | Ga0105242_10003515 | Ga0105242_1000351510 | 301 |
| 299 | 3300025926 | Ga0207659_10321075 | Ga0207659_103210752 | 301 |
| 300 | 3300005530 | Ga0070679_100099574 | Ga0070679_1000995742 | 302 |
| 301 | 3300005617 | Ga0068859_100015924 | Ga0068859_1000159249 | 302 |
| 302 | 3300006931 | Ga0097620_100015924 | Ga0097620_1000159249 | 302 |
| 303 | 3300025921 | Ga0207652_10257756 | Ga0207652_102577562 | 302 |
| 304 | 3300031548 | Ga0307408_100244337 | Ga0307408_1002443372 | 302 |
| 305 | 3300059421 | Ga0590071_004054 | Ga0590071_004054_125_1219 | 302 |
| 306 | 3300059424 | Ga0590075_013216 | Ga0590075_013216_508_1602 | 302 |
| 307 | 3300048907 | Ga0496104_0166462 | Ga0496104_0166462_421_1512 | 303 |
| 308 | 3300005329 | Ga0070683_100123188 | Ga0070683_1001231882 | 304 |
| 309 | 3300005535 | Ga0070684_100006657 | Ga0070684_1000066578 | 304 |
| 310 | 3300005564 | Ga0070664_100207803 | Ga0070664_1002078032 | 304 |
| 311 | 3300006846 | Ga0075430_100011415 | Ga0075430_1000114158 | 304 |
| 312 | 3300031824 | Ga0307413_10041492 | Ga0307413_100414923 | 304 |
| 313 | 3300032002 | Ga0307416_100008974 | Ga0307416_1000089748 | 304 |
| 314 | 3300032126 | Ga0307415_100058185 | Ga0307415_1000581853 | 304 |
| 315 | 3300045976 | Ga0466967_0083237 | Ga0466967_0083237_216_1358 | 304 |
| 316 | 3300050509 | nmdc:mga0qj67_17021_c1 | nmdc:mga0qj67_17021_c1_343_1479 | 304 |
| 317 | 3300026142 | Ga0207698_10214030 | Ga0207698_102140301 | 305 |
| 318 | 3300048905 | Ga0496102_0290593 | Ga0496102_0290593_351_1457 | 305 |
| 319 | 3300005331 | Ga0070670_100006497 | Ga0070670_1000064971 | 306 |
| 320 | 3300005530 | Ga0070679_100177388 | Ga0070679_1001773882 | 306 |
| 321 | 3300005618 | Ga0068864_100216015 | Ga0068864_1002160152 | 306 |
| 322 | 3300006358 | Ga0068871_100150589 | Ga0068871_1001505892 | 306 |
| 323 | 3300025912 | Ga0207707_10054644 | Ga0207707_100546443 | 306 |
| 324 | 3300025920 | Ga0207649_10060588 | Ga0207649_100605882 | 306 |
| 325 | 3300025921 | Ga0207652_10157487 | Ga0207652_101574872 | 306 |
| 326 | 3300025925 | Ga0207650_10005419 | Ga0207650_100054192 | 306 |
| 327 | 3300026095 | Ga0207676_10079245 | Ga0207676_100792453 | 306 |
| 328 | 3300005344 | Ga0070661_100118758 | Ga0070661_1001187582 | 307 |
| 329 | 3300005468 | Ga0070707_100024874 | Ga0070707_1000248746 | 307 |
| 330 | 3300005471 | Ga0070698_100001204 | Ga0070698_10000120413 | 307 |
| 331 | 3300005617 | Ga0068859_100177602 | Ga0068859_1001776022 | 307 |
| 332 | 3300006846 | Ga0075430_100115482 | Ga0075430_1001154822 | 307 |
| 333 | 3300006847 | Ga0075431_100012683 | Ga0075431_10001268310 | 307 |
| 334 | 3300006931 | Ga0097620_100177603 | Ga0097620_1001776032 | 307 |
| 335 | 3300025922 | Ga0207646_10064178 | Ga0207646_100641782 | 307 |
| 336 | 3300028380 | Ga0268265_10036233 | Ga0268265_100362333 | 307 |
| 337 | 3300037068 | Ga0373925_0082298 | Ga0373925_0082298_308_1462 | 307 |
