metagRoot

F469412

General Info

Members	Datasets	Scaffolds	Average Seq Length
615	260	615	158

Family's Representative Sequence

Representative Sequence	3300003579\|Ga0007429J51699_1037686\|Ga0007429J51699_10376862
Length	155
Sequence	MVEDDCLPDDPRALTPEVFEFVVSNELKRAMRSQNFVTLLLVDPMPRSTEHQRSELVRELARVIGRVVRETDILSPGRDGRLSVVLLDADFDSSMQVVDRLMTWVEHYEFRTPASFAIGAATSPTHGVDLTSLRSAAAARPVQPRREPRGSSHAQ

Samples

	Sample ID	Description	Type	Environment
1	2162886012	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1	Metagenome	Rhizosphere
2	3300002076	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3	Metagenome	Rhizosphere
3	3300003579	Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
4	3300003693	Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
5	3300004799	Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
6	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
7	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
8	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
9	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
10	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
11	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
12	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
13	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
14	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
15	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
16	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
17	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
18	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
19	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
20	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
21	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
22	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
23	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
24	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
25	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
26	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
27	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
28	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
29	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
30	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
31	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
32	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
33	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
34	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
35	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
36	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
37	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
38	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
39	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
40	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
41	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
42	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
43	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
44	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
45	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
46	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
47	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
48	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
49	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
50	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
51	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
52	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
53	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
54	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
55	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
56	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
57	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
58	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
59	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
60	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
61	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
62	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
63	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
64	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
65	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
66	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
67	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
68	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
69	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
70	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
71	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
72	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
73	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
74	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
75	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
76	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
77	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
78	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
79	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
80	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
81	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
82	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
83	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
84	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
85	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
86	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
87	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
88	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
89	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
90	3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Metagenome	Rhizosphere
91	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
92	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
93	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
94	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
95	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
96	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
97	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
98	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
99	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
100	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
101	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
102	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
103	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
104	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
105	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
106	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
107	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
108	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
109	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
110	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
111	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
112	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
113	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
114	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
115	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
116	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
117	3300020069	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
118	3300020075	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
119	3300020076	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3)	Metatranscriptome	Rhizosphere
120	3300020080	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
121	3300022467	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
122	3300025271	Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
154	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
155	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
156	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
157	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
158	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
159	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
160	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
161	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
162	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
163	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
164	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
165	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
166	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
167	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
168	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
169	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
170	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
171	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
172	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
173	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
174	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
175	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
176	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
177	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
178	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
179	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
180	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
181	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
182	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
183	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
184	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
185	3300034816	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3	Metagenome	Rhizosphere
186	3300034817	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1	Metagenome	Rhizosphere
187	3300034818	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3	Metagenome	Rhizosphere
188	3300034819	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1	Metagenome	Rhizosphere
189	3300034957	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2	Metagenome	Rhizosphere
190	3300035084	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1	Metagenome	Rhizosphere
191	3300035085	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2	Metagenome	Rhizosphere
192	3300035088	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4	Metagenome	Rhizosphere
193	3300035090	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2	Metagenome	Rhizosphere
194	3300035091	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4	Metagenome	Rhizosphere
195	3300035092	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11	Metagenome	Rhizosphere
196	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
197	3300035114	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3	Metagenome	Rhizosphere
198	3300035115	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11	Metagenome	Rhizosphere
199	3300035121	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3	Metagenome	Rhizosphere
200	3300035207	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16	Metagenome	Rhizosphere
201	3300035241	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4	Metagenome	Rhizosphere
202	3300035242	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11	Metagenome	Rhizosphere
203	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
204	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
205	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
206	3300041997	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607	Metagenome	Rhizosphere
207	3300041999	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297	Metagenome	Rhizosphere
208	3300042002	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616	Metagenome	Rhizosphere
209	3300042436	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520	Metagenome	Rhizosphere
210	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
211	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
212	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
213	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
214	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
215	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
216	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
217	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
218	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
219	3300047445	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere	Metagenome	Rhizosphere
220	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
221	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
222	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
223	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
224	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
225	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
226	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
227	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
228	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
229	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
230	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
231	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
232	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
233	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
234	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
235	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
236	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
237	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
238	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
239	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
240	3300049679	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought	Metagenome	Rhizosphere
241	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
242	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
243	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
244	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
245	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
246	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
247	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
248	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
249	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
250	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
251	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
252	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
253	3300059492	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
254	3300059493	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
255	3300059504	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
256	3300059505	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
257	3300059506	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
258	3300059510	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
259	3300059511	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
260	3300059643	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	95.77
Metatranscriptomes	4.23
Isolates	0

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	0
Nodule	0
Rhizoplane	3.09
Rhizosphere	96.91
Stem	0
Stem Tuber	0
Unclassified	0

