F469415

General Info

Members Datasets Scaffolds Average Seq Length
615 249 1230 393

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100263380|Ga0070680_1002633801
Length 451
Sequence LLLKVRNWSEAAAANAPGTIFVYPTVIAGNLTREKGLRDWELSHLGPGRADGCMAEFVIRLADERGRVQEQVQTGATAEELRARFVHAGYHVFSVKARGSVGWRKRRKVKLEPFLIFNQQFLTLIRAGLPILSSLQMLGKIQKSAHFSGQLDDVAGRVKRGEALSAAFEAQGAFPLMYTTTLLAGERAGNLQEVLDRYVGFQKVSLAFRKKLLGALIYPCVLLTLVAALMVFLLTVVVPQFAKLYDEMGSKLPAMTIDLLDTGKWLQHNIAWLGLAVLIVAALGYRFSLSERGRDFVDSFRVGVPVFGTIWLKYQVALFSRTLSTLLTGGLPLVPSLETAARSISSRKVSKAVFTSVGTVREGKSLADSLARTKVFPNLATDMITVGEQTGALPQMLNSVAEFFEEDVATALTAALNLVEPAILIIMGVVVVFILISLYLPIFSLGQAGGI

Samples

Sample ID Description Type Environment
1 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
84 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
87 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
88 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
137 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
138 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
139 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
140 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
141 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
142 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
143 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
144 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
145 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
146 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
147 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
148 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
149 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
150 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
151 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
152 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
153 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
154 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
155 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
156 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
157 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
158 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
161 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
162 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
163 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
164 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
165 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
166 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
167 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
168 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
169 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
170 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
171 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
172 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
173 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
174 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
175 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
176 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
177 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
178 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
179 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
180 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
181 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
182 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
183 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
184 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
185 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
186 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
187 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
188 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
189 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
190 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
191 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
192 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
193 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
194 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
195 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
196 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
197 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
198 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
199 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
200 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
201 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
202 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
203 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
204 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
205 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
206 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
207 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
208 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
209 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
210 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
211 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
212 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
213 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
214 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
215 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
216 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
217 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
218 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
219 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
220 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
221 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
222 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
223 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
224 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
225 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
226 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
227 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
228 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
229 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
230 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
238 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
239 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
240 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
242 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
243 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
244 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
245 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
246 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
247 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
248 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
249 2884215851 Edaphobacter sp. 12200R-103 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.35
Metatranscriptomes 0.49
Isolates 0.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.65
Nodule 0
Rhizoplane 3.41
Rhizosphere 95.12
Stem 0
Stem Tuber 0
Unclassified 6.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070680_100263380 3300005336 Bacteria 1459
2 Ga0065712_10107035 3300005290 Bacteria 1888
3 Ga0070658_10000006 3300005327 Bacteria 374835
4 Ga0070658_10010945 3300005327 Bacteria 7271