| 338 | 3300046499 | Ga0495594_0114643 | Ga0495594_0114643_277_1422 | 307 |
| 339 | 3300046517 | Ga0495630_0024540 | Ga0495630_0024540_1750_2904 | 307 |
| 340 | 3300046535 | Ga0495586_0021906 | Ga0495586_0021906_948_2102 | 307 |
| 341 | 3300047315 | Ga0495581_0017214 | Ga0495581_0017214_2092_3237 | 307 |
| 342 | 3300047471 | Ga0495684_0015720 | Ga0495684_0015720_4082_5236 | 307 |
| 343 | 3300047673 | Ga0495593_0079871 | Ga0495593_0079871_476_1621 | 307 |
| 344 | 3300005329 | Ga0070683_100050136 | Ga0070683_1000501362 | 308 |
| 345 | 3300005563 | Ga0068855_100005805 | Ga0068855_10000580511 | 308 |
| 346 | 3300006028 | Ga0070717_10084592 | Ga0070717_100845923 | 308 |
| 347 | 3300009093 | Ga0105240_10178962 | Ga0105240_101789621 | 308 |
| 348 | 3300025913 | Ga0207695_10037328 | Ga0207695_100373286 | 308 |
| 349 | 3300046459 | Ga0495629_0004819 | Ga0495629_0004819_690_1832 | 308 |
| 350 | 3300046683 | Ga0495658_0013031 | Ga0495658_0013031_175_1317 | 308 |
| 351 | 3300005328 | Ga0070676_10067778 | Ga0070676_100677782 | 310 |
| 352 | 3300005434 | Ga0070709_10155229 | Ga0070709_101552291 | 310 |
| 353 | 3300005435 | Ga0070714_100074240 | Ga0070714_1000742402 | 310 |
| 354 | 3300005435 | Ga0070714_100136821 | Ga0070714_1001368212 | 310 |
| 355 | 3300005436 | Ga0070713_100006043 | Ga0070713_1000060435 | 310 |
| 356 | 3300005439 | Ga0070711_100053749 | Ga0070711_1000537493 | 310 |
| 357 | 3300006173 | Ga0070716_100139807 | Ga0070716_1001398071 | 310 |
| 358 | 3300006175 | Ga0070712_100011778 | Ga0070712_1000117783 | 310 |
| 359 | 3300025906 | Ga0207699_10035209 | Ga0207699_100352093 | 310 |
| 360 | 3300025907 | Ga0207645_10084523 | Ga0207645_100845232 | 310 |
| 361 | 3300025915 | Ga0207693_10019977 | Ga0207693_100199772 | 310 |
| 362 | 3300025916 | Ga0207663_10083442 | Ga0207663_100834422 | 310 |
| 363 | 3300025923 | Ga0207681_10255181 | Ga0207681_102551811 | 310 |
| 364 | 3300025928 | Ga0207700_10033091 | Ga0207700_100330914 | 310 |
| 365 | 3300025929 | Ga0207664_10054702 | Ga0207664_100547023 | 310 |
| 366 | 3300025929 | Ga0207664_10118955 | Ga0207664_101189553 | 310 |
| 367 | 3300035083 | Ga0373926_0002772 | Ga0373926_0002772_38_1159 | 310 |
| 368 | 3300035089 | Ga0373944_0004135 | Ga0373944_0004135_270_1391 | 310 |
| 369 | 3300035113 | Ga0373936_0013214 | Ga0373936_0013214_18_1139 | 310 |
| 370 | 3300035170 | Ga0373943_0002090 | Ga0373943_0002090_1014_2135 | 310 |
| 371 | 3300035692 | Ga0373935_0002652 | Ga0373935_0002652_5169_6290 | 310 |
| 372 | 3300035695 | Ga0373927_0001791 | Ga0373927_0001791_328_1449 | 310 |
| 373 | 3300035725 | Ga0373947_0000698 | Ga0373947_0000698_4126_5247 | 310 |
| 374 | 3300037068 | Ga0373925_0003620 | Ga0373925_0003620_5000_6121 | 310 |
| 375 | 3300046459 | Ga0495629_0111905 | Ga0495629_0111905_153_1274 | 310 |
| 376 | 3300046472 | Ga0495580_0000874 | Ga0495580_0000874_2325_3446 | 310 |
| 377 | 3300046473 | Ga0495582_0000142 | Ga0495582_0000142_16971_18092 | 310 |