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	MBSR1b_contig_3988905	2162886012	Unclassified	904
2	JGI24749J21850_1037714	3300002076	Bacteria	703
3	Ga0007429J51699_1037686	3300003579	Bacteria	3204
4	Ga0032354_1014169	3300003693	Bacteria	3001
5	Ga0032354_1023852	3300003693	Bacteria	1729
6	Ga0058863_11338496	3300004799	Unclassified	787
7	Ga0065712_10081966	3300005290	Bacteria	2959
8	Ga0065712_10135893	3300005290	Unclassified	1498
9	Ga0065715_10053684	3300005293	Bacteria	858
10	Ga0065715_10163139	3300005293	Bacteria	1610
11	Ga0065715_10172726	3300005293	Unclassified	1534
12	Ga0065715_10603088	3300005293	Unclassified	706
13	Ga0065715_10611770	3300005293	Unclassified	701
14	Ga0065715_10691630	3300005293	Bacteria	657
15	Ga0065715_10830547	3300005293	Bacteria	599
16	Ga0065707_10085075	3300005295	Bacteria	6486
17	Ga0065707_10940366	3300005295	Unclassified	555
18	Ga0070676_10000763	3300005328	Bacteria	15827
19	Ga0070683_100003522	3300005329	Bacteria	12743
20	Ga0070683_100288775	3300005329	Bacteria	1560
21	Ga0070690_100013551	3300005330	Bacteria	4821
22	Ga0070690_100361790	3300005330	Bacteria	1056
23	Ga0070690_100590382	3300005330	Bacteria	842
24	Ga0070670_100030473	3300005331	Bacteria	4646
25	Ga0070670_100086604	3300005331	Bacteria	2692
26	Ga0070670_100146759	3300005331	Bacteria	2041
27	Ga0070670_100770208	3300005331	Unclassified	868
28	Ga0070677_10110631	3300005333	Bacteria	1226
29	Ga0070677_10186267	3300005333	Bacteria	992
30	Ga0068869_100432993	3300005334	Bacteria	1087
31	Ga0070666_10005812	3300005335	Bacteria	7580
32	Ga0070666_10083749	3300005335	Bacteria	2182
33	Ga0070666_10420662	3300005335	Bacteria	962
34	Ga0070680_100188550	3300005336	Bacteria	1737
35	Ga0070682_100629760	3300005337	Bacteria	851
36	Ga0070660_100008449	3300005339	Bacteria	7200
37	Ga0070660_100487292	3300005339	Bacteria	1025
38	Ga0070689_100011222	3300005340	Bacteria	6413
39	Ga0070689_100409051	3300005340	Unclassified	1148
40	Ga0070691_10004968	3300005341	Bacteria	6053
41	Ga0070691_10588280	3300005341	Unclassified	655
42	Ga0070687_100277216	3300005343	Bacteria	1054
43	Ga0070661_100045046	3300005344	Bacteria	3224
44	Ga0070661_100121092	3300005344	Bacteria	1960
45	Ga0070661_100388134	3300005344	Bacteria	1102
46	Ga0070692_10105692	3300005345	Bacteria	1550
47	Ga0070692_10301965	3300005345	Bacteria	978
48	Ga0070668_100024615	3300005347	Bacteria	4561
49	Ga0070669_100000228	3300005353	Bacteria	46855
50	Ga0070669_100003701	3300005353	Bacteria	11034
51	Ga0070669_100013463	3300005353	Bacteria	5814
52	Ga0070669_100055379	3300005353	Bacteria	2906
53	Ga0070669_100292773	3300005353	Unclassified	1307
54	Ga0070669_100529076	3300005353	Bacteria	981
55	Ga0070669_101856832	3300005353	Bacteria	526
56	Ga0070675_100007889	3300005354	Bacteria	8252
57	Ga0070675_100067925	3300005354	Bacteria	2950
58	Ga0070675_100331687	3300005354	Bacteria	1346
59	Ga0070675_100336715	3300005354	Bacteria	1336
60	Ga0070675_100904085	3300005354	Unclassified	809
61	Ga0070671_100017318	3300005355	Bacteria	5835
62	Ga0070671_100529931	3300005355	Bacteria	1015
63	Ga0070674_100005875	3300005356	Bacteria	7135
64	Ga0070674_100014705	3300005356	Bacteria	4869
65	Ga0070674_100044893	3300005356	Bacteria	3017
66	Ga0070673_100020854	3300005364	Bacteria	4736
67	Ga0070673_100078663	3300005364	Bacteria	2668
68	Ga0070673_100387004	3300005364	Bacteria	1248
69	Ga0070673_101069737	3300005364	Bacteria	753
70	Ga0070688_100005127	3300005365	Bacteria	6870
71	Ga0070688_100372385	3300005365	Bacteria	1051
72	Ga0070659_100356421	3300005366	Unclassified	1228
73	Ga0070659_100857414	3300005366	Unclassified	792
74	Ga0070667_100059084	3300005367	Bacteria	3243
75	Ga0070667_100086979	3300005367	Bacteria	2682
76	Ga0070667_100226391	3300005367	Unclassified	1666
77	Ga0070667_101446192	3300005367	Bacteria	645
78	Ga0070714_100039469	3300005435	Bacteria	3975
79	Ga0070713_100042527	3300005436	Bacteria	3709
80	Ga0070701_10064551	3300005438	Bacteria	1941
81	Ga0070701_10191437	3300005438	Unclassified	1204
82	Ga0070705_100006125	3300005440	Bacteria	5889
83	Ga0070705_100007546	3300005440	Bacteria	5356
84	Ga0070705_100235739	3300005440	Bacteria	1276
85	Ga0070700_100401847	3300005441	Unclassified	1030
86	Ga0070700_100606181	3300005441	Bacteria	859
87	Ga0070700_100612460	3300005441	Bacteria	855
88	Ga0070700_101192520	3300005441	Bacteria	635
89	Ga0070694_100000362	3300005444	Bacteria	24335
90	Ga0070694_100002253	3300005444	Bacteria	11404
91	Ga0070694_100210420	3300005444	Bacteria	1454
92	Ga0070694_100300679	3300005444	Unclassified	1229
93	Ga0070663_100090165	3300005455	Bacteria	2270
94	Ga0070678_100306828	3300005456	Bacteria	1351
95	Ga0070678_100991389	3300005456	Unclassified	772
96	Ga0070662_100324998	3300005457	Bacteria	1255
97	Ga0070662_100411769	3300005457	Bacteria	1117
98	Ga0070662_100452372	3300005457	Bacteria	1066
99	Ga0070681_10063451	3300005458	Bacteria	3667
100	Ga0068867_100025932	3300005459	Bacteria	4205
101	Ga0068867_101609579	3300005459	Unclassified	607
102	Ga0070685_10062660	3300005466	Bacteria	2181
103	Ga0070707_100444031	3300005468	Bacteria	1258
104	Ga0070707_100692754	3300005468	Unclassified	982
105	Ga0070707_101553567	3300005468	Unclassified	629
106	Ga0070698_100004420	3300005471	Bacteria	15447
107	Ga0070698_100052870	3300005471	Bacteria	4130
108	Ga0070698_100288945	3300005471	Bacteria	1571
109	Ga0070698_100647452	3300005471	Unclassified	998
110	Ga0070698_100917603	3300005471	Bacteria	822
111	Ga0070699_100061651	3300005518	Bacteria	3250
112	Ga0070699_100375564	3300005518	Unclassified	1283
113	Ga0070699_100655005	3300005518	Bacteria	959
114	Ga0070679_100415137	3300005530	Bacteria	1291
115	Ga0070679_100466090	3300005530	Bacteria	1208
116	Ga0070684_100040909	3300005535	Bacteria	3993
117	Ga0070684_100800228	3300005535	Bacteria	881
118	Ga0070697_100038429	3300005536	Bacteria	3867
119	Ga0070697_100319653	3300005536	Bacteria	1336
120	Ga0068853_100622650	3300005539	Bacteria	1026
121	Ga0068853_100768770	3300005539	Bacteria	921
122	Ga0070672_100052904	3300005543	Bacteria	3172
123	Ga0070672_100094732	3300005543	Bacteria	2414
124	Ga0070672_100325404	3300005543	Bacteria	1307
125	Ga0070686_100000779	3300005544	Bacteria	18447
126	Ga0070686_100157815	3300005544	Bacteria	1595
127	Ga0070695_100000129	3300005545	Bacteria	34259
128	Ga0070695_100002942	3300005545	Bacteria	9925
129	Ga0070695_100085252	3300005545	Bacteria	2097
130	Ga0070695_101080253	3300005545	Bacteria	656
131	Ga0070695_101153404	3300005545	Bacteria	636
132	Ga0070696_100000326	3300005546	Bacteria	28984
133	Ga0070696_100000859	3300005546	Bacteria	19621
134	Ga0070696_100004309	3300005546	Bacteria	9483
135	Ga0070696_100093718	3300005546	Bacteria	2142
136	Ga0070696_100160161	3300005546	Bacteria	1658
137	Ga0070696_100218708	3300005546	Bacteria	1428
138	Ga0070665_100076698	3300005548	Bacteria	3349
139	Ga0070665_100082374	3300005548	Bacteria	3223
140	Ga0070665_100609266	3300005548	Bacteria	1105
141	Ga0070704_100000419	3300005549	Bacteria	19726
142	Ga0070704_100004925	3300005549	Bacteria	7752
143	Ga0070704_100050763	3300005549	Bacteria	2917
144	Ga0070704_100109400	3300005549	Bacteria	2100
145	Ga0070704_100752923	3300005549	Bacteria	867
146	Ga0070704_101866462	3300005549	Bacteria	557
147	Ga0068855_100014774	3300005563	Bacteria	9404
148	Ga0068855_100400680	3300005563	Bacteria	1504
149	Ga0070664_100002748	3300005564	Bacteria	14202
150	Ga0070664_100126123	3300005564	Bacteria	2246
151	Ga0070664_100822452	3300005564	Unclassified	869
152	Ga0070664_100925525	3300005564	Bacteria	818
153	Ga0068857_100118730	3300005577	Bacteria	2380
154	Ga0068854_100003229	3300005578	Bacteria	10163
155	Ga0068854_100025634	3300005578	Bacteria	4047
156	Ga0068854_100274011	3300005578	Bacteria	1356
157	Ga0068854_100751220	3300005578	Bacteria	846
158	Ga0068854_101163494	3300005578	Bacteria	690
159	Ga0070702_100001602	3300005615	Bacteria	9350
160	Ga0070702_100262423	3300005615	Bacteria	1177
161	Ga0068852_100100811	3300005616	Unclassified	2606
162	Ga0068859_100001505	3300005617	Bacteria	23755
163	Ga0068859_100134332	3300005617	Bacteria	2546
164	Ga0068859_100463966	3300005617	Bacteria	1362
165	Ga0068859_100678229	3300005617	Unclassified	1122
166	Ga0068864_100025835	3300005618	Bacteria	4948
167	Ga0068864_100548700	3300005618	Unclassified	1117
168	Ga0068864_101046066	3300005618	Bacteria	811
169	Ga0068864_101286781	3300005618	Bacteria	731
170	Ga0068866_10138178	3300005718	Unclassified	1395
171	Ga0068861_100001737	3300005719	Bacteria	13978
172	Ga0068861_100040889	3300005719	Bacteria	3470
173	Ga0068861_100100376	3300005719	Bacteria	2300
174	Ga0068870_10229694	3300005840	Bacteria	1140
175	Ga0068870_10299728	3300005840	Bacteria	1014
176	Ga0068870_10860298	3300005840	Bacteria	638
177	Ga0068863_100723859	3300005841	Bacteria	990
178	Ga0068858_100001553	3300005842	Bacteria	23546
179	Ga0068858_100019178	3300005842	Bacteria	6398
180	Ga0068858_100042658	3300005842	Bacteria	4206
181	Ga0068858_100054581	3300005842	Bacteria	3694
182	Ga0068858_100098239	3300005842	Bacteria	2730
183	Ga0068858_100137555	3300005842	Bacteria	2292
184	Ga0068858_100208587	3300005842	Bacteria	1849
185	Ga0068858_101199587	3300005842	Bacteria	746
186	Ga0068860_100002653	3300005843	Bacteria	18615
187	Ga0068860_100128405	3300005843	Bacteria	2431
188	Ga0068860_100247329	3300005843	Bacteria	1736
189	Ga0068860_100806161	3300005843	Unclassified	952
190	Ga0068862_100009142	3300005844	Bacteria	8204
191	Ga0068862_100078903	3300005844	Bacteria	2853
192	Ga0068862_100396555	3300005844	Unclassified	1290
193	Ga0081539_10017495	3300005985	Bacteria	5028
194	Ga0075432_10034441	3300006058	Bacteria	1759
195	Ga0075432_10167407	3300006058	Bacteria	853
196	Ga0070715_10128767	3300006163	Bacteria	1216
197	Ga0070716_100071612	3300006173	Bacteria	2038
198	Ga0070712_100923421	3300006175	Bacteria	753
199	Ga0097621_101150332	3300006237	Bacteria	730
200	Ga0068871_100058966	3300006358	Bacteria	3127
201	Ga0068871_100305010	3300006358	Bacteria	1399
202	Ga0068871_100506431	3300006358	Bacteria	1089
203	Ga0068871_100513054	3300006358	Unclassified	1082
204	Ga0075428_100006301	3300006844	Bacteria	13189