5 Ga0070658_10020239 3300005327 Bacteria 5331
6 Ga0070676_10104203 3300005328 Bacteria 1757
7 Ga0070683_100000026 3300005329 Bacteria 172308
8 Ga0070683_100014078 3300005329 Bacteria 6987
9 Ga0070683_100026162 3300005329 Bacteria 5250
10 Ga0070683_100039788 3300005329 Bacteria 4318
11 Ga0070683_100078945 3300005329 Bacteria 3080
12 Ga0070683_100144841 3300005329 Bacteria 2251
13 Ga0070683_100286395 3300005329 Bacteria 1567
14 Ga0070683_100359764 3300005329 Bacteria 1386
15 Ga0068869_100029587 3300005334 Bacteria 3838
16 Ga0070666_10011739 3300005335 Bacteria 5509
17 Ga0070680_100003509 3300005336 Bacteria 11704
18 Ga0068868_100002212 3300005338 Bacteria 13438
19 Ga0068868_100004058 3300005338 Bacteria 10208
20 Ga0068868_100074544 3300005338 Bacteria 2710
21 Ga0068868_100150074 3300005338 Bacteria 1919
22 Ga0070660_100010222 3300005339 Bacteria 6622
23 Ga0070660_100016423 3300005339 Bacteria 5371
24 Ga0070660_100021357 3300005339 Bacteria 4773
25 Ga0070660_100048528 3300005339 Bacteria 3261
26 Ga0070660_100150556 3300005339 Bacteria 1870
27 Ga0070661_100018809 3300005344 Bacteria 4917
28 Ga0070661_100034341 3300005344 Bacteria 3678
29 Ga0070661_100054873 3300005344 Bacteria 2918
30 Ga0070661_100083115 3300005344 Bacteria 2365
31 Ga0070661_100255387 3300005344 Bacteria 1354
32 Ga0070668_100188046 3300005347 Bacteria 1690
33 Ga0070675_100011468 3300005354 Bacteria 6939
34 Ga0070671_100001968 3300005355 Bacteria 15754
35 Ga0070671_100006301 3300005355 Bacteria 9461
36 Ga0070671_100079742 3300005355 Bacteria 2737
37 Ga0070673_100138512 3300005364 Bacteria 2051
38 Ga0070659_100008976 3300005366 Bacteria 7330
39 Ga0070659_100062553 3300005366 Bacteria 2943
40 Ga0070667_100007769 3300005367 Bacteria 8890
41 Ga0070709_10045333 3300005434 Bacteria 2728
42 Ga0070709_10111880 3300005434 Bacteria 1836
43 Ga0070709_10141871 3300005434 Bacteria 1652
44 Ga0070714_100085153 3300005435 Unclassified 2760
45 Ga0070714_100086450 3300005435 Bacteria 2740
46 Ga0070714_100149441 3300005435 Bacteria 2104
47 Ga0070713_100051113 3300005436 Unclassified 3418
48 Ga0070713_100102839 3300005436 Bacteria 2478
49 Ga0070713_100129810 3300005436 Bacteria 2221
50 Ga0070710_10009546 3300005437 Bacteria 4750
51 Ga0070711_100000560 3300005439 Bacteria 19430
52 Ga0070711_100016984 3300005439 Bacteria 4627
53 Ga0070711_100039446 3300005439 Unclassified 3181
54 Ga0070708_100000527 3300005445 Bacteria 28842
55 Ga0070708_100016031 3300005445 Bacteria 6207
56 Ga0070663_100094864 3300005455 Bacteria 2216
57 Ga0070681_10008556 3300005458 Bacteria 10024
58 Ga0070681_10020854 3300005458 Bacteria 6562
59 Ga0070681_10022421 3300005458 Bacteria 6341
60 Ga0070681_10030584 3300005458 Bacteria 5403
61 Ga0070681_10130724 3300005458 Bacteria 2443
62 Ga0070706_100000991 3300005467 Bacteria 30868
63 Ga0070706_100014724 3300005467 Bacteria 7226
64 Ga0070707_100001774 3300005468 Bacteria 20733
65 Ga0070698_100000182 3300005471 Bacteria 59279
66 Ga0070699_100123403 3300005518 Bacteria 2279
67 Ga0070679_100003530 3300005530 Bacteria 14319
68 Ga0070679_100009027 3300005530 Bacteria 9404
69 Ga0070679_100009151 3300005530 Bacteria 9348
70 Ga0070679_100012595 3300005530 Bacteria 8086
71 Ga0070679_100026776 3300005530 Bacteria 5671
72 Ga0070679_100047923 3300005530 Bacteria 4258
73 Ga0070679_100063912 3300005530 Bacteria 3668
74 Ga0070679_100124413 3300005530 Unclassified 2561
75 Ga0070684_100000052 3300005535 Bacteria 77818
76 Ga0070684_100024735 3300005535 Bacteria 5040
77 Ga0070684_100056800 3300005535 Bacteria 3416
78 Ga0070684_100060442 3300005535 Bacteria 3315
79 Ga0070684_100066440 3300005535 Bacteria 3166
80 Ga0070684_100209630 3300005535 Unclassified 1776
81 Ga0070697_100000145 3300005536 Bacteria 57445
82 Ga0070697_100005158 3300005536 Bacteria 10034
83 Ga0070697_100007316 3300005536 Bacteria 8588
84 Ga0068853_100000048 3300005539 Bacteria 93122
85 Ga0068853_100004027 3300005539 Bacteria 11303
86 Ga0068853_100018550 3300005539 Bacteria 5759
87 Ga0068853_100057468 3300005539 Bacteria 3357
88 Ga0068853_100102693 3300005539 Bacteria 2530
89 Ga0068853_100169451 3300005539 Bacteria 1975
90 Ga0068853_100195309 3300005539 Bacteria 1840
91 Ga0070672_100013927 3300005543 Bacteria 5689
92 Ga0070693_100030846 3300005547 Bacteria 2934
93 Ga0070665_100009049 3300005548 Bacteria 10088
94 Ga0068855_100000779 3300005563 Bacteria 39345
95 Ga0068855_100001199 3300005563 Bacteria 32207
96 Ga0068855_100003139 3300005563 Bacteria 20209
97 Ga0068855_100010052 3300005563 Bacteria 11403
98 Ga0068855_100014685 3300005563 Bacteria 9433
99 Ga0068855_100021681 3300005563 Bacteria 7705
100 Ga0068855_100022708 3300005563 Bacteria 7517
101 Ga0068855_100036573 3300005563 Bacteria 5843
102 Ga0068855_100125022 3300005563 Bacteria 2941
103 Ga0068855_100188244 3300005563 Bacteria 2330
104 Ga0068855_100204477 3300005563 Unclassified 2222
105 Ga0068855_100275504 3300005563 Bacteria 1870
106 Ga0068855_100412952 3300005563 Bacteria 1477
107 Ga0070664_100205222 3300005564 Bacteria 1760
108 Ga0068857_100033055 3300005577 Bacteria 4573
109 Ga0068854_100000162 3300005578 Bacteria 46114
110 Ga0068854_100001703 3300005578 Bacteria 13384
111 Ga0068854_100015375 3300005578 Bacteria 5068
112 Ga0068856_100001552 3300005614 Bacteria 24044
113 Ga0068856_100003644 3300005614 Bacteria 15475
114 Ga0068856_100019956 3300005614 Bacteria 6506
115 Ga0068856_100034507 3300005614 Bacteria 4955
116 Ga0068856_100055703 3300005614 Bacteria 3902
117 Ga0068856_100058264 3300005614 Bacteria 3814
118 Ga0068856_100150202 3300005614 Bacteria 2338
119 Ga0068856_100312846 3300005614 Bacteria 1588
120 Ga0068852_100000020 3300005616 Bacteria 126369
121 Ga0068852_100000076 3300005616 Bacteria 69262
122 Ga0068852_100047633 3300005616 Bacteria 3657
123 Ga0068852_100049875 3300005616 Bacteria 3583
124 Ga0068852_100088910 3300005616 Bacteria 2760
125 Ga0068852_100104639 3300005616 Bacteria 2562
126 Ga0068852_100140047 3300005616 Bacteria 2238
127 Ga0068859_100002652 3300005617 Bacteria 18191
128 Ga0068864_100013077 3300005618 Bacteria 6875
129 Ga0068864_100035848 3300005618 Bacteria 4224
130 Ga0068864_100140398 3300005618 Bacteria 2179
131 Ga0068851_10014160 3300005834 Bacteria 3783
132 Ga0068851_10030072 3300005834 Bacteria 2692
133 Ga0068863_100006138 3300005841 Bacteria 11785
134 Ga0068863_100019423 3300005841 Bacteria 6500
135 Ga0068863_100028891 3300005841 Bacteria 5295
136 Ga0068863_100155579 3300005841 Bacteria 2189
137 Ga0068858_100029825 3300005842 Bacteria 5068
138 Ga0068860_100004905 3300005843 Bacteria 13630
139 Ga0068860_100127663 3300005843 Bacteria 2438
140 Ga0068860_100161900 3300005843 Unclassified 2158
141 Ga0070715_10008484 3300006163 Bacteria 3584
142 Ga0070715_10010809 3300006163 Bacteria 3264
143 Ga0070716_100032056 3300006173 Unclassified 2863
144 Ga0070712_100005892 3300006175 Bacteria 7581
145 Ga0070712_100016408 3300006175 Bacteria 4784
146 Ga0070712_100018603 3300006175 Bacteria 4515
147 Ga0070712_100087111 3300006175 Bacteria 2277
148 Ga0070712_100176684 3300006175 Bacteria 1661
149 Ga0097621_100000659 3300006237 Bacteria 24318
150 Ga0097621_100000868 3300006237 Bacteria 21247
151 Ga0097621_100036561 3300006237 Bacteria 3929
152 Ga0097621_100151209 3300006237 Bacteria 1991
153 Ga0068871_100000643 3300006358 Bacteria 24041
154 Ga0068871_100007389 3300006358 Bacteria 7845