| 378 | 3300046475 | Ga0495639_0000663 | Ga0495639_0000663_12387_13508 | 310 |
| 379 | 3300046517 | Ga0495630_0003191 | Ga0495630_0003191_7350_8471 | 310 |
| 380 | 3300046531 | Ga0495665_0000009 | Ga0495665_0000009_37387_38508 | 310 |
| 381 | 3300046663 | Ga0495635_0054946 | Ga0495635_0054946_1313_2434 | 310 |
| 382 | 3300046674 | Ga0495588_0001281 | Ga0495588_0001281_9088_10209 | 310 |
| 383 | 3300046683 | Ga0495658_0000131 | Ga0495658_0000131_31770_32891 | 310 |
| 384 | 3300047315 | Ga0495581_0000366 | Ga0495581_0000366_4275_5396 | 310 |
| 385 | 3300047673 | Ga0495593_0000040 | Ga0495593_0000040_22899_24020 | 310 |
| 386 | 3300048089 | Ga0495614_0002014 | Ga0495614_0002014_2197_3318 | 310 |
| 387 | 3300009094 | Ga0111539_10244997 | Ga0111539_102449971 | 311 |
| 388 | 3300050512 | nmdc:mga0n895_250535_c1 | nmdc:mga0n895_250535_c1_200_1306 | 311 |
| 389 | 3300005329 | Ga0070683_100112796 | Ga0070683_1001127962 | 312 |
| 390 | 3300005530 | Ga0070679_100003405 | Ga0070679_10000340511 | 312 |
| 391 | 3300025921 | Ga0207652_10107395 | Ga0207652_101073952 | 312 |
| 392 | 3300025933 | Ga0207706_10030971 | Ga0207706_100309712 | 312 |
| 393 | 3300025944 | Ga0207661_10172498 | Ga0207661_101724982 | 312 |
| 394 | 3300037312 | Ga0395899_0024455 | Ga0395899_0024455_2977_4125 | 312 |
| 395 | 3300037471 | Ga0395905_0005015 | Ga0395905_0005015_6108_7256 | 312 |
| 396 | 3300038443 | Ga0395901_0004304 | Ga0395901_0004304_6752_7900 | 312 |
| 397 | 3300046459 | Ga0495629_0112747 | Ga0495629_0112747_298_1443 | 312 |
| 398 | 3300006237 | Ga0097621_100147925 | Ga0097621_1001479252 | 313 |
| 399 | 3300035725 | Ga0373947_0018423 | Ga0373947_0018423_2033_3187 | 313 |
| 400 | 3300037068 | Ga0373925_0019388 | Ga0373925_0019388_3662_4804 | 313 |
| 401 | 3300046472 | Ga0495580_0012607 | Ga0495580_0012607_4720_5862 | 313 |
| 402 | 3300046499 | Ga0495594_0016573 | Ga0495594_0016573_2664_3806 | 313 |
| 403 | 3300046517 | Ga0495630_0081562 | Ga0495630_0081562_51_1193 | 313 |
| 404 | 3300046531 | Ga0495665_0004906 | Ga0495665_0004906_566_1708 | 313 |
| 405 | 3300046533 | Ga0495640_0047471 | Ga0495640_0047471_1728_2870 | 313 |
| 406 | 3300047315 | Ga0495581_0132429 | Ga0495581_0132429_131_1273 | 313 |
| 407 | 3300047319 | Ga0495674_0017454 | Ga0495674_0017454_286_1428 | 313 |
| 408 | 3300053085 | Ga0495619_0141262 | Ga0495619_0141262_476_1618 | 313 |
| 409 | 3300005336 | Ga0070680_100000489 | Ga0070680_10000048926 | 314 |
| 410 | 3300025917 | Ga0207660_10000027 | Ga0207660_1000002725 | 314 |
| 411 | 3300036401 | Ga0373937_0114765 | Ga0373937_0114765_1249_2385 | 314 |
| 412 | 3300031548 | Ga0307408_100012846 | Ga0307408_1000128463 | 315 |
| 413 | 3300031731 | Ga0307405_10031029 | Ga0307405_100310293 | 315 |
| 414 | 3300031824 | Ga0307413_10004902 | Ga0307413_100049023 | 315 |
| 415 | 3300031824 | Ga0307413_10053408 | Ga0307413_100534083 | 315 |