205	Ga0075428_100695633	3300006844	Bacteria	1083
206	Ga0075430_101058967	3300006846	Bacteria	668
207	Ga0075431_100020573	3300006847	Bacteria	6743
208	Ga0075431_100037241	3300006847	Bacteria	5013
209	Ga0075431_100155014	3300006847	Bacteria	2357
210	Ga0075433_10010180	3300006852	Bacteria	7543
211	Ga0075433_10086115	3300006852	Bacteria	2774
212	Ga0075433_10191313	3300006852	Bacteria	1820
213	Ga0075433_10223949	3300006852	Bacteria	1670
214	Ga0075433_10665800	3300006852	Unclassified	912
215	Ga0075433_10906027	3300006852	Unclassified	769
216	Ga0075434_100001876	3300006871	Bacteria	18188
217	Ga0075434_100028906	3300006871	Bacteria	5451
218	Ga0075434_100062315	3300006871	Unclassified	3712
219	Ga0075434_100066519	3300006871	Bacteria	3590
220	Ga0075434_100116737	3300006871	Bacteria	2682
221	Ga0075434_100283095	3300006871	Bacteria	1677
222	Ga0075434_100326118	3300006871	Bacteria	1556
223	Ga0075434_100420557	3300006871	Bacteria	1357
224	Ga0075434_100833781	3300006871	Bacteria	938
225	Ga0075429_100079979	3300006880	Bacteria	2849
226	Ga0075429_100488356	3300006880	Unclassified	1079
227	Ga0068865_100255791	3300006881	Unclassified	1384
228	Ga0068865_100404425	3300006881	Bacteria	1119
229	Ga0068865_100417836	3300006881	Unclassified	1102
230	Ga0068865_100612161	3300006881	Bacteria	922
231	Ga0075436_100011952	3300006914	Bacteria	5953
232	Ga0075436_100038151	3300006914	Bacteria	3316
233	Ga0075436_100105635	3300006914	Bacteria	1964
234	Ga0097620_100001505	3300006931	Bacteria	23755
235	Ga0097620_100134336	3300006931	Bacteria	2546
236	Ga0097620_100463986	3300006931	Bacteria	1362
237	Ga0097620_100678247	3300006931	Unclassified	1122
238	Ga0075435_100001224	3300007076	Bacteria	16438
239	Ga0075435_100001247	3300007076	Bacteria	16274
240	Ga0075435_100014978	3300007076	Bacteria	5817
241	Ga0075435_100022227	3300007076	Bacteria	4891
242	Ga0075435_100042996	3300007076	Unclassified	3616
243	Ga0075435_100049687	3300007076	Bacteria	3373
244	Ga0075435_100254587	3300007076	Bacteria	1495
245	Ga0075435_100270464	3300007076	Bacteria	1449
246	Ga0099794_10076408	3300007265	Bacteria	1646
247	Ga0105251_10099062	3300009011	Bacteria	1333
248	Ga0105240_10011240	3300009093	Bacteria	12482
249	Ga0105240_10019697	3300009093	Bacteria	9011
250	Ga0105240_10120866	3300009093	Unclassified	3154
251	Ga0105240_10620858	3300009093	Bacteria	1188
252	Ga0111539_10000909	3300009094	Bacteria	38680
253	Ga0111539_10001152	3300009094	Bacteria	34963
254	Ga0111539_10074895	3300009094	Unclassified	3989
255	Ga0111539_11155819	3300009094	Bacteria	899
256	Ga0105245_10204289	3300009098	Bacteria	1899
257	Ga0105245_10885126	3300009098	Bacteria	934
258	Ga0105245_10954133	3300009098	Unclassified	901
259	Ga0105245_11195785	3300009098	Unclassified	808
260	Ga0105247_10005097	3300009101	Bacteria	8326
261	Ga0114129_10000387	3300009147	Bacteria	51335
262	Ga0114129_10005534	3300009147	Bacteria	17866
263	Ga0114129_10009842	3300009147	Bacteria	13636
264	Ga0114129_10018948	3300009147	Bacteria	9802
265	Ga0114129_10023734	3300009147	Bacteria	8694
266	Ga0114129_10037493	3300009147	Bacteria	6843
267	Ga0114129_10064605	3300009147	Bacteria	5108
268	Ga0114129_10154822	3300009147	Bacteria	3135
269	Ga0114129_10336746	3300009147	Bacteria	2002
270	Ga0114129_11940761	3300009147	Unclassified	713
271	Ga0105243_10009972	3300009148	Bacteria	7219
272	Ga0105241_10096964	3300009174	Bacteria	2337
273	Ga0105241_10915337	3300009174	Bacteria	815
274	Ga0105242_10206416	3300009176	Bacteria	1748
275	Ga0105242_10256071	3300009176	Unclassified	1579
276	Ga0105242_10432959	3300009176	Unclassified	1235
277	Ga0105242_12004092	3300009176	Bacteria	621
278	Ga0105248_10011006	3300009177	Bacteria	9980
279	Ga0105248_10100655	3300009177	Bacteria	3257
280	Ga0105248_10125882	3300009177	Bacteria	2891
281	Ga0105248_10182805	3300009177	Bacteria	2362
282	Ga0105248_10241400	3300009177	Unclassified	2034
283	Ga0105248_10596074	3300009177	Bacteria	1247
284	Ga0105248_11993465	3300009177	Bacteria	659
285	Ga0105238_10211954	3300009551	Bacteria	1913
286	Ga0105249_10001512	3300009553	Bacteria	20401
287	Ga0105249_10377111	3300009553	Bacteria	1443
288	Ga0105249_10462924	3300009553	Bacteria	1308
289	Ga0105249_10756091	3300009553	Unclassified	1034
290	Ga0105249_11041907	3300009553	Bacteria	887
291	Ga0105239_10395175	3300010375	Bacteria	1564
292	Ga0105246_10342491	3300011119	Unclassified	1222
293	Ga0157370_10508646	3300013104	Bacteria	1106
294	Ga0157369_10464901	3300013105	Bacteria	1310
295	Ga0157378_11443137	3300013297	Bacteria	732
296	Ga0163162_10274419	3300013306	Bacteria	1818
297	Ga0163162_11075197	3300013306	Bacteria	911
298	Ga0163162_11744441	3300013306	Bacteria	711
299	Ga0157375_10137382	3300013308	Bacteria	2569
300	Ga0163163_10008666	3300014325	Bacteria	9045
301	Ga0163163_10248162	3300014325	Bacteria	1830
302	Ga0157380_10261095	3300014326	Bacteria	1573
303	Ga0157380_10344297	3300014326	Bacteria	1392
304	Ga0157380_10772221	3300014326	Unclassified	975
305	Ga0157380_11618850	3300014326	Bacteria	703
306	Ga0182008_10220919	3300014497	Bacteria	969
307	Ga0157377_10031601	3300014745	Bacteria	2878
308	Ga0157377_10331378	3300014745	Bacteria	1015
309	Ga0157379_10002707	3300014968	Bacteria	14945
310	Ga0157379_10221331	3300014968	Bacteria	1715
311	Ga0157379_10241067	3300014968	Bacteria	1640
312	Ga0157379_10746496	3300014968	Bacteria	921
313	Ga0157379_10942624	3300014968	Bacteria	821
314	Ga0182007_10115210	3300015262	Bacteria	897
315	Ga0163161_10236080	3300017792	Bacteria	1420
316	Ga0197907_11120794	3300020069	Bacteria	1808
317	Ga0206349_1626400	3300020075	Bacteria	586
318	Ga0206349_1670001	3300020075	Bacteria	815
319	Ga0206355_1040547	3300020076	Bacteria	605
320	Ga0206350_10255035	3300020080	Bacteria	866
321	Ga0224712_10005340	3300022467	Bacteria	3568
322	Ga0224712_10215309	3300022467	Bacteria	877
323	Ga0207666_1017931	3300025271	Bacteria	1025
324	Ga0207697_10048659	3300025315	Bacteria	1749
325	Ga0207697_10308463	3300025315	Bacteria	702
326	Ga0207682_10056606	3300025893	Bacteria	1633
327	Ga0207682_10139645	3300025893	Bacteria	1087
328	Ga0207642_10017151	3300025899	Bacteria	2747
329	Ga0207642_10375427	3300025899	Unclassified	845
330	Ga0207688_10249117	3300025901	Bacteria	1076
331	Ga0207688_10605111	3300025901	Bacteria	691
332	Ga0207680_10008430	3300025903	Bacteria	5060
333	Ga0207680_10068686	3300025903	Bacteria	2187
334	Ga0207685_10176312	3300025905	Unclassified	987
335	Ga0207645_10000346	3300025907	Bacteria	38743
336	Ga0207654_10053563	3300025911	Bacteria	2329
337	Ga0207695_10085672	3300025913	Bacteria	3179
338	Ga0207695_10172844	3300025913	Unclassified	2085
339	Ga0207695_10386202	3300025913	Unclassified	1285
340	Ga0207693_10392011	3300025915	Bacteria	1086
341	Ga0207693_10752108	3300025915	Bacteria	753
342	Ga0207660_10253835	3300025917	Unclassified	1388
343	Ga0207660_10449203	3300025917	Bacteria	1042
344	Ga0207662_10036020	3300025918	Bacteria	2891
345	Ga0207657_10002506	3300025919	Bacteria	19866
346	Ga0207657_10421778	3300025919	Bacteria	1049
347	Ga0207649_10087016	3300025920	Bacteria	2037
348	Ga0207649_10177964	3300025920	Bacteria	1487
349	Ga0207652_10079747	3300025921	Bacteria	2860
350	Ga0207652_10220857	3300025921	Bacteria	1707
351	Ga0207646_10116832	3300025922	Bacteria	2396
352	Ga0207646_10132814	3300025922	Bacteria	2241
353	Ga0207681_10007730	3300025923	Bacteria	6584
354	Ga0207681_10020412	3300025923	Bacteria	4198
355	Ga0207681_10262748	3300025923	Bacteria	1352
356	Ga0207681_10360790	3300025923	Bacteria	1165
357	Ga0207681_10829049	3300025923	Bacteria	773
358	Ga0207694_10145572	3300025924	Bacteria	1907
359	Ga0207650_10068841	3300025925	Bacteria	2659
360	Ga0207650_10136381	3300025925	Unclassified	1925
361	Ga0207659_10000069	3300025926	Bacteria	65505
362	Ga0207659_10256141	3300025926	Bacteria	1422
363	Ga0207659_10758355	3300025926	Bacteria	833
364	Ga0207687_10087390	3300025927	Bacteria	2265
365	Ga0207687_10392095	3300025927	Bacteria	1140
366	Ga0207687_10775139	3300025927	Unclassified	817
367	Ga0207700_10014835	3300025928	Bacteria	5118
368	Ga0207664_10480522	3300025929	Bacteria	1111
369	Ga0207644_10034270	3300025931	Bacteria	3552
370	Ga0207644_10199234	3300025931	Unclassified	1579
371	Ga0207644_10423287	3300025931	Bacteria	1091
372	Ga0207690_10040779	3300025932	Bacteria	3037
373	Ga0207706_10129428	3300025933	Bacteria	2220
374	Ga0207706_10177180	3300025933	Bacteria	1873
375	Ga0207706_10364972	3300025933	Bacteria	1254
376	Ga0207706_10391068	3300025933	Bacteria	1206
377	Ga0207706_10566248	3300025933	Unclassified	977
378	Ga0207706_11560479	3300025933	Bacteria	536
379	Ga0207686_10254491	3300025934	Bacteria	1285
380	Ga0207686_10370816	3300025934	Bacteria	1083
381	Ga0207709_10017859	3300025935	Bacteria	3966
382	Ga0207709_10020531	3300025935	Bacteria	3729
383	Ga0207670_10005697	3300025936	Bacteria	6862
384	Ga0207669_10003099	3300025937	Bacteria	7157
385	Ga0207669_10032896	3300025937	Bacteria	2919
386	Ga0207669_10060866	3300025937	Bacteria	2317
387	Ga0207704_10033119	3300025938	Bacteria	2935
388	Ga0207704_10511385	3300025938	Bacteria	970
389	Ga0207665_10071891	3300025939	Bacteria	2362
390	Ga0207691_10016350	3300025940	Bacteria	7043
391	Ga0207691_10306309	3300025940	Bacteria	1364
392	Ga0207691_10381783	3300025940	Bacteria	1203
393	Ga0207691_10625166	3300025940	Bacteria	911
394	Ga0207691_11181863	3300025940	Bacteria	635
395	Ga0207711_10066558	3300025941	Bacteria	3116
396	Ga0207711_10073119	3300025941	Bacteria	2979
397	Ga0207711_10322575	3300025941	Bacteria	1427
398	Ga0207711_10353778	3300025941	Bacteria	1360
399	Ga0207711_10719984	3300025941	Bacteria	931
400	Ga0207689_10431554	3300025942	Bacteria	1100
401	Ga0207689_10489783	3300025942	Bacteria	1030
402	Ga0207661_10035833	3300025944	Bacteria	3869
403	Ga0207661_10294103	3300025944	Bacteria	1454
404	Ga0207679_10068183	3300025945	Bacteria	2672
405	Ga0207679_10705853	3300025945	Unclassified	915
406	Ga0207679_11010163	3300025945	Unclassified	762
407	Ga0207667_10088858	3300025949	Bacteria	3195
408	Ga0207667_10235405	3300025949	Bacteria	1875
409	Ga0207667_11088976	3300025949	Bacteria	783
410	Ga0207651_10017921	3300025960	Bacteria	4198