155 Ga0068871_100009209 3300006358 Bacteria 7141
156 Ga0075433_10019585 3300006852 Bacteria 5641
157 Ga0075434_100009567 3300006871 Bacteria 9048
158 Ga0068865_100022268 3300006881 Unclassified 4131
159 Ga0075436_100008566 3300006914 Bacteria 6989
160 Ga0097620_100002652 3300006931 Bacteria 18191
161 Ga0075435_100050109 3300007076 Bacteria 3360
162 Ga0105240_10000145 3300009093 Bacteria 143918
163 Ga0105240_10004691 3300009093 Bacteria 20668
164 Ga0105240_10006261 3300009093 Bacteria 17508
165 Ga0105240_10008784 3300009093 Bacteria 14391
166 Ga0105240_10010259 3300009093 Bacteria 13186
167 Ga0105240_10010803 3300009093 Bacteria 12790
168 Ga0105240_10011810 3300009093 Bacteria 12132
169 Ga0105240_10015597 3300009093 Bacteria 10324
170 Ga0105240_10027813 3300009093 Bacteria 7399
171 Ga0105240_10048043 3300009093 Bacteria 5396
172 Ga0105240_10065803 3300009093 Bacteria 4498
173 Ga0105240_10105319 3300009093 Bacteria 3424
174 Ga0111539_10255904 3300009094 Unclassified 2039
175 Ga0105245_10019102 3300009098 Bacteria 5999
176 Ga0105245_10036235 3300009098 Bacteria 4381
177 Ga0105245_10090483 3300009098 Bacteria 2815
178 Ga0105245_10104376 3300009098 Bacteria 2627
179 Ga0105247_10001226 3300009101 Bacteria 19037
180 Ga0105247_10018110 3300009101 Bacteria 4225
181 Ga0105241_10000021 3300009174 Bacteria 143251
182 Ga0105241_10002045 3300009174 Bacteria 15239
183 Ga0105241_10043657 3300009174 Bacteria 3396
184 Ga0105241_10044145 3300009174 Bacteria 3377
185 Ga0105241_10049353 3300009174 Bacteria 3205
186 Ga0105241_10064734 3300009174 Unclassified 2824
187 Ga0105241_10068641 3300009174 Bacteria 2747
188 Ga0105241_10076725 3300009174 Bacteria 2607
189 Ga0105241_10222072 3300009174 Bacteria 1589
190 Ga0105248_10000002 3300009177 Bacteria 1054120
191 Ga0105248_10003676 3300009177 Bacteria 16990
192 Ga0105248_10012972 3300009177 Bacteria 9186
193 Ga0105248_10017963 3300009177 Bacteria 7806
194 Ga0105248_10068806 3300009177 Bacteria 3975
195 Ga0105248_10092801 3300009177 Bacteria 3400
196 Ga0105248_10143129 3300009177 Bacteria 2698
197 Ga0105237_10022176 3300009545 Bacteria 6516
198 Ga0105238_10001529 3300009551 Bacteria 23182
199 Ga0105238_10002554 3300009551 Bacteria 18184
200 Ga0105238_10003653 3300009551 Bacteria 15342
201 Ga0105238_10047690 3300009551 Unclassified 4318
202 Ga0105238_10058248 3300009551 Bacteria 3872
203 Ga0105238_10071087 3300009551 Bacteria 3477
204 Ga0105238_10131920 3300009551 Bacteria 2477
205 Ga0105238_10177753 3300009551 Bacteria 2105
206 Ga0105238_10184603 3300009551 Bacteria 2062
207 Ga0105238_10225818 3300009551 Bacteria 1849
208 Ga0105249_10005216 3300009553 Bacteria 11215
209 Ga0105249_10078940 3300009553 Bacteria 3055
210 Ga0105239_10002245 3300010375 Bacteria 24694
211 Ga0105239_10015712 3300010375 Bacteria 8379
212 Ga0105239_10071791 3300010375 Bacteria 3804
213 Ga0105239_10142905 3300010375 Bacteria 2668
214 Ga0105239_10437974 3300010375 Bacteria 1482
215 Ga0105246_10029905 3300011119 Bacteria 3593
216 Ga0157373_10080635 3300013100 Bacteria 2295
217 Ga0157373_10180032 3300013100 Unclassified 1488
218 Ga0157371_10041666 3300013102 Bacteria 3276
219 Ga0157371_10149737 3300013102 Bacteria 1664
220 Ga0157370_10000110 3300013104 Bacteria 95051
221 Ga0157370_10004449 3300013104 Bacteria 16064
222 Ga0157370_10008373 3300013104 Bacteria 11155
223 Ga0157370_10011493 3300013104 Bacteria 9251
224 Ga0157370_10032361 3300013104 Bacteria 5107
225 Ga0157370_10148245 3300013104 Bacteria 2184
226 Ga0157370_10154200 3300013104 Bacteria 2137
227 Ga0157369_10000162 3300013105 Bacteria 94983
228 Ga0157369_10001912 3300013105 Bacteria 25132
229 Ga0157369_10002760 3300013105 Bacteria 20967
230 Ga0157369_10007907 3300013105 Bacteria 12226
231 Ga0157369_10009498 3300013105 Bacteria 11121
232 Ga0157369_10015626 3300013105 Bacteria 8555
233 Ga0157369_10028247 3300013105 Bacteria 6210
234 Ga0157369_10034796 3300013105 Bacteria 5526
235 Ga0157369_10063895 3300013105 Bacteria 3965
236 Ga0157369_10074194 3300013105 Bacteria 3648
237 Ga0157369_10081270 3300013105 Bacteria 3468
238 Ga0157369_10121480 3300013105 Bacteria 2771
239 Ga0157369_10139411 3300013105 Bacteria 2567
240 Ga0157369_10242196 3300013105 Bacteria 1884
241 Ga0157374_10000705 3300013296 Bacteria 29341
242 Ga0157374_10001094 3300013296 Bacteria 23330
243 Ga0157374_10019189 3300013296 Bacteria 6050
244 Ga0157374_10043948 3300013296 Bacteria 4128
245 Ga0157374_10084156 3300013296 Bacteria 3023
246 Ga0157374_10125351 3300013296 Bacteria 2482
247 Ga0157374_10137050 3300013296 Bacteria 2373
248 Ga0157378_10001169 3300013297 Bacteria 23875
249 Ga0157378_10022903 3300013297 Bacteria 5498
250 Ga0157378_10028179 3300013297 Bacteria 4954
251 Ga0163162_10017755 3300013306 Bacteria 6961
252 Ga0163162_10144873 3300013306 Bacteria 2491
253 Ga0157372_10000276 3300013307 Bacteria 56940
254 Ga0157372_10000328 3300013307 Bacteria 51987
255 Ga0157372_10004425 3300013307 Bacteria 14985
256 Ga0157372_10004482 3300013307 Bacteria 14902
257 Ga0157372_10004811 3300013307 Bacteria 14352
258 Ga0157372_10005637 3300013307 Bacteria 13307
259 Ga0157372_10008740 3300013307 Bacteria 10753
260 Ga0157372_10016055 3300013307 Bacteria 8033
261 Ga0157372_10019099 3300013307 Bacteria 7379
262 Ga0157372_10049999 3300013307 Bacteria 4651
263 Ga0157372_10102373 3300013307 Unclassified 3271
264 Ga0157372_10111250 3300013307 Bacteria 3138
265 Ga0157372_10148239 3300013307 Bacteria 2706
266 Ga0157372_10175278 3300013307 Bacteria 2482
267 Ga0157372_10248305 3300013307 Bacteria 2065
268 Ga0157372_10580476 3300013307 Unclassified 1306
269 Ga0157375_10082577 3300013308 Bacteria 3255
270 Ga0157375_10118371 3300013308 Bacteria 2755
271 Ga0163163_10001462 3300014325 Bacteria 19968
272 Ga0163163_10031322 3300014325 Bacteria 5132
273 Ga0163163_10061372 3300014325 Bacteria 3725
274 Ga0163163_10153442 3300014325 Bacteria 2346
275 Ga0182008_10024308 3300014497 Bacteria 3086
276 Ga0182008_10062698 3300014497 Bacteria 1832
277 Ga0157379_10031827 3300014968 Bacteria 4699
278 Ga0157379_10062567 3300014968 Bacteria 3328
279 Ga0157379_10145244 3300014968 Bacteria 2139
280 Ga0157376_10041753 3300014969 Bacteria 3758
281 Ga0157376_10076753 3300014969 Bacteria 2855
282 Ga0157376_10085899 3300014969 Bacteria 2712
283 Ga0157376_10208571 3300014969 Bacteria 1802
284 Ga0182007_10008529 3300015262 Bacteria 4202
285 Ga0206356_10735713 3300020070 Unclassified 1883
286 Ga0206352_11046716 3300020078 Bacteria 2034
287 Ga0213872_10002230 3300021361 Bacteria 11594
288 Ga0213872_10079129 3300021361 Unclassified 1477
289 Ga0213872_10101287 3300021361 Bacteria 1284
290 Ga0213871_10001898 3300021441 Bacteria 3690
291 Ga0224712_10029438 3300022467 Bacteria 1972
292 Ga0207697_10017379 3300025315 Unclassified 2956
293 Ga0207656_10020753 3300025321 Bacteria 2614
294 Ga0207656_10090324 3300025321 Unclassified 1390
295 Ga0207710_10014870 3300025900 Bacteria 3287
296 Ga0207680_10026190 3300025903 Bacteria 3229
297 Ga0207647_10002131 3300025904 Bacteria 15124
298 Ga0207647_10007196 3300025904 Bacteria 8059
299 Ga0207685_10001322 3300025905 Bacteria 5111
300 Ga0207699_10029592 3300025906 Bacteria 3056
301 Ga0207699_10073026 3300025906 Bacteria 2103
302 Ga0207699_10095944 3300025906 Bacteria 1871
303 Ga0207705_10000012 3300025909 Bacteria 472336
304 Ga0207705_10000926 3300025909 Bacteria 23979
305 Ga0207705_10003726 3300025909 Bacteria 11602