| 416 | 3300031852 | Ga0307410_10011172 | Ga0307410_100111722 | 315 |
| 417 | 3300031903 | Ga0307407_10003959 | Ga0307407_100039595 | 315 |
| 418 | 3300031911 | Ga0307412_10050356 | Ga0307412_100503561 | 315 |
| 419 | 3300031995 | Ga0307409_100217842 | Ga0307409_1002178422 | 315 |
| 420 | 3300032002 | Ga0307416_100002606 | Ga0307416_1000026064 | 315 |
| 421 | 3300032002 | Ga0307416_100095237 | Ga0307416_1000952373 | 315 |
| 422 | 3300032005 | Ga0307411_10001294 | Ga0307411_100012945 | 315 |
| 423 | 3300041406 | Ga0439439_0002484 | Ga0439439_0002484_1458_2591 | 315 |
| 424 | 3300042435 | Ga0439434_0006631 | Ga0439434_0006631_1705_2838 | 315 |
| 425 | 3300005328 | Ga0070676_10062554 | Ga0070676_100625542 | 316 |
| 426 | 3300005329 | Ga0070683_100123553 | Ga0070683_1001235533 | 316 |
| 427 | 3300005329 | Ga0070683_100297380 | Ga0070683_1002973801 | 316 |
| 428 | 3300005331 | Ga0070670_100002223 | Ga0070670_10000222310 | 316 |
| 429 | 3300005336 | Ga0070680_100023357 | Ga0070680_1000233575 | 316 |
| 430 | 3300005341 | Ga0070691_10051203 | Ga0070691_100512031 | 316 |
| 431 | 3300005344 | Ga0070661_100008160 | Ga0070661_1000081604 | 316 |
| 432 | 3300005354 | Ga0070675_100064315 | Ga0070675_1000643154 | 316 |
| 433 | 3300005367 | Ga0070667_100239965 | Ga0070667_1002399652 | 316 |
| 434 | 3300005458 | Ga0070681_10014467 | Ga0070681_100144676 | 316 |
| 435 | 3300005530 | Ga0070679_100047091 | Ga0070679_1000470913 | 316 |
| 436 | 3300005535 | Ga0070684_100129102 | Ga0070684_1001291022 | 316 |
| 437 | 3300005539 | Ga0068853_100084207 | Ga0068853_1000842074 | 316 |
| 438 | 3300005577 | Ga0068857_100002342 | Ga0068857_10000234211 | 316 |
| 439 | 3300006847 | Ga0075431_100007854 | Ga0075431_1000078546 | 316 |
| 440 | 3300009093 | Ga0105240_10296239 | Ga0105240_102962391 | 316 |
| 441 | 3300009177 | Ga0105248_10021390 | Ga0105248_100213908 | 316 |
| 442 | 3300009545 | Ga0105237_10055922 | Ga0105237_100559223 | 316 |
| 443 | 3300009551 | Ga0105238_10036819 | Ga0105238_100368194 | 316 |
| 444 | 3300013105 | Ga0157369_10009491 | Ga0157369_1000949110 | 316 |
| 445 | 3300013307 | Ga0157372_10003116 | Ga0157372_1000311612 | 316 |
| 446 | 3300013308 | Ga0157375_10337410 | Ga0157375_103374102 | 316 |
| 447 | 3300025908 | Ga0207643_10020933 | Ga0207643_100209332 | 316 |
| 448 | 3300025912 | Ga0207707_10013189 | Ga0207707_100131896 | 316 |
| 449 | 3300025914 | Ga0207671_10110096 | Ga0207671_101100962 | 316 |
| 450 | 3300025920 | Ga0207649_10008386 | Ga0207649_100083865 | 316 |
| 451 | 3300025920 | Ga0207649_10071271 | Ga0207649_100712712 | 316 |
| 452 | 3300025924 | Ga0207694_10254674 | Ga0207694_102546742 | 316 |
| 453 | 3300025926 | Ga0207659_10004848 | Ga0207659_100048489 | 316 |
| 454 | 3300025940 | Ga0207691_10000761 | Ga0207691_1000076122 | 316 |
| 455 | 3300025941 | Ga0207711_10061730 | Ga0207711_100617303 | 316 |
| 456 | 3300025944 | Ga0207661_10037718 | Ga0207661_100377183 | 316 |