411	Ga0207651_10021684	3300025960	Bacteria	3910
412	Ga0207651_10090277	3300025960	Bacteria	2239
413	Ga0207651_10494488	3300025960	Bacteria	1056
414	Ga0207651_10646492	3300025960	Bacteria	928
415	Ga0207712_10042225	3300025961	Unclassified	3139
416	Ga0207712_10352224	3300025961	Bacteria	1224
417	Ga0207668_10374012	3300025972	Bacteria	1197
418	Ga0207668_10391070	3300025972	Bacteria	1173
419	Ga0207640_10006369	3300025981	Bacteria	6474
420	Ga0207640_10204428	3300025981	Bacteria	1499
421	Ga0207640_10832009	3300025981	Bacteria	802
422	Ga0207658_10106920	3300025986	Bacteria	2204
423	Ga0207658_10282658	3300025986	Unclassified	1423
424	Ga0207658_10869418	3300025986	Bacteria	820
425	Ga0207677_10434350	3300026023	Bacteria	1121
426	Ga0207677_10867639	3300026023	Unclassified	812
427	Ga0207703_10028565	3300026035	Bacteria	4397
428	Ga0207703_10035651	3300026035	Bacteria	3954
429	Ga0207703_10060204	3300026035	Bacteria	3104
430	Ga0207703_10660885	3300026035	Unclassified	992
431	Ga0207639_10474314	3300026041	Bacteria	1139
432	Ga0207639_11092410	3300026041	Unclassified	748
433	Ga0207678_10097956	3300026067	Bacteria	2505
434	Ga0207708_10002322	3300026075	Bacteria	13972
435	Ga0207708_10067872	3300026075	Bacteria	2729
436	Ga0207708_10072644	3300026075	Bacteria	2636
437	Ga0207641_10152587	3300026088	Bacteria	2093
438	Ga0207648_10001795	3300026089	Bacteria	23516
439	Ga0207648_10029032	3300026089	Bacteria	4904
440	Ga0207676_10054172	3300026095	Bacteria	3142
441	Ga0207676_10343979	3300026095	Bacteria	1377
442	Ga0207676_10903645	3300026095	Bacteria	866
443	Ga0207674_10372236	3300026116	Bacteria	1381
444	Ga0207674_10970745	3300026116	Bacteria	818
445	Ga0207675_100000663	3300026118	Bacteria	33858
446	Ga0207675_100003988	3300026118	Bacteria	14320
447	Ga0207675_100155262	3300026118	Bacteria	2181
448	Ga0207675_100530686	3300026118	Unclassified	1174
449	Ga0207675_101216727	3300026118	Bacteria	774
450	Ga0207683_10018725	3300026121	Bacteria	5906
451	Ga0207683_10240755	3300026121	Bacteria	1650
452	Ga0207683_10279362	3300026121	Bacteria	1526
453	Ga0207683_10325090	3300026121	Unclassified	1409
454	Ga0207683_11022360	3300026121	Unclassified	767
455	Ga0207698_10133043	3300026142	Bacteria	2129
456	Ga0207428_10009208	3300027907	Bacteria	8870
457	Ga0207428_10198208	3300027907	Bacteria	1511
458	Ga0207428_10276975	3300027907	Bacteria	1246
459	Ga0207428_10731298	3300027907	Unclassified	706
460	Ga0268266_10223911	3300028379	Bacteria	1730
461	Ga0268266_10439317	3300028379	Bacteria	1239
462	Ga0268266_10559685	3300028379	Bacteria	1096
463	Ga0268265_10005488	3300028380	Bacteria	8656
464	Ga0268265_10246252	3300028380	Bacteria	1580
465	Ga0268265_10249064	3300028380	Bacteria	1572
466	Ga0268265_10404259	3300028380	Unclassified	1263
467	Ga0268265_11443110	3300028380	Bacteria	691
468	Ga0268264_10002477	3300028381	Bacteria	16225
469	Ga0268264_10183849	3300028381	Bacteria	1900
470	Ga0268264_10253912	3300028381	Bacteria	1635
471	Ga0268264_10308268	3300028381	Bacteria	1493
472	Ga0307409_101730548	3300031995	Bacteria	654
473	Ga0307416_100902246	3300032002	Bacteria	984
474	Ga0307411_10206745	3300032005	Bacteria	1512
475	Ga0373930_0002645	3300034816	Bacteria	2786
476	Ga0373948_0003490	3300034817	Bacteria	2424
477	Ga0373950_0007935	3300034818	Bacteria	1659
478	Ga0373958_0000787	3300034819	Bacteria	4058
479	Ga0373938_0000623	3300034957	Bacteria	5712
480	Ga0373928_0008276	3300035084	Bacteria	2017
481	Ga0373929_0002530	3300035085	Bacteria	3357
482	Ga0373940_0000877	3300035088	Bacteria	5057
483	Ga0373949_0000860	3300035090	Bacteria	9578
484	Ga0373951_0001874	3300035091	Bacteria	5416
485	Ga0373952_0001623	3300035092	Bacteria	4090
486	Ga0373932_0000249	3300035112	Bacteria	16351
487	Ga0373939_0002254	3300035114	Bacteria	4563
488	Ga0373939_0032839	3300035114	Bacteria	1511
489	Ga0373941_0000920	3300035115	Bacteria	6065
490	Ga0373960_0000159	3300035121	Bacteria	11700
491	Ga0373942_0000730	3300035207	Bacteria	9057
492	Ga0373961_0003649	3300035241	Bacteria	3777
493	Ga0373962_0006956	3300035242	Bacteria	2757
494	Ga0373931_0008703	3300035691	Bacteria	4828
495	Ga0373933_0403091	3300035724	Bacteria	892
496	Ga0373925_0388115	3300037068	Unclassified	1138
497	Ga0439431_0085534	3300041997	Bacteria	854
498	Ga0439433_0144563	3300041999	Bacteria	610
499	Ga0439442_065972	3300042002	Bacteria	769
500	Ga0439435_0016733	3300042436	Bacteria	1844
501	Ga0466963_0073914	3300044694	Bacteria	2299
502	Ga0451576_0007824	3300045051	Bacteria	12666
503	Ga0451576_0033391	3300045051	Bacteria	5470
504	Ga0451576_0049234	3300045051	Bacteria	4422
505	Ga0451576_0263670	3300045051	Bacteria	1801
506	Ga0466967_0272517	3300045976	Bacteria	1622
507	Ga0466967_0530812	3300045976	Bacteria	1157
508	Ga0466967_0726830	3300045976	Bacteria	984
509	Ga0495629_0186846	3300046459	Bacteria	1435
510	Ga0495584_0075797	3300046491	Bacteria	1691
511	Ga0495640_0842171	3300046533	Bacteria	545
512	Ga0495621_0008394	3300046539	Bacteria	3096
513	Ga0495621_0229042	3300046539	Unclassified	754
514	Ga0495670_0183028	3300046691	Bacteria	1107
515	Ga0495636_0535271	3300047318	Unclassified	569
516	Ga0495677_0226837	3300047445	Bacteria	728
517	Ga0496100_0481920	3300048903	Bacteria	954
518	Ga0496102_0039632	3300048905	Unclassified	4258
519	Ga0496102_0400797	3300048905	Bacteria	1290
520	Ga0496103_0867940	3300048906	Unclassified	567
521	Ga0496104_0001113	3300048907	Bacteria	22978
522	Ga0496104_0076862	3300048907	Bacteria	3180
523	Ga0496105_0041561	3300048908	Bacteria	3790
524	Ga0496106_0054924	3300048909	Bacteria	3010
525	Ga0496106_1400440	3300048909	Unclassified	540
526	Ga0496108_0034624	3300048911	Bacteria	4196
527	Ga0496108_0045266	3300048911	Bacteria	3675
528	Ga0496109_0002013	3300048912	Bacteria	16857
529	Ga0496109_0232921	3300048912	Bacteria	1733
530	Ga0496109_1224624	3300048912	Bacteria	687
531	Ga0496110_0278356	3300048913	Bacteria	1523
532	Ga0496112_0033905	3300048915	Bacteria	4966
533	Ga0496112_0038459	3300048915	Bacteria	4671
534	Ga0496112_1095568	3300048915	Unclassified	715
535	Ga0496114_0790357	3300048917	Unclassified	827
536	Ga0501034_0041021	3300049571	Bacteria	4683
537	Ga0501034_0094072	3300049571	Bacteria	2994
538	Ga0501036_0649227	3300049572	Bacteria	874
539	Ga0501041_0127805	3300049577	Bacteria	1583
540	Ga0501047_0051971	3300049581	Bacteria	3961
541	Ga0501068_0319824	3300049584	Bacteria	995
542	Ga0501071_0657025	3300049587	Bacteria	807
543	Ga0501073_0312991	3300049589	Bacteria	1083
544	Ga0501074_0409404	3300049590	Bacteria	962
545	Ga0501075_0624658	3300049591	Bacteria	822
546	Ga0501249_073628	3300049679	Unclassified	799
547	Ga0501080_0121081	3300049742	Bacteria	2425
548	Ga0501080_0253718	3300049742	Bacteria	1604
549	Ga0501044_0002441	3300049823	Bacteria	21195
550	nmdc:mga05p37_13615_c1	3300050507	Bacteria	3078
551	nmdc:mga05p37_1418972_c1	3300050507	Unclassified	698
552	nmdc:mga05p37_1630_c1	3300050507	Bacteria	26007
553	nmdc:mga05p37_168702_c1	3300050507	Bacteria	2670
554	nmdc:mga05p37_18081_c2	3300050507	Bacteria	6887
555	nmdc:mga05p37_252185_c1	3300050507	Bacteria	2116
556	nmdc:mga05p37_539047_c1	3300050507	Bacteria	1331
557	nmdc:mga05p37_6587_c1	3300050507	Bacteria	13693
558	nmdc:mga05p37_7760_c1	3300050507	Bacteria	12667
559	nmdc:mga05p37_8293_c1	3300050507	Bacteria	12284
560	nmdc:mga09592_101518_c1	3300050508	Bacteria	2464
561	nmdc:mga09592_404439_c1	3300050508	Unclassified	1180
562	nmdc:mga06r32_102334_c1	3300050510	Bacteria	2812
563	nmdc:mga06r32_141518_c1	3300050510	Bacteria	2382
564	nmdc:mga06r32_28797_c1	3300050510	Bacteria	5199
565	nmdc:mga08y16_1316_c1	3300050511	Bacteria	24685
566	nmdc:mga08y16_261850_c1	3300050511	Bacteria	1786
567	nmdc:mga08y16_300033_c1	3300050511	Bacteria	1656
568	nmdc:mga08y16_752177_c1	3300050511	Bacteria	971
569	nmdc:mga0n895_123_c1	3300050512	Bacteria	46084
570	nmdc:mga0n895_301474_c1	3300050512	Bacteria	1624
571	nmdc:mga0n895_30646_c1	3300050512	Bacteria	5143
572	nmdc:mga0n895_3171_c1	3300050512	Bacteria	13144
573	nmdc:mga0n895_325313_c1	3300050512	Bacteria	1558
574	nmdc:mga0n895_47488_c1	3300050512	Bacteria	4198
575	nmdc:mga0n895_62785_c1	3300050512	Bacteria	3673
576	nmdc:mga0n895_80794_c1	3300050512	Bacteria	3239
577	nmdc:mga0n895_891522_c1	3300050512	Bacteria	875
578	nmdc:mga0n895_94808_c1	3300050512	Bacteria	2988
579	nmdc:mga0rr50_11476_c1	3300050513	Bacteria	5676
580	nmdc:mga0rr50_15476_c1	3300050513	Bacteria	5038
581	nmdc:mga0rr50_1968_c1	3300050513	Bacteria	11401
582	nmdc:mga0rr50_27_c1	3300050513	Bacteria	109881
583	nmdc:mga0rr50_3578_c1	3300050513	Bacteria	8978
584	nmdc:mga0rr50_36918_c1	3300050513	Bacteria	3523
585	nmdc:mga0rr50_384260_c1	3300050513	Bacteria	1184
586	nmdc:mga0rr50_846440_c1	3300050513	Bacteria	780
587	nmdc:mga08x19_239398_c1	3300050514	Bacteria	1251
588	nmdc:mga08x19_337_c1	3300050514	Bacteria	33875
589	nmdc:mga08x19_6677_c1	3300050514	Bacteria	6844
590	nmdc:mga08x19_88899_c1	3300050514	Bacteria	2037
591	nmdc:mga08x19_91721_c1	3300050514	Bacteria	2006
592	nmdc:mga0a205_17852_c1	3300050515	Bacteria	6659
593	nmdc:mga0a205_35678_c1	3300050515	Bacteria	4775
594	nmdc:mga0a205_36439_c1	3300050515	Bacteria	4726
595	nmdc:mga0a205_49110_c1	3300050515	Bacteria	4072
596	nmdc:mga0a205_574340_c1	3300050515	Bacteria	982
597	nmdc:mga0a205_6379_c1	3300050515	Bacteria	10167
598	nmdc:mga0a205_704739_c1	3300050515	Unclassified	859
599	Ga0495619_0286831	3300053085	Bacteria	1141
600	Ga0501084_0802282	3300054114	Bacteria	793
601	Ga0587073_0007534	3300059492	Bacteria	1725
602	Ga0587073_0023664	3300059492	Unclassified	1205
603	Ga0587073_0071760	3300059492	Bacteria	838
604	Ga0587077_143344	3300059493	Bacteria	617
605	Ga0587082_014065	3300059504	Unclassified	1216
606	Ga0587082_043290	3300059504	Bacteria	834
607	Ga0587082_077822	3300059504	Bacteria	686
608	Ga0587083_0038016	3300059505	Unclassified	993
609	Ga0587083_0057191	3300059505	Bacteria	869
610	Ga0587085_037004	3300059506	Bacteria	832
611	Ga0587090_015437	3300059510	Unclassified	1130
612	Ga0587091_022568	3300059511	Unclassified	1113
613	Ga0587091_042294	3300059511	Bacteria	903
614	Ga0587091_112191	3300059511	Bacteria	653
615	Ga0587072_027388	3300059643	Bacteria	1046