306 Ga0207705_10009234 3300025909 Bacteria 7177
307 Ga0207705_10014748 3300025909 Bacteria 5619
308 Ga0207705_10145713 3300025909 Unclassified 1771
309 Ga0207684_10001275 3300025910 Bacteria 27799
310 Ga0207654_10000021 3300025911 Bacteria 165620
311 Ga0207654_10000353 3300025911 Bacteria 27374
312 Ga0207654_10027918 3300025911 Bacteria 3073
313 Ga0207654_10048687 3300025911 Bacteria 2427
314 Ga0207654_10141655 3300025911 Bacteria 1534
315 Ga0207707_10004412 3300025912 Bacteria 12419
316 Ga0207707_10006696 3300025912 Bacteria 10055
317 Ga0207707_10020621 3300025912 Bacteria 5757
318 Ga0207707_10148218 3300025912 Bacteria 2051
319 Ga0207707_10230490 3300025912 Bacteria 1611
320 Ga0207695_10000035 3300025913 Bacteria 486590
321 Ga0207695_10000047 3300025913 Bacteria 422459
322 Ga0207695_10000162 3300025913 Bacteria 198155
323 Ga0207695_10000249 3300025913 Bacteria 140258
324 Ga0207695_10006831 3300025913 Bacteria 14695
325 Ga0207695_10032820 3300025913 Bacteria 5675
326 Ga0207695_10062979 3300025913 Bacteria 3825
327 Ga0207695_10089609 3300025913 Bacteria 3093
328 Ga0207695_10099762 3300025913 Bacteria 2901
329 Ga0207695_10123892 3300025913 Bacteria 2549
330 Ga0207671_10000695 3300025914 Bacteria 43535
331 Ga0207671_10001527 3300025914 Bacteria 26553
332 Ga0207693_10001998 3300025915 Bacteria 17899
333 Ga0207693_10010900 3300025915 Bacteria 7371
334 Ga0207693_10013115 3300025915 Bacteria 6686
335 Ga0207693_10096294 3300025915 Unclassified 2320
336 Ga0207693_10159849 3300025915 Bacteria 1772
337 Ga0207663_10005051 3300025916 Bacteria 6626
338 Ga0207663_10005463 3300025916 Bacteria 6402
339 Ga0207657_10004718 3300025919 Bacteria 14382
340 Ga0207657_10007062 3300025919 Bacteria 11535
341 Ga0207657_10010195 3300025919 Bacteria 9387
342 Ga0207657_10017676 3300025919 Bacteria 6832
343 Ga0207657_10068416 3300025919 Bacteria 3017
344 Ga0207649_10011291 3300025920 Bacteria 4922
345 Ga0207652_10004080 3300025921 Bacteria 11912
346 Ga0207652_10020537 3300025921 Bacteria 5441
347 Ga0207652_10031157 3300025921 Bacteria 4476
348 Ga0207652_10053283 3300025921 Bacteria 3475
349 Ga0207652_10143469 3300025921 Unclassified 2136
350 Ga0207652_10181700 3300025921 Bacteria 1890
351 Ga0207646_10004583 3300025922 Bacteria 14954
352 Ga0207694_10000146 3300025924 Bacteria 72706
353 Ga0207694_10001342 3300025924 Bacteria 21187
354 Ga0207694_10003063 3300025924 Bacteria 13401
355 Ga0207694_10010647 3300025924 Bacteria 6939
356 Ga0207694_10012659 3300025924 Bacteria 6356
357 Ga0207694_10020394 3300025924 Bacteria 5015
358 Ga0207694_10025300 3300025924 Bacteria 4511
359 Ga0207694_10058701 3300025924 Bacteria 2993
360 Ga0207694_10149441 3300025924 Bacteria 1881
361 Ga0207694_10220885 3300025924 Bacteria 1546
362 Ga0207687_10009832 3300025927 Bacteria 6260
363 Ga0207700_10011522 3300025928 Bacteria 5644
364 Ga0207700_10043231 3300025928 Unclassified 3308
365 Ga0207700_10125975 3300025928 Bacteria 2084
366 Ga0207700_10258648 3300025928 Unclassified 1490
367 Ga0207664_10049192 3300025929 Unclassified 3318
368 Ga0207664_10236405 3300025929 Bacteria 1590
369 Ga0207644_10002170 3300025931 Bacteria 12730
370 Ga0207644_10068616 3300025931 Bacteria 2587
371 Ga0207706_10023642 3300025933 Bacteria 5518
372 Ga0207704_10052026 3300025938 Bacteria 2481
373 Ga0207665_10033956 3300025939 Bacteria 3384
374 Ga0207691_10010952 3300025940 Bacteria 8704
375 Ga0207711_10000052 3300025941 Bacteria 138437
376 Ga0207711_10010188 3300025941 Bacteria 7804
377 Ga0207711_10044232 3300025941 Bacteria 3801
378 Ga0207711_10257391 3300025941 Bacteria 1604
379 Ga0207689_10001357 3300025942 Bacteria 23510
380 Ga0207661_10000003 3300025944 Bacteria 611941
381 Ga0207661_10022357 3300025944 Bacteria 4761
382 Ga0207661_10054024 3300025944 Bacteria 3217
383 Ga0207679_10075009 3300025945 Bacteria 2565
384 Ga0207679_10276332 3300025945 Bacteria 1439
385 Ga0207667_10000079 3300025949 Bacteria 163341
386 Ga0207667_10000959 3300025949 Bacteria 36774
387 Ga0207667_10001865 3300025949 Bacteria 26498
388 Ga0207667_10004151 3300025949 Bacteria 17799
389 Ga0207667_10009456 3300025949 Bacteria 11477
390 Ga0207667_10016397 3300025949 Bacteria 8374
391 Ga0207667_10016683 3300025949 Bacteria 8289
392 Ga0207667_10021909 3300025949 Bacteria 7072
393 Ga0207667_10024286 3300025949 Bacteria 6657
394 Ga0207667_10116284 3300025949 Unclassified 2756
395 Ga0207667_10128623 3300025949 Bacteria 2609
396 Ga0207667_10133173 3300025949 Bacteria 2560
397 Ga0207667_10147024 3300025949 Bacteria 2426
398 Ga0207667_10169606 3300025949 Unclassified 2243
399 Ga0207667_10233552 3300025949 Bacteria 1883
400 Ga0207640_10000013 3300025981 Bacteria 224767
401 Ga0207640_10033707 3300025981 Bacteria 3189
402 Ga0207640_10067114 3300025981 Bacteria 2399
403 Ga0207658_10003237 3300025986 Bacteria 11572
404 Ga0207677_10002086 3300026023 Bacteria 10525
405 Ga0207677_10011171 3300026023 Bacteria 5107
406 Ga0207677_10072677 3300026023 Bacteria 2432
407 Ga0207639_10000075 3300026041 Bacteria 90425
408 Ga0207639_10000098 3300026041 Bacteria 73865
409 Ga0207639_10023477 3300026041 Bacteria 4454
410 Ga0207639_10030668 3300026041 Bacteria 3945
411 Ga0207639_10075020 3300026041 Bacteria 2658
412 Ga0207639_10145515 3300026041 Bacteria 1979
413 Ga0207678_10000423 3300026067 Bacteria 38375
414 Ga0207678_10002544 3300026067 Bacteria 16624
415 Ga0207678_10080012 3300026067 Unclassified 2798
416 Ga0207702_10001223 3300026078 Bacteria 25973
417 Ga0207702_10011498 3300026078 Bacteria 7374
418 Ga0207702_10017646 3300026078 Bacteria 5905
419 Ga0207641_10002437 3300026088 Bacteria 17196
420 Ga0207641_10014846 3300026088 Bacteria 6384
421 Ga0207648_10050950 3300026089 Bacteria 3619
422 Ga0207676_10083303 3300026095 Bacteria 2604
423 Ga0207674_10004161 3300026116 Bacteria 17501
424 Ga0207674_10004575 3300026116 Bacteria 16614
425 Ga0207674_10023710 3300026116 Bacteria 6567
426 Ga0207674_10091369 3300026116 Bacteria 3034
427 Ga0207674_10193332 3300026116 Bacteria 1984
428 Ga0207674_10329432 3300026116 Unclassified 1477
429 Ga0207683_10001884 3300026121 Bacteria 18560
430 Ga0207698_10000025 3300026142 Bacteria 122764
431 Ga0207698_10000229 3300026142 Bacteria 35051
432 Ga0207698_10043819 3300026142 Bacteria 3356
433 Ga0207698_10062041 3300026142 Bacteria 2917
434 Ga0207698_10310909 3300026142 Bacteria 1471
435 Ga0268266_10020467 3300028379 Bacteria 5638
436 Ga0268264_10039864 3300028381 Bacteria 3880
437 Ga0265318_10014113 3300028577 Unclassified 3358
438 Ga0265336_10001731 3300028666 Bacteria 9585
439 Ga0265338_10021292 3300028800 Bacteria 6767
440 Ga0265330_10002202 3300031235 Bacteria 10749
441 Ga0265330_10005779 3300031235 Bacteria 6141
442 Ga0265330_10019894 3300031235 Bacteria 3069
443 Ga0265330_10029240 3300031235 Bacteria 2480
444 Ga0265332_10063357 3300031238 Unclassified 1580
445 Ga0265320_10034246 3300031240 Bacteria 2585
446 Ga0265325_10010960 3300031241 Bacteria 5222
447 Ga0265325_10044542 3300031241 Bacteria 2310
448 Ga0265325_10070173 3300031241 Unclassified 1761
449 Ga0265339_10000119 3300031249 Bacteria 64829
450 Ga0265339_10025352 3300031249 Bacteria 3403
451 Ga0265339_10051865 3300031249 Bacteria 2236
452 Ga0265316_10001682 3300031344 Bacteria 23511
453 Ga0265316_10007934 3300031344 Bacteria 9930
454 Ga0265316_10035428 3300031344 Bacteria 4045
455 Ga0265316_10169687 3300031344 Bacteria 1628