| 457 | 3300025944 | Ga0207661_10183135 | Ga0207661_101831352 | 316 |
| 458 | 3300025986 | Ga0207658_10156360 | Ga0207658_101563602 | 316 |
| 459 | 3300026116 | Ga0207674_10011064 | Ga0207674_100110647 | 316 |
| 460 | 3300048911 | Ga0496108_0271275 | Ga0496108_0271275_122_1210 | 316 |
| 461 | 3300050509 | nmdc:mga0qj67_17304_c1 | nmdc:mga0qj67_17304_c1_1143_2294 | 316 |
| 462 | 3300050510 | nmdc:mga06r32_17846_c1 | nmdc:mga06r32_17846_c1_4097_5248 | 316 |
| 463 | 3300005436 | Ga0070713_100320689 | Ga0070713_1003206892 | 317 |
| 464 | 3300005535 | Ga0070684_100109119 | Ga0070684_1001091193 | 317 |
| 465 | 3300013307 | Ga0157372_10338733 | Ga0157372_103387332 | 317 |
| 466 | 3300005328 | Ga0070676_10005548 | Ga0070676_100055483 | 318 |
| 467 | 3300005329 | Ga0070683_100010936 | Ga0070683_1000109366 | 318 |
| 468 | 3300005334 | Ga0068869_100007519 | Ga0068869_1000075199 | 318 |
| 469 | 3300005335 | Ga0070666_10090108 | Ga0070666_100901082 | 318 |
| 470 | 3300005338 | Ga0068868_100019745 | Ga0068868_1000197453 | 318 |
| 471 | 3300005339 | Ga0070660_100107396 | Ga0070660_1001073963 | 318 |
| 472 | 3300005340 | Ga0070689_100000673 | Ga0070689_1000006733 | 318 |
| 473 | 3300005344 | Ga0070661_100015888 | Ga0070661_1000158886 | 318 |
| 474 | 3300005345 | Ga0070692_10011319 | Ga0070692_100113194 | 318 |
| 475 | 3300005354 | Ga0070675_100027621 | Ga0070675_1000276212 | 318 |
| 476 | 3300005364 | Ga0070673_100166286 | Ga0070673_1001662861 | 318 |
| 477 | 3300005365 | Ga0070688_100006897 | Ga0070688_1000068972 | 318 |
| 478 | 3300005366 | Ga0070659_100023675 | Ga0070659_1000236751 | 318 |
| 479 | 3300005367 | Ga0070667_100004756 | Ga0070667_10000475610 | 318 |
| 480 | 3300005438 | Ga0070701_10009405 | Ga0070701_100094053 | 318 |
| 481 | 3300005441 | Ga0070700_100160313 | Ga0070700_1001603132 | 318 |
| 482 | 3300005457 | Ga0070662_100008714 | Ga0070662_1000087146 | 318 |
| 483 | 3300005466 | Ga0070685_10169594 | Ga0070685_101695942 | 318 |
| 484 | 3300005535 | Ga0070684_100022016 | Ga0070684_1000220161 | 318 |
| 485 | 3300005535 | Ga0070684_100131382 | Ga0070684_1001313822 | 318 |
| 486 | 3300005539 | Ga0068853_100027500 | Ga0068853_1000275005 | 318 |
| 487 | 3300005543 | Ga0070672_100001468 | Ga0070672_10000146817 | 318 |
| 488 | 3300005544 | Ga0070686_100060968 | Ga0070686_1000609683 | 318 |
| 489 | 3300005545 | Ga0070695_100187528 | Ga0070695_1001875282 | 318 |
| 490 | 3300005564 | Ga0070664_100081297 | Ga0070664_1000812971 | 318 |
| 491 | 3300005616 | Ga0068852_100020184 | Ga0068852_1000201843 | 318 |
| 492 | 3300005617 | Ga0068859_100059864 | Ga0068859_1000598644 | 318 |
| 493 | 3300005719 | Ga0068861_100003887 | Ga0068861_1000038873 | 318 |
| 494 | 3300005834 | Ga0068851_10007015 | Ga0068851_100070155 | 318 |
| 495 | 3300005841 | Ga0068863_100029541 | Ga0068863_1000295413 | 318 |
| 496 | 3300005843 | Ga0068860_100009628 | Ga0068860_1000096289 | 318 |