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300005293	Ga0065715_10172726	Ga0065715_101727263	134
2	3300005844	Ga0068862_100396555	Ga0068862_1003965552	134
3	3300028380	Ga0268265_10404259	Ga0268265_104042592	134
4	3300005290	Ga0065712_10081966	Ga0065712_100819663	135
5	3300005293	Ga0065715_10603088	Ga0065715_106030881	135
6	3300005329	Ga0070683_100003522	Ga0070683_10000352211	135
7	3300005331	Ga0070670_100030473	Ga0070670_1000304733	135
8	3300005344	Ga0070661_100045046	Ga0070661_1000450464	135
9	3300005355	Ga0070671_100017318	Ga0070671_1000173185	135
10	3300005367	Ga0070667_100059084	Ga0070667_1000590843	135
11	3300005455	Ga0070663_100090165	Ga0070663_1000901652	135
12	3300005535	Ga0070684_100040909	Ga0070684_1000409093	135
13	3300005548	Ga0070665_100076698	Ga0070665_1000766983	135
14	3300005564	Ga0070664_100002748	Ga0070664_1000027485	135
15	3300005618	Ga0068864_100548700	Ga0068864_1005487001	135
16	3300005842	Ga0068858_100098239	Ga0068858_1000982393	135
17	3300006871	Ga0075434_100116737	Ga0075434_1001167373	135
18	3300009098	Ga0105245_10954133	Ga0105245_109541332	135
19	3300009177	Ga0105248_10125882	Ga0105248_101258824	135
20	3300011119	Ga0105246_10342491	Ga0105246_103424912	135
21	3300013306	Ga0163162_10274419	Ga0163162_102744192	135
22	3300013308	Ga0157375_10137382	Ga0157375_101373822	135
23	3300014325	Ga0163163_10248162	Ga0163163_102481622	135
24	3300014968	Ga0157379_10241067	Ga0157379_102410672	135
25	3300025903	Ga0207680_10068686	Ga0207680_100686862	135
26	3300025920	Ga0207649_10087016	Ga0207649_100870162	135
27	3300025925	Ga0207650_10068841	Ga0207650_100688413	135
28	3300025927	Ga0207687_10775139	Ga0207687_107751392	135
29	3300025931	Ga0207644_10034270	Ga0207644_100342703	135
30	3300025933	Ga0207706_10177180	Ga0207706_101771803	135
31	3300025941	Ga0207711_10353778	Ga0207711_103537781	135
32	3300025944	Ga0207661_10035833	Ga0207661_100358334	135
33	3300025945	Ga0207679_10068183	Ga0207679_100681832	135
34	3300025986	Ga0207658_10106920	Ga0207658_101069202	135
35	3300026035	Ga0207703_10660885	Ga0207703_106608852	135
36	3300026067	Ga0207678_10097956	Ga0207678_100979563	135
37	3300026095	Ga0207676_10343979	Ga0207676_103439792	135
38	3300027907	Ga0207428_10198208	Ga0207428_101982082	135
39	3300028379	Ga0268266_10223911	Ga0268266_102239112	135
40	3300046539	Ga0495621_0229042	Ga0495621_0229042_281_736	135
41	3300048907	Ga0496104_0001113	Ga0496104_0001113_3202_3669	135
42	3300048908	Ga0496105_0041561	Ga0496105_0041561_3204_3671	135
43	3300048911	Ga0496108_0045266	Ga0496108_0045266_1132_1599	135
44	3300048912	Ga0496109_0002013	Ga0496109_0002013_7687_8154	135
45	3300048913	Ga0496110_0278356	Ga0496110_0278356_566_1033	135
46	3300048915	Ga0496112_0033905	Ga0496112_0033905_3378_3845	135
47	3300048917	Ga0496114_0790357	Ga0496114_0790357_11_478	135
48	3300050511	nmdc:mga08y16_300033_c1	nmdc:mga08y16_300033_c1_347_814	135
49	3300003579	Ga0007429J51699_1037686	Ga0007429J51699_10376862	141
50	3300003693	Ga0032354_1014169	Ga0032354_10141692	141
51	3300005295	Ga0065707_10085075	Ga0065707_100850756	141
52	3300005353	Ga0070669_100000228	Ga0070669_10000022823	141
53	3300005365	Ga0070688_100372385	Ga0070688_1003723852	141
54	3300005366	Ga0070659_100356421	Ga0070659_1003564211	141
55	3300005457	Ga0070662_100324998	Ga0070662_1003249982	141
56	3300005543	Ga0070672_100094732	Ga0070672_1000947322	141
57	3300005549	Ga0070704_100752923	Ga0070704_1007529231	141
58	3300005577	Ga0068857_100118730	Ga0068857_1001187302	141
59	3300005616	Ga0068852_100100811	Ga0068852_1001008113	141
60	3300005617	Ga0068859_100463966	Ga0068859_1004639662	141
61	3300005840	Ga0068870_10299728	Ga0068870_102997282	141
62	3300005844	Ga0068862_100078903	Ga0068862_1000789032	141
63	3300006844	Ga0075428_100006301	Ga0075428_10000630112	141
64	3300006847	Ga0075431_100020573	Ga0075431_1000205736	141
65	3300006880	Ga0075429_100079979	Ga0075429_1000799793	141
66	3300006931	Ga0097620_100463986	Ga0097620_1004639862	141
67	3300009094	Ga0111539_10000909	Ga0111539_1000090916	141
68	3300009094	Ga0111539_10074895	Ga0111539_100748953	141
69	3300009147	Ga0114129_10018948	Ga0114129_100189485	141
70	3300009553	Ga0105249_10001512	Ga0105249_100015126	141
71	3300010375	Ga0105239_10395175	Ga0105239_103951753	141
72	3300014326	Ga0157380_10261095	Ga0157380_102610952	141
73	3300014745	Ga0157377_10331378	Ga0157377_103313782	141
74	3300025315	Ga0207697_10308463	Ga0207697_103084632	141
75	3300025923	Ga0207681_10020412	Ga0207681_100204124	141
76	3300025933	Ga0207706_10364972	Ga0207706_103649722	141
77	3300025940	Ga0207691_10306309	Ga0207691_103063092	141
78	3300025961	Ga0207712_10042225	Ga0207712_100422254	141
79	3300026116	Ga0207674_10372236	Ga0207674_103722362	141
80	3300026142	Ga0207698_10133043	Ga0207698_101330432	141
81	3300027907	Ga0207428_10009208	Ga0207428_100092082	141
82	3300027907	Ga0207428_10731298	Ga0207428_107312982	141
83	3300028380	Ga0268265_10246252	Ga0268265_102462522	141
84	3300050507	nmdc:mga05p37_8293_c1	nmdc:mga05p37_8293_c1_5904_6371	141
85	3300050508	nmdc:mga09592_101518_c1	nmdc:mga09592_101518_c1_1041_1508	141
86	3300050510	nmdc:mga06r32_28797_c1	nmdc:mga06r32_28797_c1_3875_4342	141
87	3300050511	nmdc:mga08y16_1316_c1	nmdc:mga08y16_1316_c1_18682_19149	141
88	3300050511	nmdc:mga08y16_752177_c1	nmdc:mga08y16_752177_c1_305_772	141
89	3300005290	Ga0065712_10135893	Ga0065712_101358932	146
90	3300005618	Ga0068864_100025835	Ga0068864_1000258351	146
91	3300005842	Ga0068858_100054581	Ga0068858_1000545814	146
92	3300009011	Ga0105251_10099062	Ga0105251_100990621	146
93	3300009101	Ga0105247_10005097	Ga0105247_100050974	146
94	3300009177	Ga0105248_10011006	Ga0105248_100110066	146
95	3300014325	Ga0163163_10008666	Ga0163163_100086666	146
96	3300025941	Ga0207711_10073119	Ga0207711_100731193	146
97	3300026035	Ga0207703_10035651	Ga0207703_100356514	146
98	3300026095	Ga0207676_10054172	Ga0207676_100541724	146
99	3300037068	Ga0373925_0388115	Ga0373925_0388115_265_732	146
100	3300048907	Ga0496104_0076862	Ga0496104_0076862_517_987	146
101	3300048911	Ga0496108_0034624	Ga0496108_0034624_2195_2665	146
102	3300048912	Ga0496109_0232921	Ga0496109_0232921_705_1175	146
103	3300048915	Ga0496112_0038459	Ga0496112_0038459_2106_2576	146
104	3300005543	Ga0070672_100325404	Ga0070672_1003254042	147
105	3300005841	Ga0068863_100723859	Ga0068863_1007238592	147
106	3300006844	Ga0075428_100695633	Ga0075428_1006956332	147
107	3300006847	Ga0075431_100037241	Ga0075431_1000372414	147
108	3300006852	Ga0075433_10223949	Ga0075433_102239492	147
109	3300006880	Ga0075429_100488356	Ga0075429_1004883562	147
110	3300009147	Ga0114129_10023734	Ga0114129_100237342	147
111	3300025940	Ga0207691_10381783	Ga0207691_103817832	147
112	3300035088	Ga0373940_0000877	Ga0373940_0000877_3346_3819	147
113	3300048909	Ga0496106_1400440	Ga0496106_1400440_40_510	147
114	3300050507	nmdc:mga05p37_18081_c2	nmdc:mga05p37_18081_c2_3499_3969	147
115	3300050508	nmdc:mga09592_404439_c1	nmdc:mga09592_404439_c1_410_880	147
116	3300050510	nmdc:mga06r32_102334_c1	nmdc:mga06r32_102334_c1_1736_2206	147
117	3300050515	nmdc:mga0a205_574340_c1	nmdc:mga0a205_574340_c1_440_910	147
118	3300002076	JGI24749J21850_1037714	JGI24749J21850_10377141	148
119	3300005293	Ga0065715_10163139	Ga0065715_101631392	148
120	3300005331	Ga0070670_100770208	Ga0070670_1007702081	148
121	3300005333	Ga0070677_10110631	Ga0070677_101106312	148
122	3300005340	Ga0070689_100011222	Ga0070689_1000112226	148
123	3300005354	Ga0070675_100007889	Ga0070675_1000078895	148
124	3300005364	Ga0070673_100078663	Ga0070673_1000786632	148
125	3300005365	Ga0070688_100005127	Ga0070688_1000051276	148
126	3300005367	Ga0070667_100086979	Ga0070667_1000869792	148
127	3300005436	Ga0070713_100042527	Ga0070713_1000425274	148
128	3300005440	Ga0070705_100007546	Ga0070705_1000075463	148
129	3300005441	Ga0070700_100606181	Ga0070700_1006061812	148
130	3300005444	Ga0070694_100000362	Ga0070694_10000036211	148
131	3300005444	Ga0070694_100002253	Ga0070694_1000022535	148
132	3300005456	Ga0070678_100306828	Ga0070678_1003068282	148
133	3300005466	Ga0070685_10062660	Ga0070685_100626602	148
134	3300005471	Ga0070698_100004420	Ga0070698_1000044203	148
135	3300005530	Ga0070679_100415137	Ga0070679_1004151371	148
136	3300005535	Ga0070684_100800228	Ga0070684_1008002282	148
137	3300005543	Ga0070672_100052904	Ga0070672_1000529042	148
138	3300005545	Ga0070695_100000129	Ga0070695_1000001297	148
139	3300005545	Ga0070695_101080253	Ga0070695_1010802531	148
140	3300005546	Ga0070696_100000326	Ga0070696_10000032611	148
141	3300005546	Ga0070696_100004309	Ga0070696_1000043098	148
142	3300005549	Ga0070704_100000419	Ga0070704_1000004192	148
143	3300005615	Ga0070702_100262423	Ga0070702_1002624231	148
144	3300005617	Ga0068859_100001505	Ga0068859_1000015056	148
145	3300005842	Ga0068858_100042658	Ga0068858_1000426582	148
146	3300005843	Ga0068860_100002653	Ga0068860_1000026539	148
147	3300006358	Ga0068871_100305010	Ga0068871_1003050102	148
148	3300006847	Ga0075431_100155014	Ga0075431_1001550143	148
149	3300006852	Ga0075433_10010180	Ga0075433_100101801	148
150	3300006852	Ga0075433_10665800	Ga0075433_106658001	148
151	3300006871	Ga0075434_100028906	Ga0075434_1000289063	148
152	3300006871	Ga0075434_100833781	Ga0075434_1008337811	148
153	3300006881	Ga0068865_100404425	Ga0068865_1004044251	148
154	3300006931	Ga0097620_100001505	Ga0097620_10000150515	148
155	3300007076	Ga0075435_100014978	Ga0075435_1000149784	148
156	3300007076	Ga0075435_100254587	Ga0075435_1002545872	148
157	3300009094	Ga0111539_11155819	Ga0111539_111558192	148
158	3300009147	Ga0114129_10064605	Ga0114129_100646053	148
159	3300014326	Ga0157380_10344297	Ga0157380_103442972	148
160	3300014745	Ga0157377_10031601	Ga0157377_100316013	148
161	3300014968	Ga0157379_10221331	Ga0157379_102213312	148
162	3300020075	Ga0206349_1626400	Ga0206349_16264002	148
163	3300022467	Ga0224712_10215309	Ga0224712_102153091	148
164	3300025918	Ga0207662_10036020	Ga0207662_100360202	148
165	3300025921	Ga0207652_10079747	Ga0207652_100797473	148
166	3300025922	Ga0207646_10116832	Ga0207646_101168322	148
167	3300025926	Ga0207659_10000069	Ga0207659_100000696	148
168	3300025928	Ga0207700_10014835	Ga0207700_100148354	148
169	3300025936	Ga0207670_10005697	Ga0207670_100056972	148
170	3300025938	Ga0207704_10033119	Ga0207704_100331192	148
171	3300025940	Ga0207691_10016350	Ga0207691_100163507	148
172	3300025960	Ga0207651_10021684	Ga0207651_100216843	148
173	3300025986	Ga0207658_10869418	Ga0207658_108694181	148
174	3300026023	Ga0207677_10434350	Ga0207677_104343502	148
175	3300026075	Ga0207708_10067872	Ga0207708_100678722	148
176	3300026088	Ga0207641_10152587	Ga0207641_101525872	148
177	3300026121	Ga0207683_10279362	Ga0207683_102793622	148
178	3300028381	Ga0268264_10002477	Ga0268264_100024778	148
179	3300031995	Ga0307409_101730548	Ga0307409_1017305482	148
180	3300035114	Ga0373939_0032839	Ga0373939_0032839_149_628	148
181	3300035724	Ga0373933_0403091	Ga0373933_0403091_292_771	148
182	3300041997	Ga0439431_0085534	Ga0439431_0085534_356_841	148
183	3300041999	Ga0439433_0144563	Ga0439433_0144563_50_535	148
184	3300042002	Ga0439442_065972	Ga0439442_065972_164_649	148
185	3300045051	Ga0451576_0049234	Ga0451576_0049234_2880_3359	148
186	3300046491	Ga0495584_0075797	Ga0495584_0075797_660_1139	148
187	3300046539	Ga0495621_0008394	Ga0495621_0008394_396_875	148
188	3300047445	Ga0495677_0226837	Ga0495677_0226837_153_632	148
189	3300048906	Ga0496103_0867940	Ga0496103_0867940_14_490	148
190	3300049572	Ga0501036_0649227	Ga0501036_0649227_59_535	148
191	3300049577	Ga0501041_0127805	Ga0501041_0127805_735_1211	148
192	3300049590	Ga0501074_0409404	Ga0501074_0409404_317_793	148
193	3300050507	nmdc:mga05p37_252185_c1	nmdc:mga05p37_252185_c1_65_541	148
194	3300050507	nmdc:mga05p37_539047_c1	nmdc:mga05p37_539047_c1_40_519	148
195	3300050510	nmdc:mga06r32_141518_c1	nmdc:mga06r32_141518_c1_411_887	148
196	3300050512	nmdc:mga0n895_30646_c1	nmdc:mga0n895_30646_c1_1760_2239	148
197	3300050512	nmdc:mga0n895_62785_c1	nmdc:mga0n895_62785_c1_3178_3657	148
198	3300050512	nmdc:mga0n895_891522_c1	nmdc:mga0n895_891522_c1_54_527	148
199	3300050513	nmdc:mga0rr50_846440_c1	nmdc:mga0rr50_846440_c1_246_725	148
200	3300050515	nmdc:mga0a205_49110_c1	nmdc:mga0a205_49110_c1_122_601	148
201	3300050515	nmdc:mga0a205_6379_c1	nmdc:mga0a205_6379_c1_771_1250	148
202	3300059504	Ga0587082_077822	Ga0587082_077822_43_519	148
203	2162886012	MBSR1b_contig_3988905	MBSR1b_0207.00000120	149
204	3300003693	Ga0032354_1023852	Ga0032354_10238522	149
205	3300004799	Ga0058863_11338496	Ga0058863_113384962	149
206	3300005293	Ga0065715_10053684	Ga0065715_100536841	149
207	3300005293	Ga0065715_10611770	Ga0065715_106117701	149
208	3300005293	Ga0065715_10691630	Ga0065715_106916302	149
209	3300005293	Ga0065715_10830547	Ga0065715_108305471	149
210	3300005295	Ga0065707_10940366	Ga0065707_109403661	149
211	3300005328	Ga0070676_10000763	Ga0070676_100007639	149
212	3300005329	Ga0070683_100288775	Ga0070683_1002887751	149
213	3300005330	Ga0070690_100013551	Ga0070690_1000135513	149
214	3300005330	Ga0070690_100361790	Ga0070690_1003617901	149
215	3300005330	Ga0070690_100590382	Ga0070690_1005903821	149
216	3300005331	Ga0070670_100086604	Ga0070670_1000866043	149
217	3300005331	Ga0070670_100146759	Ga0070670_1001467592	149
218	3300005333	Ga0070677_10186267	Ga0070677_101862672	149
219	3300005334	Ga0068869_100432993	Ga0068869_1004329932	149
220	3300005335	Ga0070666_10005812	Ga0070666_100058122	149
221	3300005335	Ga0070666_10083749	Ga0070666_100837492	149
222	3300005335	Ga0070666_10420662	Ga0070666_104206621	149
223	3300005336	Ga0070680_100188550	Ga0070680_1001885502	149
224	3300005337	Ga0070682_100629760	Ga0070682_1006297601	149
225	3300005339	Ga0070660_100008449	Ga0070660_1000084494	149
226	3300005339	Ga0070660_100487292	Ga0070660_1004872922	149
227	3300005340	Ga0070689_100409051	Ga0070689_1004090512	149
228	3300005341	Ga0070691_10004968	Ga0070691_100049682	149
229	3300005341	Ga0070691_10588280	Ga0070691_105882801	149
230	3300005343	Ga0070687_100277216	Ga0070687_1002772162	149
231	3300005344	Ga0070661_100121092	Ga0070661_1001210923	149
232	3300005344	Ga0070661_100388134	Ga0070661_1003881342	149
233	3300005345	Ga0070692_10105692	Ga0070692_101056922	149
234	3300005345	Ga0070692_10301965	Ga0070692_103019652	149
235	3300005347	Ga0070668_100024615	Ga0070668_1000246153	149
236	3300005353	Ga0070669_100003701	Ga0070669_1000037014	149
237	3300005353	Ga0070669_100013463	Ga0070669_1000134633	149
238	3300005353	Ga0070669_100055379	Ga0070669_1000553792	149
239	3300005353	Ga0070669_100292773	Ga0070669_1002927732	149
240	3300005353	Ga0070669_100529076	Ga0070669_1005290762	149
241	3300005353	Ga0070669_101856832	Ga0070669_1018568321	149
242	3300005354	Ga0070675_100067925	Ga0070675_1000679253	149
243	3300005354	Ga0070675_100331687	Ga0070675_1003316872	149
244	3300005354	Ga0070675_100336715	Ga0070675_1003367152	149
245	3300005354	Ga0070675_100904085	Ga0070675_1009040851	149
246	3300005355	Ga0070671_100529931	Ga0070671_1005299312	149
247	3300005356	Ga0070674_100005875	Ga0070674_1000058752	149
248	3300005356	Ga0070674_100014705	Ga0070674_1000147054	149
249	3300005356	Ga0070674_100044893	Ga0070674_1000448932	149
250	3300005364	Ga0070673_100020854	Ga0070673_1000208542	149
251	3300005364	Ga0070673_100387004	Ga0070673_1003870041	149
252	3300005364	Ga0070673_101069737	Ga0070673_1010697371	149
253	3300005366	Ga0070659_100857414	Ga0070659_1008574141	149
254	3300005367	Ga0070667_100226391	Ga0070667_1002263912	149
255	3300005367	Ga0070667_101446192	Ga0070667_1014461921	149
256	3300005435	Ga0070714_100039469	Ga0070714_1000394693	149
257	3300005438	Ga0070701_10064551	Ga0070701_100645512	149
258	3300005438	Ga0070701_10191437	Ga0070701_101914372	149
259	3300005440	Ga0070705_100006125	Ga0070705_1000061253	149
260	3300005440	Ga0070705_100235739	Ga0070705_1002357393	149
261	3300005441	Ga0070700_100401847	Ga0070700_1004018472	149
262	3300005441	Ga0070700_100612460	Ga0070700_1006124601	149
263	3300005441	Ga0070700_101192520	Ga0070700_1011925201	149
264	3300005444	Ga0070694_100210420	Ga0070694_1002104202	149
265	3300005444	Ga0070694_100300679	Ga0070694_1003006792	149
266	3300005456	Ga0070678_100991389	Ga0070678_1009913892	149
267	3300005457	Ga0070662_100411769	Ga0070662_1004117692	149
268	3300005457	Ga0070662_100452372	Ga0070662_1004523722	149
269	3300005458	Ga0070681_10063451	Ga0070681_100634513	149
270	3300005459	Ga0068867_100025932	Ga0068867_1000259324	149
271	3300005459	Ga0068867_101609579	Ga0068867_1016095791	149
272	3300005468	Ga0070707_100444031	Ga0070707_1004440312	149
273	3300005468	Ga0070707_100692754	Ga0070707_1006927542	149
274	3300005468	Ga0070707_101553567	Ga0070707_1015535671	149
275	3300005471	Ga0070698_100052870	Ga0070698_1000528703	149
276	3300005471	Ga0070698_100288945	Ga0070698_1002889452	149
277	3300005471	Ga0070698_100647452	Ga0070698_1006474522	149
278	3300005471	Ga0070698_100917603	Ga0070698_1009176032	149
279	3300005518	Ga0070699_100061651	Ga0070699_1000616512	149
280	3300005518	Ga0070699_100375564	Ga0070699_1003755642	149
281	3300005518	Ga0070699_100655005	Ga0070699_1006550052	149
282	3300005530	Ga0070679_100466090	Ga0070679_1004660902	149
283	3300005536	Ga0070697_100038429	Ga0070697_1000384293	149
284	3300005536	Ga0070697_100319653	Ga0070697_1003196532	149
285	3300005539	Ga0068853_100622650	Ga0068853_1006226502	149
286	3300005539	Ga0068853_100768770	Ga0068853_1007687702	149
287	3300005544	Ga0070686_100000779	Ga0070686_10000077910	149
288	3300005544	Ga0070686_100157815	Ga0070686_1001578153	149
289	3300005545	Ga0070695_100002942	Ga0070695_1000029429	149
290	3300005545	Ga0070695_100085252	Ga0070695_1000852522	149
291	3300005545	Ga0070695_101153404	Ga0070695_1011534041	149
292	3300005546	Ga0070696_100000859	Ga0070696_10000085916	149
293	3300005546	Ga0070696_100093718	Ga0070696_1000937182	149
294	3300005546	Ga0070696_100160161	Ga0070696_1001601612	149
295	3300005546	Ga0070696_100218708	Ga0070696_1002187081	149
296	3300005548	Ga0070665_100082374	Ga0070665_1000823742	149
297	3300005548	Ga0070665_100609266	Ga0070665_1006092662	149
298	3300005549	Ga0070704_100004925	Ga0070704_1000049257	149
299	3300005549	Ga0070704_100050763	Ga0070704_1000507633	149
300	3300005549	Ga0070704_100109400	Ga0070704_1001094002	149
301	3300005549	Ga0070704_101866462	Ga0070704_1018664621	149
302	3300005563	Ga0068855_100014774	Ga0068855_1000147743	149
303	3300005563	Ga0068855_100400680	Ga0068855_1004006802	149
304	3300005564	Ga0070664_100126123	Ga0070664_1001261232	149
305	3300005564	Ga0070664_100822452	Ga0070664_1008224522	149
306	3300005564	Ga0070664_100925525	Ga0070664_1009255252	149
307	3300005578	Ga0068854_100003229	Ga0068854_1000032294	149
308	3300005578	Ga0068854_100025634	Ga0068854_1000256342	149
309	3300005578	Ga0068854_100274011	Ga0068854_1002740112	149
310	3300005578	Ga0068854_100751220	Ga0068854_1007512202	149
311	3300005578	Ga0068854_101163494	Ga0068854_1011634941	149
312	3300005615	Ga0070702_100001602	Ga0070702_1000016029	149
313	3300005617	Ga0068859_100134332	Ga0068859_1001343323	149
314	3300005617	Ga0068859_100678229	Ga0068859_1006782292	149
315	3300005618	Ga0068864_101046066	Ga0068864_1010460662	149
316	3300005618	Ga0068864_101286781	Ga0068864_1012867811	149
317	3300005718	Ga0068866_10138178	Ga0068866_101381783	149
318	3300005719	Ga0068861_100001737	Ga0068861_1000017379	149
319	3300005719	Ga0068861_100040889	Ga0068861_1000408894	149
320	3300005719	Ga0068861_100100376	Ga0068861_1001003763	149
321	3300005840	Ga0068870_10229694	Ga0068870_102296942	149
322	3300005840	Ga0068870_10860298	Ga0068870_108602982	149
323	3300005842	Ga0068858_100001553	Ga0068858_10000155314	149
324	3300005842	Ga0068858_100019178	Ga0068858_1000191784	149
325	3300005842	Ga0068858_100137555	Ga0068858_1001375553	149
326	3300005842	Ga0068858_100208587	Ga0068858_1002085872	149
327	3300005842	Ga0068858_101199587	Ga0068858_1011995871	149
328	3300005843	Ga0068860_100128405	Ga0068860_1001284053	149
329	3300005843	Ga0068860_100247329	Ga0068860_1002473293	149
330	3300005843	Ga0068860_100806161	Ga0068860_1008061611	149
331	3300005844	Ga0068862_100009142	Ga0068862_1000091427	149
332	3300005985	Ga0081539_10017495	Ga0081539_100174954	149
333	3300006058	Ga0075432_10034441	Ga0075432_100344413	149
334	3300006058	Ga0075432_10167407	Ga0075432_101674072	149
335	3300006163	Ga0070715_10128767	Ga0070715_101287672	149
336	3300006173	Ga0070716_100071612	Ga0070716_1000716122	149
337	3300006175	Ga0070712_100923421	Ga0070712_1009234211	149
338	3300006237	Ga0097621_101150332	Ga0097621_1011503322	149
339	3300006358	Ga0068871_100058966	Ga0068871_1000589663	149
340	3300006358	Ga0068871_100506431	Ga0068871_1005064312	149
341	3300006358	Ga0068871_100513054	Ga0068871_1005130542	149
342	3300006846	Ga0075430_101058967	Ga0075430_1010589672	149
343	3300006852	Ga0075433_10086115	Ga0075433_100861152	149
344	3300006852	Ga0075433_10191313	Ga0075433_101913132	149
345	3300006852	Ga0075433_10906027	Ga0075433_109060272	149
346	3300006871	Ga0075434_100001876	Ga0075434_10000187617	149
347	3300006871	Ga0075434_100062315	Ga0075434_1000623154	149
348	3300006871	Ga0075434_100066519	Ga0075434_1000665191	149
349	3300006871	Ga0075434_100283095	Ga0075434_1002830953	149
350	3300006871	Ga0075434_100326118	Ga0075434_1003261182	149
351	3300006871	Ga0075434_100420557	Ga0075434_1004205572	149
352	3300006881	Ga0068865_100255791	Ga0068865_1002557912	149
353	3300006881	Ga0068865_100417836	Ga0068865_1004178362	149
354	3300006881	Ga0068865_100612161	Ga0068865_1006121612	149
355	3300006914	Ga0075436_100011952	Ga0075436_1000119526	149
356	3300006914	Ga0075436_100038151	Ga0075436_1000381513	149
357	3300006914	Ga0075436_100105635	Ga0075436_1001056352	149
358	3300006931	Ga0097620_100134336	Ga0097620_1001343363	149
359	3300006931	Ga0097620_100678247	Ga0097620_1006782472	149
360	3300007076	Ga0075435_100001224	Ga0075435_10000122410	149
361	3300007076	Ga0075435_100001247	Ga0075435_10000124714	149
362	3300007076	Ga0075435_100022227	Ga0075435_1000222272	149
363	3300007076	Ga0075435_100042996	Ga0075435_1000429962	149
364	3300007076	Ga0075435_100049687	Ga0075435_1000496872	149
365	3300007076	Ga0075435_100270464	Ga0075435_1002704642	149
366	3300007265	Ga0099794_10076408	Ga0099794_100764081	149
367	3300009093	Ga0105240_10011240	Ga0105240_100112405	149
368	3300009093	Ga0105240_10019697	Ga0105240_100196974	149
369	3300009093	Ga0105240_10120866	Ga0105240_101208662	149
370	3300009093	Ga0105240_10620858	Ga0105240_106208581	149
371	3300009094	Ga0111539_10001152	Ga0111539_100011522	149
372	3300009098	Ga0105245_10204289	Ga0105245_102042892	149
373	3300009098	Ga0105245_10885126	Ga0105245_108851262	149
374	3300009098	Ga0105245_11195785	Ga0105245_111957852	149
375	3300009147	Ga0114129_10000387	Ga0114129_1000038712	149
376	3300009147	Ga0114129_10005534	Ga0114129_1000553413	149
377	3300009147	Ga0114129_10009842	Ga0114129_100098422	149
378	3300009147	Ga0114129_10037493	Ga0114129_100374932	149
379	3300009147	Ga0114129_10154822	Ga0114129_101548222	149
380	3300009147	Ga0114129_10336746	Ga0114129_103367462	149
381	3300009147	Ga0114129_11940761	Ga0114129_119407612	149
382	3300009148	Ga0105243_10009972	Ga0105243_100099726	149
383	3300009174	Ga0105241_10096964	Ga0105241_100969642	149
384	3300009174	Ga0105241_10915337	Ga0105241_109153372	149
385	3300009176	Ga0105242_10206416	Ga0105242_102064162	149
386	3300009176	Ga0105242_10256071	Ga0105242_102560712	149
387	3300009176	Ga0105242_10432959	Ga0105242_104329592	149
388	3300009176	Ga0105242_12004092	Ga0105242_120040921	149
389	3300009177	Ga0105248_10100655	Ga0105248_101006553	149
390	3300009177	Ga0105248_10182805	Ga0105248_101828053	149
391	3300009177	Ga0105248_10241400	Ga0105248_102414003	149
392	3300009177	Ga0105248_10596074	Ga0105248_105960742	149
393	3300009177	Ga0105248_11993465	Ga0105248_119934651	149
394	3300009551	Ga0105238_10211954	Ga0105238_102119542	149
395	3300009553	Ga0105249_10377111	Ga0105249_103771112	149
396	3300009553	Ga0105249_10462924	Ga0105249_104629242	149
397	3300009553	Ga0105249_10756091	Ga0105249_107560912	149
398	3300009553	Ga0105249_11041907	Ga0105249_110419072	149
399	3300013104	Ga0157370_10508646	Ga0157370_105086462	149
400	3300013105	Ga0157369_10464901	Ga0157369_104649012	149
401	3300013297	Ga0157378_11443137	Ga0157378_114431372	149
402	3300013306	Ga0163162_11075197	Ga0163162_110751972	149
403	3300013306	Ga0163162_11744441	Ga0163162_117444412	149
404	3300014326	Ga0157380_10772221	Ga0157380_107722212	149
405	3300014326	Ga0157380_11618850	Ga0157380_116188502	149
406	3300014497	Ga0182008_10220919	Ga0182008_102209192	149
407	3300014968	Ga0157379_10002707	Ga0157379_100027075	149
408	3300014968	Ga0157379_10746496	Ga0157379_107464962	149
409	3300014968	Ga0157379_10942624	Ga0157379_109426242	149
410	3300015262	Ga0182007_10115210	Ga0182007_101152102	149
411	3300017792	Ga0163161_10236080	Ga0163161_102360802	149
412	3300020069	Ga0197907_11120794	Ga0197907_111207943	149
413	3300020075	Ga0206349_1670001	Ga0206349_16700012	149
414	3300020076	Ga0206355_1040547	Ga0206355_10405471	149
415	3300020080	Ga0206350_10255035	Ga0206350_102550352	149
416	3300022467	Ga0224712_10005340	Ga0224712_100053403	149
417	3300025271	Ga0207666_1017931	Ga0207666_10179312	149
418	3300025315	Ga0207697_10048659	Ga0207697_100486592	149
419	3300025893	Ga0207682_10056606	Ga0207682_100566062	149
420	3300025893	Ga0207682_10139645	Ga0207682_101396452	149
421	3300025899	Ga0207642_10017151	Ga0207642_100171513	149
422	3300025899	Ga0207642_10375427	Ga0207642_103754271	149
423	3300025901	Ga0207688_10249117	Ga0207688_102491172	149
424	3300025901	Ga0207688_10605111	Ga0207688_106051112	149
425	3300025903	Ga0207680_10008430	Ga0207680_100084305	149
426	3300025905	Ga0207685_10176312	Ga0207685_101763122	149
427	3300025907	Ga0207645_10000346	Ga0207645_1000034623	149
428	3300025911	Ga0207654_10053563	Ga0207654_100535632	149
429	3300025913	Ga0207695_10085672	Ga0207695_100856723	149
430	3300025913	Ga0207695_10172844	Ga0207695_101728443	149
431	3300025913	Ga0207695_10386202	Ga0207695_103862022	149
432	3300025915	Ga0207693_10392011	Ga0207693_103920112	149
433	3300025915	Ga0207693_10752108	Ga0207693_107521082	149
434	3300025917	Ga0207660_10253835	Ga0207660_102538352	149
435	3300025917	Ga0207660_10449203	Ga0207660_104492032	149
436	3300025919	Ga0207657_10002506	Ga0207657_100025069	149
437	3300025919	Ga0207657_10421778	Ga0207657_104217781	149
438	3300025920	Ga0207649_10177964	Ga0207649_101779642	149
439	3300025921	Ga0207652_10220857	Ga0207652_102208572	149
440	3300025922	Ga0207646_10132814	Ga0207646_101328143	149
441	3300025923	Ga0207681_10007730	Ga0207681_100077304	149
442	3300025923	Ga0207681_10262748	Ga0207681_102627482	149
443	3300025923	Ga0207681_10360790	Ga0207681_103607902	149
444	3300025923	Ga0207681_10829049	Ga0207681_108290492	149
445	3300025924	Ga0207694_10145572	Ga0207694_101455722	149
446	3300025925	Ga0207650_10136381	Ga0207650_101363812	149
447	3300025926	Ga0207659_10256141	Ga0207659_102561412	149
448	3300025926	Ga0207659_10758355	Ga0207659_107583552	149
449	3300025927	Ga0207687_10087390	Ga0207687_100873902	149
450	3300025927	Ga0207687_10392095	Ga0207687_103920952	149
451	3300025929	Ga0207664_10480522	Ga0207664_104805222	149
452	3300025931	Ga0207644_10199234	Ga0207644_101992342	149
453	3300025931	Ga0207644_10423287	Ga0207644_104232872	149
454	3300025932	Ga0207690_10040779	Ga0207690_100407792	149
455	3300025933	Ga0207706_10129428	Ga0207706_101294282	149
456	3300025933	Ga0207706_10391068	Ga0207706_103910682	149
457	3300025933	Ga0207706_10566248	Ga0207706_105662482	149
458	3300025933	Ga0207706_11560479	Ga0207706_115604791	149
459	3300025934	Ga0207686_10254491	Ga0207686_102544912	149
460	3300025934	Ga0207686_10370816	Ga0207686_103708162	149
461	3300025935	Ga0207709_10017859	Ga0207709_100178593	149
462	3300025935	Ga0207709_10020531	Ga0207709_100205314	149
463	3300025937	Ga0207669_10003099	Ga0207669_100030992	149
464	3300025937	Ga0207669_10032896	Ga0207669_100328962	149
465	3300025937	Ga0207669_10060866	Ga0207669_100608663	149
466	3300025938	Ga0207704_10511385	Ga0207704_105113852	149
467	3300025939	Ga0207665_10071891	Ga0207665_100718911	149
468	3300025940	Ga0207691_10625166	Ga0207691_106251662	149
469	3300025940	Ga0207691_11181863	Ga0207691_111818631	149
470	3300025941	Ga0207711_10066558	Ga0207711_100665583	149
471	3300025941	Ga0207711_10322575	Ga0207711_103225752	149
472	3300025941	Ga0207711_10719984	Ga0207711_107199842	149
473	3300025942	Ga0207689_10431554	Ga0207689_104315542	149
474	3300025942	Ga0207689_10489783	Ga0207689_104897832	149
475	3300025944	Ga0207661_10294103	Ga0207661_102941032	149
476	3300025945	Ga0207679_10705853	Ga0207679_107058532	149
477	3300025945	Ga0207679_11010163	Ga0207679_110101632	149
478	3300025949	Ga0207667_10088858	Ga0207667_100888583	149
479	3300025949	Ga0207667_10235405	Ga0207667_102354052	149
480	3300025949	Ga0207667_11088976	Ga0207667_110889762	149
481	3300025960	Ga0207651_10017921	Ga0207651_100179213	149
482	3300025960	Ga0207651_10090277	Ga0207651_100902772	149
483	3300025960	Ga0207651_10494488	Ga0207651_104944882	149
484	3300025960	Ga0207651_10646492	Ga0207651_106464922	149
485	3300025961	Ga0207712_10352224	Ga0207712_103522242	149
486	3300025972	Ga0207668_10374012	Ga0207668_103740122	149
487	3300025972	Ga0207668_10391070	Ga0207668_103910702	149
488	3300025981	Ga0207640_10006369	Ga0207640_100063694	149
489	3300025981	Ga0207640_10204428	Ga0207640_102044282	149
490	3300025981	Ga0207640_10832009	Ga0207640_108320092	149
491	3300025986	Ga0207658_10282658	Ga0207658_102826582	149
492	3300026023	Ga0207677_10867639	Ga0207677_108676392	149
493	3300026035	Ga0207703_10028565	Ga0207703_100285652	149
494	3300026035	Ga0207703_10060204	Ga0207703_100602042	149
495	3300026041	Ga0207639_10474314	Ga0207639_104743142	149
496	3300026041	Ga0207639_11092410	Ga0207639_110924102	149
497	3300026075	Ga0207708_10002322	Ga0207708_1000232214	149
498	3300026075	Ga0207708_10072644	Ga0207708_100726443	149
499	3300026089	Ga0207648_10001795	Ga0207648_100017958	149
500	3300026089	Ga0207648_10029032	Ga0207648_100290322	149
501	3300026095	Ga0207676_10903645	Ga0207676_109036452	149
502	3300026116	Ga0207674_10970745	Ga0207674_109707452	149
503	3300026118	Ga0207675_100000663	Ga0207675_10000066328	149
504	3300026118	Ga0207675_100003988	Ga0207675_10000398811	149
505	3300026118	Ga0207675_100155262	Ga0207675_1001552623	149
506	3300026118	Ga0207675_100530686	Ga0207675_1005306862	149
507	3300026118	Ga0207675_101216727	Ga0207675_1012167271	149
508	3300026121	Ga0207683_10018725	Ga0207683_100187252	149
509	3300026121	Ga0207683_10240755	Ga0207683_102407552	149
510	3300026121	Ga0207683_10325090	Ga0207683_103250902	149
511	3300026121	Ga0207683_11022360	Ga0207683_110223602	149
512	3300027907	Ga0207428_10276975	Ga0207428_102769752	149
513	3300028379	Ga0268266_10439317	Ga0268266_104393172	149
514	3300028379	Ga0268266_10559685	Ga0268266_105596852	149
515	3300028380	Ga0268265_10005488	Ga0268265_100054887	149
516	3300028380	Ga0268265_10249064	Ga0268265_102490641	149
517	3300028380	Ga0268265_11443110	Ga0268265_114431102	149
518	3300028381	Ga0268264_10183849	Ga0268264_101838492	149
519	3300028381	Ga0268264_10253912	Ga0268264_102539122	149
520	3300028381	Ga0268264_10308268	Ga0268264_103082682	149
521	3300032002	Ga0307416_100902246	Ga0307416_1009022462	149
522	3300032005	Ga0307411_10206745	Ga0307411_102067452	149
523	3300034816	Ga0373930_0002645	Ga0373930_0002645_1949_2428	149
524	3300034817	Ga0373948_0003490	Ga0373948_0003490_1792_2271	149
525	3300034818	Ga0373950_0007935	Ga0373950_0007935_1061_1540	149
526	3300034819	Ga0373958_0000787	Ga0373958_0000787_1033_1512	149
527	3300034957	Ga0373938_0000623	Ga0373938_0000623_699_1178	149
528	3300035084	Ga0373928_0008276	Ga0373928_0008276_155_634	149
529	3300035085	Ga0373929_0002530	Ga0373929_0002530_695_1174	149
530	3300035090	Ga0373949_0000860	Ga0373949_0000860_7522_8001	149
531	3300035091	Ga0373951_0001874	Ga0373951_0001874_360_839	149
532	3300035092	Ga0373952_0001623	Ga0373952_0001623_1474_1953	149
533	3300035112	Ga0373932_0000249	Ga0373932_0000249_9720_10199	149
534	3300035114	Ga0373939_0002254	Ga0373939_0002254_3432_3911	149
535	3300035115	Ga0373941_0000920	Ga0373941_0000920_1890_2369	149
536	3300035121	Ga0373960_0000159	Ga0373960_0000159_9983_10462	149
537	3300035207	Ga0373942_0000730	Ga0373942_0000730_7138_7617	149
538	3300035241	Ga0373961_0003649	Ga0373961_0003649_92_571	149
539	3300035242	Ga0373962_0006956	Ga0373962_0006956_1818_2297	149
540	3300035691	Ga0373931_0008703	Ga0373931_0008703_46_525	149
541	3300042436	Ga0439435_0016733	Ga0439435_0016733_817_1296	149
542	3300044694	Ga0466963_0073914	Ga0466963_0073914_284_763	149
543	3300045051	Ga0451576_0007824	Ga0451576_0007824_11174_11653	149
544	3300045051	Ga0451576_0033391	Ga0451576_0033391_3232_3711	149
545	3300045051	Ga0451576_0263670	Ga0451576_0263670_135_614	149
546	3300045976	Ga0466967_0272517	Ga0466967_0272517_235_714	149
547	3300045976	Ga0466967_0530812	Ga0466967_0530812_257_736	149
548	3300045976	Ga0466967_0726830	Ga0466967_0726830_185_670	149
549	3300046459	Ga0495629_0186846	Ga0495629_0186846_480_977	149
550	3300046533	Ga0495640_0842171	Ga0495640_0842171_18_494	149
551	3300046691	Ga0495670_0183028	Ga0495670_0183028_214_693	149
552	3300047318	Ga0495636_0535271	Ga0495636_0535271_70_549	149
553	3300048903	Ga0496100_0481920	Ga0496100_0481920_60_539	149
554	3300048905	Ga0496102_0039632	Ga0496102_0039632_3612_4094	149
555	3300048905	Ga0496102_0400797	Ga0496102_0400797_506_982	149
556	3300048909	Ga0496106_0054924	Ga0496106_0054924_499_978	149
557	3300048912	Ga0496109_1224624	Ga0496109_1224624_154_651	149
558	3300048915	Ga0496112_1095568	Ga0496112_1095568_81_563	149
559	3300049571	Ga0501034_0041021	Ga0501034_0041021_3408_3905	149
560	3300049571	Ga0501034_0094072	Ga0501034_0094072_1366_1866	149
561	3300049581	Ga0501047_0051971	Ga0501047_0051971_2656_3153	149
562	3300049584	Ga0501068_0319824	Ga0501068_0319824_379_858	149
563	3300049587	Ga0501071_0657025	Ga0501071_0657025_40_516	149
564	3300049589	Ga0501073_0312991	Ga0501073_0312991_273_773	149
565	3300049591	Ga0501075_0624658	Ga0501075_0624658_83_562	149
566	3300049679	Ga0501249_073628	Ga0501249_073628_13_510	149
567	3300049742	Ga0501080_0121081	Ga0501080_0121081_337_834	149
568	3300049742	Ga0501080_0253718	Ga0501080_0253718_347_826	149
569	3300049823	Ga0501044_0002441	Ga0501044_0002441_13433_13930	149
570	3300050507	nmdc:mga05p37_13615_c1	nmdc:mga05p37_13615_c1_1002_1478	149
571	3300050507	nmdc:mga05p37_1418972_c1	nmdc:mga05p37_1418972_c1_78_557	149
572	3300050507	nmdc:mga05p37_1630_c1	nmdc:mga05p37_1630_c1_10522_11007	149
573	3300050507	nmdc:mga05p37_168702_c1	nmdc:mga05p37_168702_c1_390_869	149
574	3300050507	nmdc:mga05p37_6587_c1	nmdc:mga05p37_6587_c1_6433_6924	149
575	3300050507	nmdc:mga05p37_7760_c1	nmdc:mga05p37_7760_c1_1093_1572	149
576	3300050511	nmdc:mga08y16_261850_c1	nmdc:mga08y16_261850_c1_724_1203	149
577	3300050512	nmdc:mga0n895_123_c1	nmdc:mga0n895_123_c1_44649_45125	149
578	3300050512	nmdc:mga0n895_301474_c1	nmdc:mga0n895_301474_c1_852_1331	149
579	3300050512	nmdc:mga0n895_3171_c1	nmdc:mga0n895_3171_c1_6680_7159	149
580	3300050512	nmdc:mga0n895_325313_c1	nmdc:mga0n895_325313_c1_516_995	149
581	3300050512	nmdc:mga0n895_47488_c1	nmdc:mga0n895_47488_c1_3184_3663	149
582	3300050512	nmdc:mga0n895_80794_c1	nmdc:mga0n895_80794_c1_1071_1550	149
583	3300050512	nmdc:mga0n895_94808_c1	nmdc:mga0n895_94808_c1_537_1025	149
584	3300050513	nmdc:mga0rr50_11476_c1	nmdc:mga0rr50_11476_c1_1561_2040	149
585	3300050513	nmdc:mga0rr50_15476_c1	nmdc:mga0rr50_15476_c1_3203_3679	149
586	3300050513	nmdc:mga0rr50_1968_c1	nmdc:mga0rr50_1968_c1_6132_6611	149
587	3300050513	nmdc:mga0rr50_27_c1	nmdc:mga0rr50_27_c1_79107_79583	149
588	3300050513	nmdc:mga0rr50_3578_c1	nmdc:mga0rr50_3578_c1_4238_4717	149
589	3300050513	nmdc:mga0rr50_36918_c1	nmdc:mga0rr50_36918_c1_2673_3152	149
590	3300050513	nmdc:mga0rr50_384260_c1	nmdc:mga0rr50_384260_c1_59_547	149
591	3300050514	nmdc:mga08x19_239398_c1	nmdc:mga08x19_239398_c1_641_1117	149
592	3300050514	nmdc:mga08x19_337_c1	nmdc:mga08x19_337_c1_30057_30533	149
593	3300050514	nmdc:mga08x19_6677_c1	nmdc:mga08x19_6677_c1_3494_3973	149
594	3300050514	nmdc:mga08x19_88899_c1	nmdc:mga08x19_88899_c1_631_1107	149
595	3300050514	nmdc:mga08x19_91721_c1	nmdc:mga08x19_91721_c1_536_1024	149
596	3300050515	nmdc:mga0a205_17852_c1	nmdc:mga0a205_17852_c1_2619_3098	149
597	3300050515	nmdc:mga0a205_35678_c1	nmdc:mga0a205_35678_c1_1365_1850	149
598	3300050515	nmdc:mga0a205_36439_c1	nmdc:mga0a205_36439_c1_504_983	149
599	3300050515	nmdc:mga0a205_704739_c1	nmdc:mga0a205_704739_c1_34_510	149
600	3300053085	Ga0495619_0286831	Ga0495619_0286831_590_1087	149
601	3300054114	Ga0501084_0802282	Ga0501084_0802282_253_732	149
602	3300059492	Ga0587073_0007534	Ga0587073_0007534_151_630	149
603	3300059492	Ga0587073_0023664	Ga0587073_0023664_622_1101	149
604	3300059492	Ga0587073_0071760	Ga0587073_0071760_155_634	149
605	3300059493	Ga0587077_143344	Ga0587077_143344_110_589	149
606	3300059504	Ga0587082_014065	Ga0587082_014065_163_642	149
607	3300059504	Ga0587082_043290	Ga0587082_043290_187_666	149
608	3300059505	Ga0587083_0038016	Ga0587083_0038016_396_875	149
609	3300059505	Ga0587083_0057191	Ga0587083_0057191_335_814	149
610	3300059506	Ga0587085_037004	Ga0587085_037004_176_658	149
611	3300059510	Ga0587090_015437	Ga0587090_015437_485_964	149
612	3300059511	Ga0587091_022568	Ga0587091_022568_467_946	149
613	3300059511	Ga0587091_042294	Ga0587091_042294_257_736	149
614	3300059511	Ga0587091_112191	Ga0587091_112191_117_596	149
615	3300059643	Ga0587072_027388	Ga0587072_027388_123_602	149

Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
6khu-assembly1.cif.gz_A	the crystal structure of a dgc protein from thermotoga maritima	0.8813	13	145
6khu-assembly1.cif.gz_A	the crystal structure of a dgc protein from thermotoga maritima	0.8438	13	145
4urq-assembly1.cif.gz_Z	crystal structure of ggdef domain (i site mutant) from t.maritima	0.8413	11	142
4iob-assembly1.cif.gz_A	crystal structure of the ggdef domain of pa1120 (yfin or tpbb) from pseudomonas aeruginosa at 2.7 ang.	0.8398	13	142
5llw-assembly1.cif.gz_A	bacteriophytochrome activated diguanylyl cyclase from idiomarina species a28l	0.819	7	142

ID	Description	Score	Start	End	Superfamily
4iobA00	Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Reverse transcriptase/Diguanylate cyclase domain	0.8398	13	142	3.30.70.270
3ezuA02	Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Reverse transcriptase/Diguanylate cyclase domain	0.8359	14	142	3.30.70.270
af_P38097_675_846_3.30.70.270	Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Reverse transcriptase/Diguanylate cyclase domain	0.8243	4	142	3.30.70.270
4ursA00	Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Reverse transcriptase/Diguanylate cyclase domain	0.8134	6	142	3.30.70.270
af_P76330_387_561_3.30.70.270	Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Reverse transcriptase/Diguanylate cyclase domain	0.8117	6	142	3.30.70.270

ID	Description	Score	Start	End
AF-A0A317HSI7-F1-model_v4	GGDEF domain-containing protein	0.9632	3	149
AF-A0A2V8HRI1-F1-model_v4	BioF2-like acetyltransferase domain-containing protein	0.946	1	149
AF-A0A317HSI7-F1-model_v4	GGDEF domain-containing protein	0.9443	3	149
AF-A0A1F2TC04-F1-model_v4	GGDEF domain-containing protein	0.9434	7	149
AF-A0A2V8HRI1-F1-model_v4	BioF2-like acetyltransferase domain-containing protein	0.9399	1	149

Feature Viewer

pLDDT	pTM	Quality
91.8	0.88	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F469412

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map