456 Ga0265313_10010783 3300031595 Bacteria 5741
457 Ga0265313_10018374 3300031595 Bacteria 3926
458 Ga0265313_10024788 3300031595 Bacteria 3195
459 Ga0265314_10000946 3300031711 Bacteria 34185
460 Ga0265342_10001022 3300031712 Bacteria 27535
461 Ga0265342_10007567 3300031712 Bacteria 7930
462 Ga0265342_10043665 3300031712 Bacteria 2704
463 Ga0265342_10053801 3300031712 Bacteria 2394
464 Ga0265342_10094840 3300031712 Bacteria 1707
465 Ga0307416_100131040 3300032002 Bacteria 2257
466 Ga0307510_10059623 3300033180 Bacteria 3938
467 Ga0373936_0038471 3300035113 Unclassified 1912
468 Ga0373945_0000772 3300035116 Bacteria 9344
469 Ga0373946_0013855 3300035171 Unclassified 3035
470 Ga0373955_0025240 3300035172 Bacteria 3050
471 Ga0373924_0005764 3300035410 Bacteria 4403
472 Ga0373931_0043870 3300035691 Unclassified 2357
473 Ga0373935_0033208 3300035692 Bacteria 3210
474 Ga0373927_0092679 3300035695 Unclassified 1962
475 Ga0373937_0005221 3300036401 Bacteria 11095
476 Ga0373937_0008290 3300036401 Bacteria 9022
477 Ga0373937_0182150 3300036401 Bacteria 1973
478 Ga0373925_0127054 3300037068 Bacteria 1984
479 Ga0373925_0193365 3300037068 Bacteria 1615
480 Ga0395898_0105588 3300037466 Bacteria 2701
481 Ga0436360_0153839 3300039438 Bacteria 8340
482 Ga0436360_0313429 3300039438 Unclassified 1523
483 Ga0436360_0799809 3300039438 Bacteria 1768
484 Ga0436361_0035228 3300039447 Bacteria 17454
485 Ga0436361_0155239 3300039447 Bacteria 16247
486 Ga0436361_0664697 3300039447 Bacteria 3345
487 Ga0436362_1064123 3300039453 Bacteria 2163
488 Ga0439448_0046732 3300042005 Bacteria 1411
489 Ga0451577_0002999 3300042876 Bacteria 19237
490 Ga0466966_0166000 3300044684 Unclassified 1343
491 Ga0466963_0007713 3300044694 Bacteria 6430
492 Ga0453684_0000686 3300044712 Bacteria 120659
493 Ga0466957_0005168 3300044842 Bacteria 7298
494 Ga0466957_0169368 3300044842 Bacteria 1422
495 Ga0466959_0034602 3300045049 Bacteria 3737
496 Ga0451576_0035610 3300045051 Bacteria 5279
497 Ga0466958_0031896 3300045836 Bacteria 3132
498 Ga0466967_0000722 3300045976 Bacteria 16880
499 Ga0466967_0126492 3300045976 Bacteria 2368
500 Ga0495629_0061328 3300046459 Bacteria 2628
501 Ga0495651_0070125 3300046462 Bacteria 2668
502 Ga0495651_0182880 3300046462 Bacteria 1482
503 Ga0495650_0000010 3300046471 Bacteria 645599
504 Ga0495580_0013802 3300046472 Bacteria 6150
505 Ga0495580_0017346 3300046472 Bacteria 5386
506 Ga0495580_0017853 3300046472 Bacteria 5292
507 Ga0495580_0067857 3300046472 Bacteria 2495
508 Ga0495580_0071986 3300046472 Bacteria 2415
509 Ga0495580_0103193 3300046472 Bacteria 1982
510 Ga0495582_0144417 3300046473 Bacteria 1349
511 Ga0495639_0000499 3300046475 Bacteria 18495
512 Ga0495662_0018342 3300046476 Bacteria 3386
513 Ga0495664_0028740 3300046477 Bacteria 3247
514 Ga0495594_0013364 3300046499 Bacteria 4286
515 Ga0495594_0068501 3300046499 Bacteria 1971
516 Ga0495607_0099800 3300046501 Bacteria 1557
517 Ga0495628_0131431 3300046516 Bacteria 1914
518 Ga0495630_0061592 3300046517 Bacteria 2818
519 Ga0495644_0000293 3300046523 Bacteria 23152
520 Ga0495652_0026706 3300046529 Bacteria 5097
521 Ga0495665_0032614 3300046531 Bacteria 2786
522 Ga0495640_0037786 3300046533 Bacteria 3401
523 Ga0495586_0105245 3300046535 Bacteria 1568
524 Ga0495587_0062537 3300046536 Bacteria 2179
525 Ga0495645_0001441 3300046543 Bacteria 16057
526 Ga0495645_0004268 3300046543 Bacteria 9765
527 Ga0495645_0107870 3300046543 Bacteria 1973
528 Ga0495667_0080145 3300046559 Bacteria 2122
529 Ga0495668_0036565 3300046616 Bacteria 2751
530 Ga0495668_0044165 3300046616 Bacteria 2477
531 Ga0495611_0020110 3300046648 Bacteria 2872
532 Ga0495625_0000962 3300046660 Bacteria 38327
533 Ga0495625_0113930 3300046660 Bacteria 1846
534 Ga0495635_0009005 3300046663 Bacteria 6963
535 Ga0495635_0161035 3300046663 Bacteria 1527
536 Ga0495661_0028628 3300046665 Bacteria 3564
537 Ga0495661_0099855 3300046665 Bacteria 1636
538 Ga0495599_0000633 3300046678 Bacteria 19880
539 Ga0495623_0017896 3300046679 Bacteria 4578
540 Ga0495623_0119714 3300046679 Unclassified 1586
541 Ga0495646_0118791 3300046680 Bacteria 1498
542 Ga0495646_0159748 3300046680 Bacteria 1248
543 Ga0495669_0003727 3300046684 Bacteria 6272
544 Ga0495613_0003439 3300046689 Bacteria 11829
545 Ga0495624_0030855 3300046690 Bacteria 3489
546 Ga0495670_0004637 3300046691 Bacteria 6739
547 Ga0495600_0000121 3300046809 Bacteria 43756
548 Ga0495600_0042568 3300046809 Bacteria 2961
549 Ga0495581_0000661 3300047315 Bacteria 18100
550 Ga0495581_0014668 3300047315 Bacteria 4544
551 Ga0495581_0076310 3300047315 Bacteria 1939
552 Ga0495604_0016981 3300047317 Bacteria 5821
553 Ga0495604_0128408 3300047317 Bacteria 1824
554 Ga0495674_0014220 3300047319 Bacteria 7452
555 Ga0495672_0001194 3300047320 Bacteria 26265
556 Ga0495676_0001724 3300047321 Bacteria 19113
557 Ga0495680_0052574 3300047322 Bacteria 3175
558 Ga0495675_0009872 3300047444 Bacteria 5951
559 Ga0495673_0028665 3300047469 Bacteria 2635
560 Ga0495686_0001896 3300047472 Bacteria 20897
561 Ga0495686_0012715 3300047472 Bacteria 5877
562 Ga0495686_0063376 3300047472 Bacteria 2291
563 Ga0495602_0054518 3300048088 Bacteria 3529
564 Ga0495602_0168542 3300048088 Bacteria 1702
565 Ga0495614_0000301 3300048089 Bacteria 19480
566 Ga0496102_0001348 3300048905 Bacteria 21995
567 Ga0496102_0012498 3300048905 Bacteria 7351
568 Ga0496102_0210548 3300048905 Bacteria 1833
569 Ga0496104_0021458 3300048907 Bacteria 5928
570 Ga0496104_0024866 3300048907 Bacteria 5515
571 Ga0496104_0033064 3300048907 Bacteria 4815
572 Ga0496104_0099246 3300048907 Bacteria 2787
573 Ga0496104_0138187 3300048907 Bacteria 2341
574 Ga0496104_0218664 3300048907 Bacteria 1817
575 Ga0496105_0028061 3300048908 Bacteria 4603
576 Ga0496106_0134758 3300048909 Bacteria 1939
577 Ga0496107_0222782 3300048910 Bacteria 1403
578 Ga0496111_0058945 3300048914 Bacteria 2781
579 Ga0496112_0010354 3300048915 Bacteria 8456
580 Ga0496112_0177723 3300048915 Unclassified 2093
581 Ga0496113_0001190 3300048916 Bacteria 14234
582 Ga0496113_0022309 3300048916 Bacteria 4476
583 Ga0496114_0020531 3300048917 Bacteria 5361
584 Ga0496115_0118202 3300048918 Bacteria 2180
585 Ga0496115_0137574 3300048918 Bacteria 2014
586 Ga0496115_0263883 3300048918 Unclassified 1416
587 Ga0496126_0000092 3300048929 Bacteria 209156
588 Ga0496126_0000713 3300048929 Bacteria 60401
589 Ga0496126_0001103 3300048929 Bacteria 45319
590 Ga0496126_0072041 3300048929 Bacteria 3075
591 Ga0495682_0024008 3300049460 Bacteria 2276
592 Ga0501031_0028119 3300049568 Bacteria 3666
593 Ga0501032_0001301 3300049569 Bacteria 20017
594 Ga0501034_0002411 3300049571 Bacteria 22636
595 Ga0501037_0066180 3300049573 Bacteria 2633
596 Ga0501038_0001959 3300049574 Bacteria 18992
597 Ga0501038_0087283 3300049574 Bacteria 2620
598 Ga0501043_0007195 3300049579 Bacteria 8843
599 Ga0501047_0001137 3300049581 Bacteria 26410
600 Ga0501077_0070201 3300049593 Bacteria 2220
601 Ga0501243_004498 3300049675 Bacteria 2093
602 Ga0501080_0004633 3300049742 Bacteria 12255
603 Ga0501035_0004980 3300049822 Bacteria 12591
604 Ga0501044_0166476 3300049823 Bacteria 2178
605 nmdc:mga0n895_24787_c1 3300050512 Bacteria 5658
606 nmdc:mga0n895_518_c1 3300050512 Bacteria 26232
607 nmdc:mga0rr50_81219_c1 3300050513 Bacteria 2501
608 nmdc:mga08x19_16609_c1 3300050514 Bacteria 4492
609 nmdc:mga0a205_6675_c1 3300050515 Bacteria 10441