| 497 | 3300005844 | Ga0068862_100004451 | Ga0068862_1000044519 | 318 |
| 498 | 3300006175 | Ga0070712_100073409 | Ga0070712_1000734093 | 318 |
| 499 | 3300006871 | Ga0075434_100051238 | Ga0075434_1000512382 | 318 |
| 500 | 3300006931 | Ga0097620_100059864 | Ga0097620_1000598644 | 318 |
| 501 | 3300009094 | Ga0111539_10034308 | Ga0111539_100343083 | 318 |
| 502 | 3300009177 | Ga0105248_10027659 | Ga0105248_100276592 | 318 |
| 503 | 3300009553 | Ga0105249_10007249 | Ga0105249_100072492 | 318 |
| 504 | 3300010375 | Ga0105239_10198360 | Ga0105239_101983602 | 318 |
| 505 | 3300013102 | Ga0157371_10008559 | Ga0157371_100085596 | 318 |
| 506 | 3300013104 | Ga0157370_10004041 | Ga0157370_100040418 | 318 |
| 507 | 3300013306 | Ga0163162_10005364 | Ga0163162_100053643 | 318 |
| 508 | 3300013308 | Ga0157375_10006108 | Ga0157375_100061089 | 318 |
| 509 | 3300014745 | Ga0157377_10008970 | Ga0157377_100089703 | 318 |
| 510 | 3300014968 | Ga0157379_10000965 | Ga0157379_100009655 | 318 |
| 511 | 3300025315 | Ga0207697_10002065 | Ga0207697_1000206511 | 318 |
| 512 | 3300025321 | Ga0207656_10044004 | Ga0207656_100440042 | 318 |
| 513 | 3300025903 | Ga0207680_10096221 | Ga0207680_100962213 | 318 |
| 514 | 3300025907 | Ga0207645_10001564 | Ga0207645_1000156415 | 318 |
| 515 | 3300025915 | Ga0207693_10262703 | Ga0207693_102627031 | 318 |
| 516 | 3300025918 | Ga0207662_10001820 | Ga0207662_1000182011 | 318 |
| 517 | 3300025919 | Ga0207657_10059375 | Ga0207657_100593753 | 318 |
| 518 | 3300025920 | Ga0207649_10004071 | Ga0207649_100040717 | 318 |
| 519 | 3300025923 | Ga0207681_10002478 | Ga0207681_1000247811 | 318 |
| 520 | 3300025926 | Ga0207659_10003670 | Ga0207659_1000367010 | 318 |
| 521 | 3300025932 | Ga0207690_10016616 | Ga0207690_100166163 | 318 |
| 522 | 3300025933 | Ga0207706_10001727 | Ga0207706_100017276 | 318 |
| 523 | 3300025936 | Ga0207670_10031206 | Ga0207670_100312062 | 318 |
| 524 | 3300025940 | Ga0207691_10000638 | Ga0207691_100006382 | 318 |
| 525 | 3300025942 | Ga0207689_10002056 | Ga0207689_1000205618 | 318 |
| 526 | 3300025944 | Ga0207661_10011257 | Ga0207661_100112575 | 318 |
| 527 | 3300025945 | Ga0207679_10043833 | Ga0207679_100438332 | 318 |
| 528 | 3300025945 | Ga0207679_10094610 | Ga0207679_100946103 | 318 |
| 529 | 3300025960 | Ga0207651_10061880 | Ga0207651_100618802 | 318 |
| 530 | 3300025961 | Ga0207712_10014017 | Ga0207712_100140173 | 318 |
| 531 | 3300025986 | Ga0207658_10027985 | Ga0207658_100279854 | 318 |
| 532 | 3300026035 | Ga0207703_10004720 | Ga0207703_1000472011 | 318 |
| 533 | 3300026067 | Ga0207678_10014153 | Ga0207678_100141533 | 318 |
| 534 | 3300026075 | Ga0207708_10063356 | Ga0207708_100633562 | 318 |
| 535 | 3300026088 | Ga0207641_10020169 | Ga0207641_100201695 | 318 |
| 536 | 3300026116 | Ga0207674_10018952 | Ga0207674_100189523 | 318 |
| 537 | 3300026118 | Ga0207675_100003791 | Ga0207675_1000037918 | 318 |
| 538 | 3300026142 | Ga0207698_10190767 | Ga0207698_101907672 | 318 |
| 539 | 3300027907 | Ga0207428_10119856 | Ga0207428_101198562 | 318 |
| 540 | 3300028380 | Ga0268265_10007327 | Ga0268265_1000732710 | 318 |
| 541 | 3300028381 | Ga0268264_10010283 | Ga0268264_100102835 | 318 |
| 542 | 3300031548 | Ga0307408_100009869 | Ga0307408_1000098694 | 318 |
| 543 | 3300031852 | Ga0307410_10029421 | Ga0307410_100294212 | 318 |
| 544 | 3300031901 | Ga0307406_10158389 | Ga0307406_101583892 | 318 |
| 545 | 3300032002 | Ga0307416_100084627 | Ga0307416_1000846272 | 318 |
| 546 | 3300035118 | Ga0373954_0057986 | Ga0373954_0057986_469_1605 | 318 |
| 547 | 3300035119 | Ga0373956_0018712 | Ga0373956_0018712_851_1987 | 318 |
| 548 | 3300045051 | Ga0451576_0042270 | Ga0451576_0042270_2380_3531 | 318 |
| 549 | 3300048911 | Ga0496108_0160804 | Ga0496108_0160804_105_1256 | 318 |
| 550 | 3300050512 | nmdc:mga0n895_57823_c1 | nmdc:mga0n895_57823_c1_930_2081 | 318 |
| 551 | 3300050515 | nmdc:mga0a205_89215_c1 | nmdc:mga0a205_89215_c1_382_1533 | 318 |
| 552 | 3300006846 | Ga0075430_100020317 | Ga0075430_1000203174 | 319 |
| 553 | 3300006847 | Ga0075431_100066919 | Ga0075431_1000669194 | 319 |
| 554 | 3300006880 | Ga0075429_100102583 | Ga0075429_1001025832 | 319 |
| 555 | 3300050508 | nmdc:mga09592_197745_c1 | nmdc:mga09592_197745_c1_489_1634 | 319 |
| 556 | 3300050509 | nmdc:mga0qj67_53175_c1 | nmdc:mga0qj67_53175_c1_1635_2780 | 319 |
| 557 | 3300031852 | Ga0307410_10027657 | Ga0307410_100276572 | 320 |
| 558 | 3300032004 | Ga0307414_10025192 | Ga0307414_100251922 | 320 |
| 559 | 3300032005 | Ga0307411_10007734 | Ga0307411_100077345 | 320 |
| 560 | 3300026041 | Ga0207639_10056943 | Ga0207639_100569433 | 321 |
| 561 | 3300046511 | Ga0495608_0062335 | Ga0495608_0062335_275_1408 | 321 |
| 562 | 3300006852 | Ga0075433_10013426 | Ga0075433_100134263 | 322 |
| 563 | 3300006871 | Ga0075434_100012135 | Ga0075434_1000121359 | 322 |
| 564 | 3300009147 | Ga0114129_10075335 | Ga0114129_100753352 | 322 |
| 565 | 3300035086 | Ga0373934_0004878 | Ga0373934_0004878_847_1980 | 322 |
| 566 | 3300035120 | Ga0373957_0038499 | Ga0373957_0038499_98_1231 | 322 |
| 567 | 3300036401 | Ga0373937_0005107 | Ga0373937_0005107_8613_9746 | 322 |
| 568 | 3300046477 | Ga0495664_0012098 | Ga0495664_0012098_684_1817 | 322 |
| 569 | 3300046516 | Ga0495628_0018170 | Ga0495628_0018170_1380_2513 | 322 |
| 570 | 3300046529 | Ga0495652_0018708 | Ga0495652_0018708_1714_2847 | 322 |
| 571 | 3300046536 | Ga0495587_0015658 | Ga0495587_0015658_1965_3098 | 322 |
| 572 | 3300046543 | Ga0495645_0028533 | Ga0495645_0028533_977_2110 | 322 |
| 573 | 3300046678 | Ga0495599_0000646 | Ga0495599_0000646_6258_7391 | 322 |
| 574 | 3300046680 | Ga0495646_0086317 | Ga0495646_0086317_225_1358 | 322 |
| 575 | 3300047317 | Ga0495604_0006036 | Ga0495604_0006036_3201_4334 | 322 |
| 576 | 3300047444 | Ga0495675_0008607 | Ga0495675_0008607_1497_2630 | 322 |