610 Ga0500651_0000004 3300053093 Bacteria 389879
611 Ga0500595_000011 3300053119 Bacteria 268589
612 Ga0500595_009008 3300053119 Bacteria 4053
613 Ga0500595_018158 3300053119 Bacteria 2578
614 Ga0501084_0056349 3300054114 Bacteria 3288
615 2884219691 2884215851 Bacteria 4554841
616 Ga0070680_100263380
617 Ga0065712_10107035
618 Ga0070658_10000006
619 Ga0070658_10010945
620 Ga0070658_10020239
621 Ga0070676_10104203
622 Ga0070683_100000026
623 Ga0070683_100014078
624 Ga0070683_100026162
625 Ga0070683_100039788
626 Ga0070683_100078945
627 Ga0070683_100144841
628 Ga0070683_100286395
629 Ga0070683_100359764
630 Ga0068869_100029587
631 Ga0070666_10011739
632 Ga0070680_100003509
633 Ga0068868_100002212
634 Ga0068868_100004058
635 Ga0068868_100074544
636 Ga0068868_100150074
637 Ga0070660_100010222
638 Ga0070660_100016423
639 Ga0070660_100021357
640 Ga0070660_100048528
641 Ga0070660_100150556
642 Ga0070661_100018809
643 Ga0070661_100034341
644 Ga0070661_100054873
645 Ga0070661_100083115
646 Ga0070661_100255387
647 Ga0070668_100188046
648 Ga0070675_100011468
649 Ga0070671_100001968
650 Ga0070671_100006301
651 Ga0070671_100079742
652 Ga0070673_100138512
653 Ga0070659_100008976
654 Ga0070659_100062553
655 Ga0070667_100007769
656 Ga0070709_10045333
657 Ga0070709_10111880
658 Ga0070709_10141871
659 Ga0070714_100085153
660 Ga0070714_100086450
661 Ga0070714_100149441
662 Ga0070713_100051113
663 Ga0070713_100102839
664 Ga0070713_100129810
665 Ga0070710_10009546
666 Ga0070711_100000560
667 Ga0070711_100016984
668 Ga0070711_100039446
669 Ga0070708_100000527
670 Ga0070708_100016031
671 Ga0070663_100094864
672 Ga0070681_10008556
673 Ga0070681_10020854
674 Ga0070681_10022421
675 Ga0070681_10030584
676 Ga0070681_10130724
677 Ga0070706_100000991
678 Ga0070706_100014724
679 Ga0070707_100001774
680 Ga0070698_100000182
681 Ga0070699_100123403
682 Ga0070679_100003530
683 Ga0070679_100009027
684 Ga0070679_100009151
685 Ga0070679_100012595
686 Ga0070679_100026776
687 Ga0070679_100047923
688 Ga0070679_100063912
689 Ga0070679_100124413
690 Ga0070684_100000052
691 Ga0070684_100024735
692 Ga0070684_100056800
693 Ga0070684_100060442
694 Ga0070684_100066440
695 Ga0070684_100209630
696 Ga0070697_100000145
697 Ga0070697_100005158
698 Ga0070697_100007316
699 Ga0068853_100000048
700 Ga0068853_100004027
701 Ga0068853_100018550
702 Ga0068853_100057468
703 Ga0068853_100102693
704 Ga0068853_100169451
705 Ga0068853_100195309
706 Ga0070672_100013927
707 Ga0070693_100030846
708 Ga0070665_100009049
709 Ga0068855_100000779
710 Ga0068855_100001199
711 Ga0068855_100003139
712 Ga0068855_100010052
713 Ga0068855_100014685
714 Ga0068855_100021681
715 Ga0068855_100022708
716 Ga0068855_100036573
717 Ga0068855_100125022
718 Ga0068855_100188244
719 Ga0068855_100204477
720 Ga0068855_100275504
721 Ga0068855_100412952
722 Ga0070664_100205222
723 Ga0068857_100033055
724 Ga0068854_100000162
725 Ga0068854_100001703
726 Ga0068854_100015375
727 Ga0068856_100001552
728 Ga0068856_100003644
729 Ga0068856_100019956
730 Ga0068856_100034507
731 Ga0068856_100055703
732 Ga0068856_100058264
733 Ga0068856_100150202
734 Ga0068856_100312846
735 Ga0068852_100000020
736 Ga0068852_100000076
737 Ga0068852_100047633
738 Ga0068852_100049875
739 Ga0068852_100088910
740 Ga0068852_100104639
741 Ga0068852_100140047
742 Ga0068859_100002652
743 Ga0068864_100013077
744 Ga0068864_100035848
745 Ga0068864_100140398
746 Ga0068851_10014160
747 Ga0068851_10030072
748 Ga0068863_100006138
749 Ga0068863_100019423
750 Ga0068863_100028891
751 Ga0068863_100155579
752 Ga0068858_100029825
753 Ga0068860_100004905
754 Ga0068860_100127663
755 Ga0068860_100161900
756 Ga0070715_10008484
757 Ga0070715_10010809
758 Ga0070716_100032056
759 Ga0070712_100005892
760 Ga0070712_100016408
761 Ga0070712_100018603
762 Ga0070712_100087111
763 Ga0070712_100176684
764 Ga0097621_100000659
765 Ga0097621_100000868
766 Ga0097621_100036561
767 Ga0097621_100151209
768 Ga0068871_100000643
769 Ga0068871_100007389
770 Ga0068871_100009209
771 Ga0075433_10019585
772 Ga0075434_100009567
773 Ga0068865_100022268
774 Ga0075436_100008566
775 Ga0097620_100002652
776 Ga0075435_100050109
777 Ga0105240_10000145
778 Ga0105240_10004691
779 Ga0105240_10006261
780 Ga0105240_10008784
781 Ga0105240_10010259
782 Ga0105240_10010803
783 Ga0105240_10011810
784 Ga0105240_10015597
785 Ga0105240_10027813
786 Ga0105240_10048043
787 Ga0105240_10065803
788 Ga0105240_10105319
789 Ga0111539_10255904
790 Ga0105245_10019102
791 Ga0105245_10036235
792 Ga0105245_10090483
793 Ga0105245_10104376
794 Ga0105247_10001226
795 Ga0105247_10018110
796 Ga0105241_10000021
797 Ga0105241_10002045
798 Ga0105241_10043657
799 Ga0105241_10044145
800 Ga0105241_10049353
801 Ga0105241_10064734
802 Ga0105241_10068641
803 Ga0105241_10076725
804 Ga0105241_10222072
805 Ga0105248_10000002
806 Ga0105248_10003676
807 Ga0105248_10012972
808 Ga0105248_10017963
809 Ga0105248_10068806
810 Ga0105248_10092801
811 Ga0105248_10143129
812 Ga0105237_10022176
813 Ga0105238_10001529
814 Ga0105238_10002554
815 Ga0105238_10003653
816 Ga0105238_10047690
817 Ga0105238_10058248
818 Ga0105238_10071087
819 Ga0105238_10131920
820 Ga0105238_10177753
821 Ga0105238_10184603
822 Ga0105238_10225818
823 Ga0105249_10005216
824 Ga0105249_10078940
825 Ga0105239_10002245
826 Ga0105239_10015712
827 Ga0105239_10071791
828 Ga0105239_10142905
829 Ga0105239_10437974
830 Ga0105246_10029905
831 Ga0157373_10080635
832 Ga0157373_10180032
833 Ga0157371_10041666
834 Ga0157371_10149737
835 Ga0157370_10000110
836 Ga0157370_10004449
837 Ga0157370_10008373
838 Ga0157370_10011493
839 Ga0157370_10032361
840 Ga0157370_10148245
841 Ga0157370_10154200
842 Ga0157369_10000162
843 Ga0157369_10001912
844 Ga0157369_10002760
845 Ga0157369_10007907
846 Ga0157369_10009498
847 Ga0157369_10015626
848 Ga0157369_10028247
849 Ga0157369_10034796
850 Ga0157369_10063895
851 Ga0157369_10074194
852 Ga0157369_10081270
853 Ga0157369_10121480
854 Ga0157369_10139411
855 Ga0157369_10242196
856 Ga0157374_10000705
857 Ga0157374_10001094
858 Ga0157374_10019189
859 Ga0157374_10043948
860 Ga0157374_10084156
861 Ga0157374_10125351
862 Ga0157374_10137050
863 Ga0157378_10001169
864 Ga0157378_10022903
865 Ga0157378_10028179
866 Ga0163162_10017755
867 Ga0163162_10144873
868 Ga0157372_10000276
869 Ga0157372_10000328
870 Ga0157372_10004425
871 Ga0157372_10004482
872 Ga0157372_10004811
873 Ga0157372_10005637
874 Ga0157372_10008740
875 Ga0157372_10016055
876 Ga0157372_10019099
877 Ga0157372_10049999
878 Ga0157372_10102373
879 Ga0157372_10111250
880 Ga0157372_10148239
881 Ga0157372_10175278
882 Ga0157372_10248305
883 Ga0157372_10580476
884 Ga0157375_10082577
885 Ga0157375_10118371
886 Ga0163163_10001462
887 Ga0163163_10031322
888 Ga0163163_10061372
889 Ga0163163_10153442
890 Ga0182008_10024308
891 Ga0182008_10062698
892 Ga0157379_10031827
893 Ga0157379_10062567
894 Ga0157379_10145244
895 Ga0157376_10041753
896 Ga0157376_10076753
897 Ga0157376_10085899
898 Ga0157376_10208571
899 Ga0182007_10008529
900 Ga0206356_10735713
901 Ga0206352_11046716
902 Ga0213872_10002230
903 Ga0213872_10079129
904 Ga0213872_10101287
905 Ga0213871_10001898
906 Ga0224712_10029438
907 Ga0207697_10017379
908 Ga0207656_10020753
909 Ga0207656_10090324
910 Ga0207710_10014870
911 Ga0207680_10026190
912 Ga0207647_10002131
913 Ga0207647_10007196
914 Ga0207685_10001322
915 Ga0207699_10029592
916 Ga0207699_10073026
917 Ga0207699_10095944
918 Ga0207705_10000012
919 Ga0207705_10000926
920 Ga0207705_10003726
921 Ga0207705_10009234
922 Ga0207705_10014748
923 Ga0207705_10145713
924 Ga0207684_10001275
925 Ga0207654_10000021
926 Ga0207654_10000353
927 Ga0207654_10027918
928 Ga0207654_10048687
929 Ga0207654_10141655
930 Ga0207707_10004412
931 Ga0207707_10006696
932 Ga0207707_10020621
933 Ga0207707_10148218
934 Ga0207707_10230490
935 Ga0207695_10000035
936 Ga0207695_10000047
937 Ga0207695_10000162
938 Ga0207695_10000249
939 Ga0207695_10006831
940 Ga0207695_10032820
941 Ga0207695_10062979
942 Ga0207695_10089609
943 Ga0207695_10099762
944 Ga0207695_10123892
945 Ga0207671_10000695
946 Ga0207671_10001527
947 Ga0207693_10001998
948 Ga0207693_10010900
949 Ga0207693_10013115
950 Ga0207693_10096294
951 Ga0207693_10159849
952 Ga0207663_10005051
953 Ga0207663_10005463
954 Ga0207657_10004718
955 Ga0207657_10007062
956 Ga0207657_10010195
957 Ga0207657_10017676
958 Ga0207657_10068416
959 Ga0207649_10011291
960 Ga0207652_10004080
961 Ga0207652_10020537
962 Ga0207652_10031157
963 Ga0207652_10053283
964 Ga0207652_10143469
965 Ga0207652_10181700
966 Ga0207646_10004583
967 Ga0207694_10000146
968 Ga0207694_10001342
969 Ga0207694_10003063
970 Ga0207694_10010647
971 Ga0207694_10012659
972 Ga0207694_10020394
973 Ga0207694_10025300
974 Ga0207694_10058701
975 Ga0207694_10149441
976 Ga0207694_10220885
977 Ga0207687_10009832
978 Ga0207700_10011522
979 Ga0207700_10043231
980 Ga0207700_10125975
981 Ga0207700_10258648
982 Ga0207664_10049192
983 Ga0207664_10236405
984 Ga0207644_10002170
985 Ga0207644_10068616
986 Ga0207706_10023642
987 Ga0207704_10052026
988 Ga0207665_10033956
989 Ga0207691_10010952
990 Ga0207711_10000052
991 Ga0207711_10010188
992 Ga0207711_10044232
993 Ga0207711_10257391
994 Ga0207689_10001357
995 Ga0207661_10000003
996 Ga0207661_10022357
997 Ga0207661_10054024
998 Ga0207679_10075009
999 Ga0207679_10276332
1000 Ga0207667_10000079
1001 Ga0207667_10000959
1002 Ga0207667_10001865
1003 Ga0207667_10004151
1004 Ga0207667_10009456
1005 Ga0207667_10016397
1006 Ga0207667_10016683
1007 Ga0207667_10021909
1008 Ga0207667_10024286
1009 Ga0207667_10116284
1010 Ga0207667_10128623
1011 Ga0207667_10133173
1012 Ga0207667_10147024
1013 Ga0207667_10169606
1014 Ga0207667_10233552
1015 Ga0207640_10000013
1016 Ga0207640_10033707
1017 Ga0207640_10067114
1018 Ga0207658_10003237
1019 Ga0207677_10002086
1020 Ga0207677_10011171
1021 Ga0207677_10072677
1022 Ga0207639_10000075
1023 Ga0207639_10000098
1024 Ga0207639_10023477
1025 Ga0207639_10030668
1026 Ga0207639_10075020
1027 Ga0207639_10145515
1028 Ga0207678_10000423
1029 Ga0207678_10002544
1030 Ga0207678_10080012
1031 Ga0207702_10001223
1032 Ga0207702_10011498
1033 Ga0207702_10017646
1034 Ga0207641_10002437
1035 Ga0207641_10014846
1036 Ga0207648_10050950
1037 Ga0207676_10083303
1038 Ga0207674_10004161
1039 Ga0207674_10004575
1040 Ga0207674_10023710
1041 Ga0207674_10091369
1042 Ga0207674_10193332
1043 Ga0207674_10329432
1044 Ga0207683_10001884
1045 Ga0207698_10000025
1046 Ga0207698_10000229
1047 Ga0207698_10043819
1048 Ga0207698_10062041
1049 Ga0207698_10310909
1050 Ga0268266_10020467
1051 Ga0268264_10039864
1052 Ga0265318_10014113
1053 Ga0265336_10001731
1054 Ga0265338_10021292
1055 Ga0265330_10002202
1056 Ga0265330_10005779
1057 Ga0265330_10019894
1058 Ga0265330_10029240
1059 Ga0265332_10063357
1060 Ga0265320_10034246
1061 Ga0265325_10010960
1062 Ga0265325_10044542
1063 Ga0265325_10070173
1064 Ga0265339_10000119
1065 Ga0265339_10025352
1066 Ga0265339_10051865
1067 Ga0265316_10001682
1068 Ga0265316_10007934
1069 Ga0265316_10035428
1070 Ga0265316_10169687
1071 Ga0265313_10010783
1072 Ga0265313_10018374
1073 Ga0265313_10024788
1074 Ga0265314_10000946
1075 Ga0265342_10001022
1076 Ga0265342_10007567
1077 Ga0265342_10043665
1078 Ga0265342_10053801
1079 Ga0265342_10094840
1080 Ga0307416_100131040
1081 Ga0307510_10059623
1082 Ga0373936_0038471
1083 Ga0373945_0000772
1084 Ga0373946_0013855
1085 Ga0373955_0025240
1086 Ga0373924_0005764
1087 Ga0373931_0043870
1088 Ga0373935_0033208
1089 Ga0373927_0092679
1090 Ga0373937_0005221
1091 Ga0373937_0008290
1092 Ga0373937_0182150
1093 Ga0373925_0127054
1094 Ga0373925_0193365
1095 Ga0395898_0105588
1096 Ga0436360_0153839
1097 Ga0436360_0313429
1098 Ga0436360_0799809
1099 Ga0436361_0035228
1100 Ga0436361_0155239
1101 Ga0436361_0664697
1102 Ga0436362_1064123
1103 Ga0439448_0046732
1104 Ga0451577_0002999
1105 Ga0466966_0166000
1106 Ga0466963_0007713
1107 Ga0453684_0000686
1108 Ga0466957_0005168
1109 Ga0466957_0169368
1110 Ga0466959_0034602
1111 Ga0451576_0035610
1112 Ga0466958_0031896
1113 Ga0466967_0000722
1114 Ga0466967_0126492
1115 Ga0495629_0061328
1116 Ga0495651_0070125
1117 Ga0495651_0182880
1118 Ga0495650_0000010
1119 Ga0495580_0013802
1120 Ga0495580_0017346
1121 Ga0495580_0017853
1122 Ga0495580_0067857
1123 Ga0495580_0071986
1124 Ga0495580_0103193
1125 Ga0495582_0144417
1126 Ga0495639_0000499
1127 Ga0495662_0018342
1128 Ga0495664_0028740
1129 Ga0495594_0013364
1130 Ga0495594_0068501
1131 Ga0495607_0099800
1132 Ga0495628_0131431
1133 Ga0495630_0061592
1134 Ga0495644_0000293
1135 Ga0495652_0026706
1136 Ga0495665_0032614
1137 Ga0495640_0037786
1138 Ga0495586_0105245
1139 Ga0495587_0062537
1140 Ga0495645_0001441
1141 Ga0495645_0004268
1142 Ga0495645_0107870
1143 Ga0495667_0080145
1144 Ga0495668_0036565
1145 Ga0495668_0044165
1146 Ga0495611_0020110
1147 Ga0495625_0000962
1148 Ga0495625_0113930
1149 Ga0495635_0009005
1150 Ga0495635_0161035
1151 Ga0495661_0028628
1152 Ga0495661_0099855
1153 Ga0495599_0000633
1154 Ga0495623_0017896
1155 Ga0495623_0119714
1156 Ga0495646_0118791
1157 Ga0495646_0159748
1158 Ga0495669_0003727
1159 Ga0495613_0003439
1160 Ga0495624_0030855
1161 Ga0495670_0004637
1162 Ga0495600_0000121
1163 Ga0495600_0042568
1164 Ga0495581_0000661
1165 Ga0495581_0014668
1166 Ga0495581_0076310
1167 Ga0495604_0016981
1168 Ga0495604_0128408
1169 Ga0495674_0014220
1170 Ga0495672_0001194
1171 Ga0495676_0001724
1172 Ga0495680_0052574
1173 Ga0495675_0009872
1174 Ga0495673_0028665
1175 Ga0495686_0001896
1176 Ga0495686_0012715
1177 Ga0495686_0063376
1178 Ga0495602_0054518
1179 Ga0495602_0168542
1180 Ga0495614_0000301
1181 Ga0496102_0001348
1182 Ga0496102_0012498
1183 Ga0496102_0210548
1184 Ga0496104_0021458
1185 Ga0496104_0024866
1186 Ga0496104_0033064
1187 Ga0496104_0099246
1188 Ga0496104_0138187
1189 Ga0496104_0218664
1190 Ga0496105_0028061
1191 Ga0496106_0134758
1192 Ga0496107_0222782
1193 Ga0496111_0058945
1194 Ga0496112_0010354
1195 Ga0496112_0177723
1196 Ga0496113_0001190
1197 Ga0496113_0022309
1198 Ga0496114_0020531
1199 Ga0496115_0118202
1200 Ga0496115_0137574
1201 Ga0496115_0263883
1202 Ga0496126_0000092
1203 Ga0496126_0000713
1204 Ga0496126_0001103
1205 Ga0496126_0072041
1206 Ga0495682_0024008
1207 Ga0501031_0028119
1208 Ga0501032_0001301
1209 Ga0501034_0002411
1210 Ga0501037_0066180
1211 Ga0501038_0001959
1212 Ga0501038_0087283
1213 Ga0501043_0007195
1214 Ga0501047_0001137
1215 Ga0501077_0070201
1216 Ga0501243_004498
1217 Ga0501080_0004633
1218 Ga0501035_0004980
1219 Ga0501044_0166476
1220 nmdc:mga0n895_24787_c1
1221 nmdc:mga0n895_518_c1
1222 nmdc:mga0rr50_81219_c1
1223 nmdc:mga08x19_16609_c1
1224 nmdc:mga0a205_6675_c1
1225 Ga0500651_0000004
1226 Ga0500595_000011
1227 Ga0500595_009008
1228 Ga0500595_018158
1229 Ga0501084_0056349
1230 2884219691

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00482

T2SSF

Type II secretion system (T2SS), protein F

319

441

0.99

PF00482

T2SSF

Type II secretion system (T2SS), protein F

117

239

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2whn-assembly2.cif.gz_B n-terminal domain from the pilc type iv pilus biogenesis protein 0.9538 62 160
2whn-assembly1.cif.gz_A n-terminal domain from the pilc type iv pilus biogenesis protein 0.9519 63 160
3c1q-assembly1.cif.gz_A the three-dimensional structure of the cytoplasmic domains of epsf from the type 2 secretion system of vibrio cholerae 0.9327 62 165
5nbg-assembly1.cif.gz_B structure of the cytoplasmic domain i of outf in the d. dadantii type ii secretion system 0.9252 62 165
2vma-assembly1.cif.gz_A the three-dimensional structure of the cytoplasmic domains of epsf from the type 2 secretion system of vibrio cholerae 0.9147 62 172
ID Description Score Start End Superfamily
af_P41441_261_365_1.20.81.30 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.9597 255 360 1.20.81.30
2whnB00 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.9538 62 160 1.20.81.30
af_P36646_249_359_1.20.81.30 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.9527 247 355 1.20.81.30
af_P41441_261_365_1.20.81.30 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.9332 255 360 1.20.81.30
af_P36646_249_359_1.20.81.30 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.9282 247 355 1.20.81.30
ID Description Score Start End GO Terms
AF-A0A7R8ZZ00-F1-model_v4 Uncharacterized protein 0.9547 239 375 GO:0005886
AF-A0A7C4V982-F1-model_v4 GNAT family N-acetyltransferase 0.9472 257 354 GO:0005886
GO:0016747
AF-A0A3M1QM08-F1-model_v4 Type II secretion system protein GspF 0.9413 231 389 GO:0005886
GO:0015628
AF-A0A7C3ASA6-F1-model_v4 Type II secretion system F family protein 0.9391 216 390 GO:0005886
AF-A0A0S7WN77-F1-model_v4 Type II secretion system protein GspF domain-containing protein 0.938 222 389 GO:0005886
GO:0015628

Map