| 577 | 3300047471 | Ga0495684_0005686 | Ga0495684_0005686_6938_8071 | 322 |
| 578 | 3300050507 | nmdc:mga05p37_58807_c1 | nmdc:mga05p37_58807_c1_3149_4300 | 322 |
| 579 | 3300050512 | nmdc:mga0n895_8015_c1 | nmdc:mga0n895_8015_c1_1322_2473 | 322 |
| 580 | 3300050515 | nmdc:mga0a205_4663_c2 | nmdc:mga0a205_4663_c2_7098_8249 | 322 |
| 581 | 3300053077 | Ga0495601_0046087 | Ga0495601_0046087_972_2105 | 322 |
| 582 | 3300053078 | Ga0495612_0078174 | Ga0495612_0078174_201_1334 | 322 |
| 583 | 3300053084 | Ga0495595_0125096 | Ga0495595_0125096_75_1208 | 322 |
| 584 | 3300006846 | Ga0075430_100000259 | Ga0075430_10000025919 | 323 |
| 585 | 3300050509 | nmdc:mga0qj67_931_c1 | nmdc:mga0qj67_931_c1_12564_13730 | 323 |
| 586 | 3300005329 | Ga0070683_100000588 | Ga0070683_10000058827 | 325 |
| 587 | 3300005459 | Ga0068867_100093316 | Ga0068867_1000933162 | 325 |
| 588 | 3300005535 | Ga0070684_100037766 | Ga0070684_1000377665 | 325 |
| 589 | 3300006844 | Ga0075428_100031278 | Ga0075428_1000312785 | 325 |
| 590 | 3300025937 | Ga0207669_10193613 | Ga0207669_101936132 | 325 |
| 591 | 3300025944 | Ga0207661_10008476 | Ga0207661_100084767 | 325 |
| 592 | 3300026089 | Ga0207648_10017643 | Ga0207648_100176434 | 325 |
| 593 | 3300049570 | Ga0501033_0009596 | Ga0501033_0009596_5351_6484 | 325 |
| 594 | 3300049823 | Ga0501044_0002752 | Ga0501044_0002752_5351_6484 | 325 |
| 595 | 3300009176 | Ga0105242_10132940 | Ga0105242_101329402 | 326 |
| 596 | 3300005614 | Ga0068856_100010080 | Ga0068856_1000100808 | 327 |
| 597 | 3300026078 | Ga0207702_10031714 | Ga0207702_100317144 | 327 |
| 598 | 3300047444 | Ga0495675_0005499 | Ga0495675_0005499_774_1907 | 328 |
| 599 | 3300005445 | Ga0070708_100000006 | Ga0070708_10000000697 | 329 |
| 600 | 3300005530 | Ga0070679_100389496 | Ga0070679_1003894961 | 329 |
| 601 | 3300035086 | Ga0373934_0059671 | Ga0373934_0059671_213_1346 | 329 |
| 602 | 3300035119 | Ga0373956_0010255 | Ga0373956_0010255_1471_2604 | 329 |
| 603 | 3300035120 | Ga0373957_0089798 | Ga0373957_0089798_32_1174 | 329 |
| 604 | 3300035172 | Ga0373955_0004323 | Ga0373955_0004323_3695_4828 | 329 |
| 605 | 3300035724 | Ga0373933_0004718 | Ga0373933_0004718_5074_6207 | 329 |
| 606 | 3300036401 | Ga0373937_0003528 | Ga0373937_0003528_5656_6789 | 329 |
| 607 | 3300046462 | Ga0495651_0083453 | Ga0495651_0083453_1045_2178 | 329 |
| 608 | 3300046536 | Ga0495587_0002876 | Ga0495587_0002876_437_1570 | 329 |
| 609 | 3300046543 | Ga0495645_0000316 | Ga0495645_0000316_28443_29576 | 329 |
| 610 | 3300046559 | Ga0495667_0108423 | Ga0495667_0108423_571_1704 | 329 |
| 611 | 3300046678 | Ga0495599_0024374 | Ga0495599_0024374_2173_3306 | 329 |
| 612 | 3300049581 | Ga0501047_0026840 | Ga0501047_0026840_1567_2700 | 329 |
| 613 | 3300003203 | JGI25406J46586_10028962 | JGI25406J46586_100289622 | 334 |
| 614 | 3300005985 | Ga0081539_10000807 | Ga0081539_100008073 | 334 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar