F469459
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 615 | 345 | 610 | 103 |
Family's Representative Sequence
| Representative Sequence | 3300041408|Ga0439453_0126544|Ga0439453_0126544_64_402 |
| Length | 112 |
| Sequence | LKEFHMPGFLLHVGATVLCSHAGQAQPTVPNPRVTVMGQPTVAITSPYVVAGCAMPPPIAGNGPCVTAQFVTSATRVLSNGQPLLLLDSQAICVPTGTPLMIVITQTRASAI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2582581280 | Caulobacter henricii CF287 | Isolate | Rhizosphere |
| 2 | 2582581293 | Caulobacter henricii YR570 | Isolate | Rhizosphere |
| 3 | 2919450847 | Ancylobacter sp. 3268 | Isolate | Rhizosphere |
| 4 | 2928963466 | Dyella japonica 1073 | Isolate | Unclassified |
| 5 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 6 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 7 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 8 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 9 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 10 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 11 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 12 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 13 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 14 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 15 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 16 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 17 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 18 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 19 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 20 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 21 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 22 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 24 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 27 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 30 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 60 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 63 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 70 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 72 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 73 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 74 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 76 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 77 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 78 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 79 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 80 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 81 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 82 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 83 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 84 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 85 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 86 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 87 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 88 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 89 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 90 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 91 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 93 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 94 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 95 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 96 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 97 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 98 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 99 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 101 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 127 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 128 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 129 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 139 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 196 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 197 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 198 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 199 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 200 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 201 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 202 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 203 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 204 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 205 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 206 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 207 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 208 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 209 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 210 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 211 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 212 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 213 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 214 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 215 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 216 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 217 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 218 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 219 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 220 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 221 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 222 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 223 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 224 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 225 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 226 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 227 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 228 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 229 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 230 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 231 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 232 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 233 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 234 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 235 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 236 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 237 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 238 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 239 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 240 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 241 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 242 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 243 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 244 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 245 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 246 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 247 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 248 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 249 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 250 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 251 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 252 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 253 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 254 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 255 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 256 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 257 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 258 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 259 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 283 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 284 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 285 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 286 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 287 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 288 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 289 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 290 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 291 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 292 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 293 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 294 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 315 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 316 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 317 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 318 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 319 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 320 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 321 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 322 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 323 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 327 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 331 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 332 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 336 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 337 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 341 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 342 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 343 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.35 |
| Metatranscriptomes | 0 |
| Isolates | 0.65 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.5 |
| Nodule | 0 |
| Rhizoplane | 2.44 |
| Rhizosphere | 88.13 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.93 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10067983 | 3300001989 | Bacteria | 1113 |
| 2 | JGI24748J21848_1000002 | 3300002074 | Bacteria | 426946 |
| 3 | JGI24034J26672_10000004 | 3300002239 | Bacteria | 426946 |
| 4 | JGI25162J39368_1000021 | 3300002737 | Bacteria | 248155 |
| 5 | JGI25157J39369_1014950 | 3300002741 | Bacteria | 959 |
| 6 | JGI25163J39215_1007283 | 3300002771 | Bacteria | 624 |
| 7 | JGI25165J46597_1000049 | 3300003214 | Bacteria | 248154 |
| 8 | rootH1_10043042 | 3300003316 | Bacteria | 5272 |
| 9 | rootH1_10118134 | 3300003316 | Bacteria | 1527 |
| 10 | rootH2_10001362 | 3300003320 | Bacteria | 52723 |
| 11 | rootH2_10256832 | 3300003320 | Unclassified | 1932 |
| 12 | rootL2_10009982 | 3300003322 | Bacteria | 12131 |
| 13 | rootL2_10038767 | 3300003322 | Bacteria | 14897 |
| 14 | rootL2_10257985 | 3300003322 | Unclassified | 2208 |
| 15 | Ga0055538_1000023 | 3300003751 | Bacteria | 248154 |
| 16 | Ga0055539_1000030 | 3300003752 | Bacteria | 248154 |
| 17 | Ga0055533_1000039 | 3300003756 | Bacteria | 248154 |
| 18 | Ga0055533_1005338 | 3300003756 | Bacteria | 2082 |
| 19 | Ga0055525_1000048 | 3300003759 | Bacteria | 248154 |
| 20 | Ga0055525_1000207 | 3300003759 | Bacteria | 66980 |
| 21 | Ga0055527_1000108 | 3300003760 | Bacteria | 59457 |
| 22 | Ga0055535_1000646 | 3300003761 | Bacteria | 27765 |
| 23 | Ga0055542_1000223 | 3300003762 | Bacteria | 68138 |
| 24 | Ga0055542_1000447 | 3300003762 | Bacteria | 39214 |
| 25 | Ga0055529_1000603 | 3300003763 | Bacteria | 27759 |
| 26 | Ga0055541_1000021 | 3300003841 | Bacteria | 248154 |
| 27 | Ga0070658_10011873 | 3300005327 | Bacteria | 6995 |
| 28 | Ga0070658_10023784 | 3300005327 | Bacteria | 4914 |
| 29 | Ga0070658_10155143 | 3300005327 | Bacteria | 1919 |
| 30 | Ga0070670_100018852 | 3300005331 | Bacteria | 5917 |
| 31 | Ga0070670_100029904 | 3300005331 | Bacteria | 4691 |
| 32 | Ga0070670_100667457 | 3300005331 | Bacteria | 933 |
| 33 | Ga0070670_101719437 | 3300005331 | Unclassified | 577 |
| 34 | Ga0070670_101948063 | 3300005331 | Bacteria | 541 |
| 35 | Ga0068869_100113390 | 3300005334 | Unclassified | 2065 |
| 36 | Ga0068869_100498475 | 3300005334 | Bacteria | 1016 |
| 37 | Ga0068869_100869545 | 3300005334 | Bacteria | 779 |
| 38 | Ga0068869_101194413 | 3300005334 | Unclassified | 668 |
| 39 | Ga0068869_101216558 | 3300005334 | Unclassified | 662 |
| 40 | Ga0070680_100920761 | 3300005336 | Bacteria | 754 |
| 41 | Ga0070682_100350214 | 3300005337 | Bacteria | 1101 |
| 42 | Ga0068868_100094624 | 3300005338 | Bacteria | 2410 |
| 43 | Ga0068868_100835553 | 3300005338 | Unclassified | 833 |
| 44 | Ga0070689_100388737 | 3300005340 | Bacteria | 1177 |
| 45 | Ga0070689_100780134 | 3300005340 | Bacteria | 839 |
| 46 | Ga0070687_100120130 | 3300005343 | Bacteria | 1502 |
| 47 | Ga0070692_10023635 | 3300005345 | Unclassified | 3013 |
| 48 | Ga0070692_10230000 | 3300005345 | Unclassified | 1100 |
| 49 | Ga0070692_11395584 | 3300005345 | Unclassified | 506 |
| 50 | Ga0070669_100000019 | 3300005353 | Bacteria | 186509 |
| 51 | Ga0070669_100048363 | 3300005353 | Unclassified | 3104 |
| 52 | Ga0070669_101171723 | 3300005353 | Bacteria | 663 |
| 53 | Ga0070669_101324743 | 3300005353 | Unclassified | 624 |
| 54 | Ga0070675_100647377 | 3300005354 | Unclassified | 960 |
| 55 | Ga0070671_100046913 | 3300005355 | Bacteria | 3593 |
| 56 | Ga0070671_100312201 | 3300005355 | Bacteria | 1339 |
| 57 | Ga0070673_100866591 | 3300005364 | Bacteria | 836 |
| 58 | Ga0070673_101330275 | 3300005364 | Bacteria | 675 |
| 59 | Ga0070688_101058548 | 3300005365 | Bacteria | 647 |
| 60 | Ga0070667_100019678 | 3300005367 | Bacteria | 5600 |
| 61 | Ga0070703_10000028 | 3300005406 | Bacteria | 70844 |
| 62 | Ga0070703_10142371 | 3300005406 | Unclassified | 892 |
| 63 | Ga0070709_10370028 | 3300005434 | Bacteria | 1063 |
| 64 | Ga0070714_100078810 | 3300005435 | Bacteria | 2864 |
| 65 | Ga0070714_100303404 | 3300005435 | Bacteria | 1489 |
| 66 | Ga0070713_100009503 | 3300005436 | Bacteria | 6966 |
| 67 | Ga0070713_101747329 | 3300005436 | Bacteria | 604 |
| 68 | Ga0070710_10028354 | 3300005437 | Bacteria | 2994 |
| 69 | Ga0070710_10940413 | 3300005437 | Unclassified | 626 |
| 70 | Ga0070701_10188807 | 3300005438 | Unclassified | 1211 |
| 71 | Ga0070701_10310877 | 3300005438 | Bacteria | 972 |
| 72 | Ga0070711_100394796 | 3300005439 | Bacteria | 1121 |
| 73 | Ga0070711_101911771 | 3300005439 | Unclassified | 521 |
| 74 | Ga0070705_100000368 | 3300005440 | Bacteria | 26424 |
| 75 | Ga0070705_100109133 | 3300005440 | Bacteria | 1764 |
| 76 | Ga0070705_100229134 | 3300005440 | Bacteria | 1291 |
| 77 | Ga0070705_100386094 | 3300005440 | Unclassified | 1032 |
| 78 | Ga0070705_101143903 | 3300005440 | Unclassified | 639 |
| 79 | Ga0070700_100000193 | 3300005441 | Bacteria | 34477 |
| 80 | Ga0070700_100006039 | 3300005441 | Bacteria | 6448 |
| 81 | Ga0070700_100587338 | 3300005441 | Unclassified | 871 |
| 82 | Ga0070700_100639519 | 3300005441 | Bacteria | 839 |
| 83 | Ga0070694_100241404 | 3300005444 | Bacteria | 1363 |
| 84 | Ga0070694_100297183 | 3300005444 | Bacteria | 1236 |
| 85 | Ga0070708_100000237 | 3300005445 | Bacteria | 40825 |
| 86 | Ga0070708_100001158 | 3300005445 | Bacteria | 20294 |
| 87 | Ga0070708_100031387 | 3300005445 | Bacteria | 4598 |
| 88 | Ga0070708_100999912 | 3300005445 | Unclassified | 784 |
| 89 | Ga0070663_100006820 | 3300005455 | Bacteria | 6906 |
| 90 | Ga0070663_101348698 | 3300005455 | Bacteria | 630 |
| 91 | Ga0070678_100101308 | 3300005456 | Bacteria | 2232 |
| 92 | Ga0070662_100005929 | 3300005457 | Bacteria | 7839 |
| 93 | Ga0070662_101830964 | 3300005457 | Unclassified | 524 |
| 94 | Ga0070681_10175666 | 3300005458 | Bacteria | 2064 |
| 95 | Ga0070681_10294969 | 3300005458 | Unclassified | 1531 |
| 96 | Ga0070681_10375680 | 3300005458 | Bacteria | 1332 |
| 97 | Ga0070685_10150822 | 3300005466 | Bacteria | 1473 |
| 98 | Ga0070685_10281317 | 3300005466 | Bacteria | 1114 |
| 99 | Ga0070685_10334027 | 3300005466 | Bacteria | 1031 |
| 100 | Ga0070706_100001593 | 3300005467 | Bacteria | 23652 |
| 101 | Ga0070706_100004834 | 3300005467 | Bacteria | 12903 |
| 102 | Ga0070706_100253436 | 3300005467 | Bacteria | 1643 |
| 103 | Ga0070706_100386337 | 3300005467 | Bacteria | 1303 |
| 104 | Ga0070706_100711661 | 3300005467 | Bacteria | 931 |
| 105 | Ga0070706_100932334 | 3300005467 | Unclassified | 802 |
| 106 | Ga0070706_101296460 | 3300005467 | Bacteria | 668 |
| 107 | Ga0070707_100034782 | 3300005468 | Bacteria | 4805 |
| 108 | Ga0070707_100549387 | 3300005468 | Bacteria | 1117 |
| 109 | Ga0070707_101452765 | 3300005468 | Bacteria | 652 |
| 110 | Ga0070698_100001354 | 3300005471 | Bacteria | 27238 |
| 111 | Ga0070698_100065472 | 3300005471 | Bacteria | 3659 |
| 112 | Ga0070698_100067512 | 3300005471 | Bacteria | 3596 |
| 113 | Ga0070698_100211259 | 3300005471 | Bacteria | 1875 |
| 114 | Ga0070698_101012541 | 3300005471 | Unclassified | 778 |
| 115 | Ga0070698_101845943 | 3300005471 | Bacteria | 557 |
| 116 | Ga0070699_100171861 | 3300005518 | Unclassified | 1920 |
| 117 | Ga0070699_100290033 | 3300005518 | Bacteria | 1467 |
| 118 | Ga0070699_100728702 | 3300005518 | Bacteria | 906 |
| 119 | Ga0070679_100294754 | 3300005530 | Bacteria | 1573 |
| 120 | Ga0070679_101888298 | 3300005530 | Bacteria | 546 |
| 121 | Ga0070684_101406144 | 3300005535 | Bacteria | 657 |
| 122 | Ga0070697_100000140 | 3300005536 | Bacteria | 58765 |
| 123 | Ga0070697_100137905 | 3300005536 | Bacteria | 2049 |
| 124 | Ga0068853_100193419 | 3300005539 | Bacteria | 1849 |
| 125 | Ga0070672_100725387 | 3300005543 | Bacteria | 871 |
| 126 | Ga0070672_100848305 | 3300005543 | Bacteria | 805 |
| 127 | Ga0070695_100050977 | 3300005545 | Bacteria | 2654 |
| 128 | Ga0070695_100128826 | 3300005545 | Bacteria | 1742 |
| 129 | Ga0070696_100706402 | 3300005546 | Bacteria | 822 |
| 130 | Ga0070693_100358456 | 3300005547 | Bacteria | 1000 |
| 131 | Ga0070665_100000026 | 3300005548 | Bacteria | 365176 |
| 132 | Ga0070665_100000365 | 3300005548 | Bacteria | 67635 |
| 133 | Ga0070704_100017412 | 3300005549 | Unclassified | 4570 |
| 134 | Ga0070704_100067136 | 3300005549 | Bacteria | 2589 |
| 135 | Ga0070704_101693233 | 3300005549 | Bacteria | 584 |
| 136 | Ga0068855_100000148 | 3300005563 | Bacteria | 89300 |
| 137 | Ga0070664_100295325 | 3300005564 | Bacteria | 1463 |
| 138 | Ga0068857_100312327 | 3300005577 | Unclassified | 1450 |
| 139 | Ga0068857_102147862 | 3300005577 | Unclassified | 548 |
| 140 | Ga0068854_100000527 | 3300005578 | Bacteria | 23195 |
| 141 | Ga0068854_100014355 | 3300005578 | Bacteria | 5220 |
| 142 | Ga0068854_100076177 | 3300005578 | Bacteria | 2465 |
| 143 | Ga0068854_101324508 | 3300005578 | Unclassified | 649 |
| 144 | Ga0068856_100114766 | 3300005614 | Bacteria | 2693 |
| 145 | Ga0068856_102526820 | 3300005614 | Bacteria | 520 |
| 146 | Ga0070702_100007398 | 3300005615 | Bacteria | 5257 |
| 147 | Ga0070702_100685652 | 3300005615 | Bacteria | 779 |
| 148 | Ga0070702_100704121 | 3300005615 | Unclassified | 770 |
| 149 | Ga0070702_100756469 | 3300005615 | Bacteria | 747 |
| 150 | Ga0068852_100218565 | 3300005616 | Viruses | 1811 |
| 151 | Ga0068852_100328066 | 3300005616 | Bacteria | 1488 |
| 152 | Ga0068852_100957396 | 3300005616 | Bacteria | 874 |
| 153 | Ga0068859_100000046 | 3300005617 | Bacteria | 142733 |
| 154 | Ga0068859_100003211 | 3300005617 | Bacteria | 16645 |
| 155 | Ga0068859_100011283 | 3300005617 | Bacteria | 8991 |
| 156 | Ga0068859_100014042 | 3300005617 | Bacteria | 8031 |
| 157 | Ga0068859_100084432 | 3300005617 | Bacteria | 3221 |
| 158 | Ga0068859_100304497 | 3300005617 | Unclassified | 1687 |
| 159 | Ga0068859_100391782 | 3300005617 | Bacteria | 1485 |
| 160 | Ga0068859_100701645 | 3300005617 | Bacteria | 1103 |
| 161 | Ga0068859_101383415 | 3300005617 | Bacteria | 776 |
| 162 | Ga0068859_101673465 | 3300005617 | Bacteria | 703 |
| 163 | Ga0068864_100001094 | 3300005618 | Bacteria | 22718 |
| 164 | Ga0068864_100052563 | 3300005618 | Bacteria | 3512 |
| 165 | Ga0068864_100122958 | 3300005618 | Bacteria | 2323 |
| 166 | Ga0068866_10054750 | 3300005718 | Bacteria | 2045 |
| 167 | Ga0068861_100126977 | 3300005719 | Unclassified | 2065 |
| 168 | Ga0068861_100517884 | 3300005719 | Bacteria | 1081 |
| 169 | Ga0068870_10001396 | 3300005840 | Bacteria | 9746 |
| 170 | Ga0068870_10401408 | 3300005840 | Bacteria | 892 |
| 171 | Ga0068870_11281202 | 3300005840 | Bacteria | 533 |
| 172 | Ga0068863_100340516 | 3300005841 | Bacteria | 1459 |
| 173 | Ga0068863_100816623 | 3300005841 | Unclassified | 930 |
| 174 | Ga0068863_101029225 | 3300005841 | Bacteria | 827 |
| 175 | Ga0068863_102328343 | 3300005841 | Unclassified | 545 |
| 176 | Ga0068858_100215509 | 3300005842 | Bacteria | 1817 |
| 177 | Ga0068860_100136255 | 3300005843 | Bacteria | 2358 |
| 178 | Ga0068862_100052522 | 3300005844 | Unclassified | 3487 |
| 179 | Ga0068862_100918207 | 3300005844 | Unclassified | 862 |
| 180 | Ga0068862_101075623 | 3300005844 | Unclassified | 798 |
| 181 | Ga0068862_102492818 | 3300005844 | Unclassified | 529 |
| 182 | Ga0081455_10108237 | 3300005937 | Bacteria | 2214 |
| 183 | Ga0081455_10468211 | 3300005937 | Bacteria | 856 |
| 184 | Ga0075365_10330246 | 3300006038 | Bacteria | 1074 |
| 185 | Ga0070716_100018531 | 3300006173 | Bacteria | 3629 |
| 186 | Ga0070712_100083329 | 3300006175 | Bacteria | 2322 |
| 187 | Ga0070712_100092787 | 3300006175 | Bacteria | 2215 |
| 188 | Ga0070712_100411240 | 3300006175 | Bacteria | 1119 |
| 189 | Ga0070712_101795898 | 3300006175 | Bacteria | 537 |
| 190 | Ga0075362_10726267 | 3300006177 | Bacteria | 519 |
| 191 | Ga0075367_10663820 | 3300006178 | Bacteria | 663 |
| 192 | Ga0097621_100106336 | 3300006237 | Bacteria | 2367 |
| 193 | Ga0097621_100139737 | 3300006237 | Bacteria | 2069 |
| 194 | Ga0068871_100014643 | 3300006358 | Bacteria | 5852 |
| 195 | Ga0075428_100105443 | 3300006844 | Bacteria | 3074 |
| 196 | Ga0075428_100125665 | 3300006844 | Bacteria | 2791 |
| 197 | Ga0075428_102366264 | 3300006844 | Unclassified | 546 |
| 198 | Ga0075430_101157027 | 3300006846 | Bacteria | 637 |
| 199 | Ga0075433_10688767 | 3300006852 | Bacteria | 895 |
| 200 | Ga0075433_10746275 | 3300006852 | Bacteria | 856 |
| 201 | Ga0075433_10802231 | 3300006852 | Bacteria | 823 |
| 202 | Ga0075434_100022420 | 3300006871 | Bacteria | 6151 |
| 203 | Ga0075434_100216644 | 3300006871 | Bacteria | 1935 |
| 204 | Ga0075434_100558606 | 3300006871 | Bacteria | 1164 |
| 205 | Ga0075434_101706856 | 3300006871 | Bacteria | 637 |
| 206 | Ga0075434_102415158 | 3300006871 | Bacteria | 528 |
| 207 | Ga0068865_100947803 | 3300006881 | Bacteria | 751 |
| 208 | Ga0075436_100064655 | 3300006914 | Unclassified | 2529 |
| 209 | Ga0075436_100238498 | 3300006914 | Bacteria | 1293 |
| 210 | Ga0075436_100377736 | 3300006914 | Unclassified | 1024 |
| 211 | Ga0097620_100000046 | 3300006931 | Bacteria | 142733 |
| 212 | Ga0097620_100003211 | 3300006931 | Bacteria | 16645 |
| 213 | Ga0097620_100011281 | 3300006931 | Bacteria | 8991 |
| 214 | Ga0097620_100014042 | 3300006931 | Bacteria | 8031 |
| 215 | Ga0097620_100084432 | 3300006931 | Bacteria | 3221 |
| 216 | Ga0097620_100304532 | 3300006931 | Unclassified | 1687 |
| 217 | Ga0097620_100391765 | 3300006931 | Bacteria | 1485 |
| 218 | Ga0097620_100701673 | 3300006931 | Bacteria | 1103 |
| 219 | Ga0097620_101383513 | 3300006931 | Bacteria | 776 |
| 220 | Ga0097620_101673240 | 3300006931 | Bacteria | 703 |
| 221 | Ga0075435_100043004 | 3300007076 | Bacteria | 3616 |
| 222 | Ga0075435_100290010 | 3300007076 | Unclassified | 1398 |
| 223 | Ga0075435_100308590 | 3300007076 | Bacteria | 1354 |
| 224 | Ga0105240_10007036 | 3300009093 | Bacteria | 16414 |
| 225 | Ga0105240_10019513 | 3300009093 | Bacteria | 9056 |
| 226 | Ga0111539_12523086 | 3300009094 | Unclassified | 596 |
| 227 | Ga0105247_10064908 | 3300009101 | Unclassified | 2270 |
| 228 | Ga0105247_10258903 | 3300009101 | Bacteria | 1192 |
| 229 | Ga0114129_10223701 | 3300009147 | Bacteria | 2538 |
| 230 | Ga0114129_10560851 | 3300009147 | Bacteria | 1484 |
| 231 | Ga0114129_10901253 | 3300009147 | Bacteria | 1120 |
| 232 | Ga0114129_11648250 | 3300009147 | Bacteria | 784 |
| 233 | Ga0114129_12542384 | 3300009147 | Unclassified | 612 |
| 234 | Ga0114129_13223032 | 3300009147 | Bacteria | 530 |
| 235 | Ga0105243_11384659 | 3300009148 | Unclassified | 723 |
| 236 | Ga0105241_10084903 | 3300009174 | Unclassified | 2487 |
| 237 | Ga0105241_10437883 | 3300009174 | Bacteria | 1154 |
| 238 | Ga0105242_10685628 | 3300009176 | Bacteria | 1000 |
| 239 | Ga0105248_10003342 | 3300009177 | Bacteria | 17833 |
| 240 | Ga0105248_11589920 | 3300009177 | Bacteria | 740 |
| 241 | Ga0105237_10013242 | 3300009545 | Bacteria | 8654 |
| 242 | Ga0105238_11096211 | 3300009551 | Bacteria | 819 |
| 243 | Ga0105249_10623536 | 3300009553 | Bacteria | 1134 |
| 244 | Ga0105239_10125152 | 3300010375 | Bacteria | 2856 |
| 245 | Ga0105239_11974907 | 3300010375 | Bacteria | 677 |
| 246 | Ga0105246_10033873 | 3300011119 | Bacteria | 3398 |
| 247 | Ga0105246_10406897 | 3300011119 | Bacteria | 1131 |
| 248 | Ga0105246_11763104 | 3300011119 | Unclassified | 590 |
| 249 | Ga0157373_10000982 | 3300013100 | Bacteria | 22058 |
| 250 | Ga0157371_10205741 | 3300013102 | Bacteria | 1412 |
| 251 | Ga0157371_10871202 | 3300013102 | Bacteria | 682 |
| 252 | Ga0157370_10006370 | 3300013104 | Bacteria | 13026 |
| 253 | Ga0157378_11303248 | 3300013297 | Bacteria | 767 |
| 254 | Ga0163162_11371494 | 3300013306 | Bacteria | 804 |
| 255 | Ga0163162_11684493 | 3300013306 | Unclassified | 724 |
| 256 | Ga0157372_10053589 | 3300013307 | Bacteria | 4496 |
| 257 | Ga0157372_10786323 | 3300013307 | Bacteria | 1106 |
| 258 | Ga0157375_12274491 | 3300013308 | Unclassified | 646 |
| 259 | Ga0163163_10123336 | 3300014325 | Bacteria | 2626 |
| 260 | Ga0163163_10308808 | 3300014325 | Bacteria | 1634 |
| 261 | Ga0163163_10349333 | 3300014325 | Bacteria | 1535 |
| 262 | Ga0157380_10001886 | 3300014326 | Bacteria | 13902 |
| 263 | Ga0157377_10000198 | 3300014745 | Bacteria | 33472 |
| 264 | Ga0157379_11088793 | 3300014968 | Unclassified | 765 |
| 265 | Ga0157376_12618642 | 3300014969 | Bacteria | 544 |
| 266 | Ga0183368_1004 | 3300015687 | Bacteria | 1211761 |
| 267 | Ga0213873_10308738 | 3300021358 | Unclassified | 512 |
| 268 | Ga0213876_10000053 | 3300021384 | Bacteria | 142404 |
| 269 | Ga0213876_10000458 | 3300021384 | Bacteria | 32682 |
| 270 | Ga0209760_100894 | 3300025207 | Bacteria | 3772 |
| 271 | Ga0209784_100004 | 3300025224 | Bacteria | 1378156 |
| 272 | Ga0209566_100004 | 3300025225 | Bacteria | 1531866 |
| 273 | Ga0209674_100006 | 3300025226 | Bacteria | 1531866 |
| 274 | Ga0209674_100016 | 3300025226 | Bacteria | 696756 |
| 275 | Ga0209672_100103 | 3300025228 | Bacteria | 104244 |
| 276 | Ga0209563_100009 | 3300025230 | Bacteria | 1378156 |
| 277 | Ga0209563_100150 | 3300025230 | Bacteria | 65666 |
| 278 | Ga0207427_100699 | 3300025231 | Bacteria | 15790 |
| 279 | Ga0207427_100768 | 3300025231 | Bacteria | 14614 |
| 280 | Ga0209437_100004 | 3300025233 | Bacteria | 1378156 |
| 281 | Ga0209437_100228 | 3300025233 | Bacteria | 98265 |
| 282 | Ga0209258_100232 | 3300025242 | Bacteria | 104244 |
| 283 | Ga0209026_1003441 | 3300025250 | Bacteria | 5179 |
| 284 | Ga0209677_100005 | 3300025253 | Bacteria | 1378156 |
| 285 | Ga0209148_1000005 | 3300025254 | Bacteria | 1806504 |
| 286 | Ga0209148_1000206 | 3300025254 | Bacteria | 104244 |
| 287 | Ga0209233_1000005 | 3300025261 | Bacteria | 1531866 |
| 288 | Ga0209233_1006577 | 3300025261 | Bacteria | 3736 |
| 289 | Ga0209455_1000179 | 3300025272 | Bacteria | 104244 |
| 290 | Ga0207653_10000047 | 3300025885 | Bacteria | 91340 |
| 291 | Ga0207653_10230099 | 3300025885 | Bacteria | 706 |
| 292 | Ga0207692_10446960 | 3300025898 | Bacteria | 813 |
| 293 | Ga0207692_10643200 | 3300025898 | Unclassified | 685 |
| 294 | Ga0207710_10000004 | 3300025900 | Bacteria | 846540 |
| 295 | Ga0207710_10057290 | 3300025900 | Bacteria | 1760 |
| 296 | Ga0207710_10127913 | 3300025900 | Unclassified | 1218 |
| 297 | Ga0207699_10203582 | 3300025906 | Bacteria | 1343 |
| 298 | Ga0207643_10015698 | 3300025908 | Bacteria | 4124 |
| 299 | Ga0207643_10364701 | 3300025908 | Bacteria | 908 |
| 300 | Ga0207705_10113411 | 3300025909 | Bacteria | 2004 |
| 301 | Ga0207684_10001536 | 3300025910 | Bacteria | 24717 |
| 302 | Ga0207684_10011559 | 3300025910 | Bacteria | 7714 |
| 303 | Ga0207684_10039886 | 3300025910 | Bacteria | 3981 |
| 304 | Ga0207684_10222783 | 3300025910 | Bacteria | 1628 |
| 305 | Ga0207684_10858724 | 3300025910 | Unclassified | 765 |
| 306 | Ga0207654_10293544 | 3300025911 | Bacteria | 1103 |
| 307 | Ga0207695_10008974 | 3300025913 | Bacteria | 12443 |
| 308 | Ga0207695_10136047 | 3300025913 | Bacteria | 2410 |
| 309 | Ga0207671_10020566 | 3300025914 | Bacteria | 5022 |
| 310 | Ga0207693_10171851 | 3300025915 | Bacteria | 1706 |
| 311 | Ga0207693_10222704 | 3300025915 | Bacteria | 1482 |
| 312 | Ga0207693_10802918 | 3300025915 | Bacteria | 725 |
| 313 | Ga0207663_10436040 | 3300025916 | Bacteria | 1008 |
| 314 | Ga0207660_10565813 | 3300025917 | Bacteria | 925 |
| 315 | Ga0207662_10029724 | 3300025918 | Bacteria | 3168 |
| 316 | Ga0207662_10068994 | 3300025918 | Bacteria | 2136 |
| 317 | Ga0207652_10027349 | 3300025921 | Unclassified | 4752 |
| 318 | Ga0207652_10286648 | 3300025921 | Bacteria | 1486 |
| 319 | Ga0207646_10066305 | 3300025922 | Bacteria | 3223 |
| 320 | Ga0207646_10200046 | 3300025922 | Bacteria | 1805 |
| 321 | Ga0207646_11289967 | 3300025922 | Bacteria | 638 |
| 322 | Ga0207681_10000110 | 3300025923 | Bacteria | 69649 |
| 323 | Ga0207681_11012687 | 3300025923 | Bacteria | 697 |
| 324 | Ga0207650_10021490 | 3300025925 | Bacteria | 4560 |
| 325 | Ga0207650_10035327 | 3300025925 | Bacteria | 3628 |
| 326 | Ga0207650_11612067 | 3300025925 | Bacteria | 551 |
| 327 | Ga0207687_11717788 | 3300025927 | Bacteria | 538 |
| 328 | Ga0207700_10682646 | 3300025928 | Bacteria | 916 |
| 329 | Ga0207664_10518014 | 3300025929 | Bacteria | 1069 |
| 330 | Ga0207664_11117009 | 3300025929 | Bacteria | 704 |
| 331 | Ga0207644_10002425 | 3300025931 | Bacteria | 12009 |
| 332 | Ga0207706_10012101 | 3300025933 | Bacteria | 7858 |
| 333 | Ga0207706_10103590 | 3300025933 | Bacteria | 2503 |
| 334 | Ga0207686_10575050 | 3300025934 | Bacteria | 884 |
| 335 | Ga0207709_10980204 | 3300025935 | Bacteria | 690 |
| 336 | Ga0207670_10494158 | 3300025936 | Bacteria | 993 |
| 337 | Ga0207670_10539625 | 3300025936 | Bacteria | 952 |
| 338 | Ga0207669_11048466 | 3300025937 | Bacteria | 687 |
| 339 | Ga0207704_11653148 | 3300025938 | Bacteria | 550 |
| 340 | Ga0207665_10002211 | 3300025939 | Bacteria | 13127 |
| 341 | Ga0207691_10660462 | 3300025940 | Bacteria | 883 |
| 342 | Ga0207711_10006529 | 3300025941 | Bacteria | 9818 |
| 343 | Ga0207711_10327137 | 3300025941 | Bacteria | 1417 |
| 344 | Ga0207689_10420880 | 3300025942 | Unclassified | 1115 |
| 345 | Ga0207689_10648309 | 3300025942 | Bacteria | 889 |
| 346 | Ga0207689_10694071 | 3300025942 | Bacteria | 858 |
| 347 | Ga0207689_11173765 | 3300025942 | Bacteria | 646 |
| 348 | Ga0207679_10021982 | 3300025945 | Bacteria | 4336 |
| 349 | Ga0207667_10000062 | 3300025949 | Bacteria | 190422 |
| 350 | Ga0207667_10639533 | 3300025949 | Bacteria | 1070 |
| 351 | Ga0207651_10427614 | 3300025960 | Bacteria | 1132 |
| 352 | Ga0207640_10000022 | 3300025981 | Bacteria | 167526 |
| 353 | Ga0207640_10138412 | 3300025981 | Bacteria | 1771 |
| 354 | Ga0207640_10693592 | 3300025981 | Unclassified | 872 |
| 355 | Ga0207658_10056487 | 3300025986 | Bacteria | 2913 |
| 356 | Ga0207677_10097872 | 3300026023 | Bacteria | 2151 |
| 357 | Ga0207677_10465063 | 3300026023 | Unclassified | 1087 |
| 358 | Ga0207677_11114831 | 3300026023 | Bacteria | 720 |
| 359 | Ga0207703_11062669 | 3300026035 | Bacteria | 777 |
| 360 | Ga0207678_10000399 | 3300026067 | Bacteria | 39734 |
| 361 | Ga0207678_11778088 | 3300026067 | Bacteria | 540 |
| 362 | Ga0207708_10001354 | 3300026075 | Bacteria | 18401 |
| 363 | Ga0207708_10064775 | 3300026075 | Bacteria | 2793 |
| 364 | Ga0207708_10222027 | 3300026075 | Unclassified | 1514 |
| 365 | Ga0207702_12485213 | 3300026078 | Bacteria | 504 |
| 366 | Ga0207641_10249276 | 3300026088 | Bacteria | 1658 |
| 367 | Ga0207641_10503382 | 3300026088 | Bacteria | 1177 |
| 368 | Ga0207641_12244409 | 3300026088 | Unclassified | 546 |
| 369 | Ga0207648_10065542 | 3300026089 | Bacteria | 3166 |
| 370 | Ga0207648_10977978 | 3300026089 | Unclassified | 792 |
| 371 | Ga0207676_10003048 | 3300026095 | Bacteria | 11958 |
| 372 | Ga0207676_10234782 | 3300026095 | Bacteria | 1642 |
| 373 | Ga0207676_10321737 | 3300026095 | Bacteria | 1420 |
| 374 | Ga0207676_10401531 | 3300026095 | Bacteria | 1281 |
| 375 | Ga0207676_10535770 | 3300026095 | Bacteria | 1117 |
| 376 | Ga0207676_10632053 | 3300026095 | Unclassified | 1031 |
| 377 | Ga0207674_10116463 | 3300026116 | Unclassified | 2643 |
| 378 | Ga0207675_100749100 | 3300026118 | Bacteria | 988 |
| 379 | Ga0207683_10023314 | 3300026121 | Bacteria | 5323 |
| 380 | Ga0207698_10403005 | 3300026142 | Bacteria | 1308 |
| 381 | Ga0207698_10634093 | 3300026142 | Bacteria | 1057 |
| 382 | Ga0207698_11258650 | 3300026142 | Unclassified | 754 |
| 383 | Ga0207698_12334579 | 3300026142 | Unclassified | 547 |
| 384 | Ga0268266_10000001 | 3300028379 | Bacteria | 4040580 |
| 385 | Ga0268266_10000252 | 3300028379 | Bacteria | 90702 |
| 386 | Ga0268265_10027580 | 3300028380 | Unclassified | 4055 |
| 387 | Ga0268264_10603839 | 3300028381 | Bacteria | 1082 |
| 388 | Ga0307515_10158966 | 3300028794 | Bacteria | 2316 |
| 389 | Ga0265338_10000016 | 3300028800 | Bacteria | 347424 |
| 390 | Ga0265338_11016878 | 3300028800 | Bacteria | 561 |
| 391 | Ga0316177_1016443 | 3300030731 | Bacteria | 1040 |
| 392 | Ga0316177_1164940 | 3300030731 | Bacteria | 6988 |
| 393 | Ga0316176_1204343 | 3300030732 | Bacteria | 1392 |
| 394 | Ga0314311_1179633 | 3300030733 | Bacteria | 636 |
| 395 | Ga0316180_1010538 | 3300030736 | Bacteria | 696 |
| 396 | Ga0316181_1073040 | 3300030744 | Bacteria | 569 |
| 397 | Ga0316182_1014446 | 3300030745 | Bacteria | 1373 |
| 398 | Ga0316182_1171846 | 3300030745 | Unclassified | 526 |
| 399 | Ga0316182_1276313 | 3300030745 | Bacteria | 2544 |
| 400 | Ga0265325_10008493 | 3300031241 | Bacteria | 6057 |
| 401 | Ga0265325_10491617 | 3300031241 | Bacteria | 532 |
| 402 | Ga0307408_100006007 | 3300031548 | Bacteria | 8080 |
| 403 | Ga0316579_10140560 | 3300031691 | Bacteria | 1164 |
| 404 | Ga0316579_10318330 | 3300031691 | Unclassified | 752 |
| 405 | Ga0316576_10302392 | 3300031727 | Bacteria | 1195 |
| 406 | Ga0316576_10327990 | 3300031727 | Bacteria | 1141 |
| 407 | Ga0316576_10957124 | 3300031727 | Unclassified | 611 |
| 408 | Ga0316578_10034292 | 3300031728 | Bacteria | 2914 |
| 409 | Ga0307405_10023447 | 3300031731 | Bacteria | 3507 |
| 410 | Ga0307405_10710433 | 3300031731 | Unclassified | 833 |
| 411 | Ga0307410_10009883 | 3300031852 | Bacteria | 5377 |
| 412 | Ga0307406_10022338 | 3300031901 | Bacteria | 3752 |
| 413 | Ga0307407_10257659 | 3300031903 | Bacteria | 1198 |
| 414 | Ga0307412_10058787 | 3300031911 | Bacteria | 2573 |
| 415 | Ga0307409_100288644 | 3300031995 | Bacteria | 1520 |
| 416 | Ga0307416_100016556 | 3300032002 | Bacteria | 5129 |
| 417 | Ga0307414_10006929 | 3300032004 | Bacteria | 6349 |
| 418 | Ga0307414_10104660 | 3300032004 | Bacteria | 2138 |
| 419 | Ga0307411_10359936 | 3300032005 | Bacteria | 1189 |
| 420 | Ga0307415_100005575 | 3300032126 | Bacteria | 6699 |
| 421 | Ga0307507_10465604 | 3300033179 | Unclassified | 693 |
| 422 | Ga0373950_0035216 | 3300034818 | Bacteria | 941 |
| 423 | Ga0373959_0182950 | 3300034820 | Bacteria | 546 |
| 424 | Ga0373926_0060992 | 3300035083 | Bacteria | 1375 |
| 425 | Ga0373934_0001012 | 3300035086 | Bacteria | 10172 |
| 426 | Ga0373934_0451575 | 3300035086 | Bacteria | 539 |
| 427 | Ga0373951_0133263 | 3300035091 | Unclassified | 685 |
| 428 | Ga0373923_0315660 | 3300035111 | Bacteria | 742 |
| 429 | Ga0373932_0320698 | 3300035112 | Unclassified | 583 |
| 430 | Ga0373936_0019359 | 3300035113 | Bacteria | 2637 |
| 431 | Ga0373936_0120871 | 3300035113 | Bacteria | 1119 |
| 432 | Ga0373939_0044604 | 3300035114 | Bacteria | 1350 |
| 433 | Ga0373941_0029730 | 3300035115 | Bacteria | 1614 |
| 434 | Ga0373954_0124634 | 3300035118 | Bacteria | 1252 |
| 435 | Ga0373943_0072420 | 3300035170 | Bacteria | 1748 |
| 436 | Ga0373943_0384926 | 3300035170 | Bacteria | 808 |
| 437 | Ga0373955_0027178 | 3300035172 | Bacteria | 2955 |
| 438 | Ga0316574_0046118 | 3300035398 | Bacteria | 2701 |
| 439 | Ga0373924_0009892 | 3300035410 | Bacteria | 3507 |
| 440 | Ga0373931_0969129 | 3300035691 | Unclassified | 574 |
| 441 | Ga0373931_0980338 | 3300035691 | Unclassified | 571 |
| 442 | Ga0373935_0089201 | 3300035692 | Bacteria | 2016 |
| 443 | Ga0373935_0107164 | 3300035692 | Bacteria | 1850 |
| 444 | Ga0373927_0653456 | 3300035695 | Bacteria | 695 |
| 445 | Ga0373933_0074937 | 3300035724 | Bacteria | 2065 |
| 446 | Ga0373933_0084023 | 3300035724 | Bacteria | 1956 |
| 447 | Ga0373947_0126186 | 3300035725 | Bacteria | 1630 |
| 448 | Ga0373947_0687014 | 3300035725 | Bacteria | 698 |
| 449 | Ga0373937_0001923 | 3300036401 | Bacteria | 17365 |
| 450 | Ga0373937_0004880 | 3300036401 | Bacteria | 11404 |
| 451 | Ga0373937_0530741 | 3300036401 | Bacteria | 1118 |
| 452 | Ga0316582_0172665 | 3300036647 | Bacteria | 1468 |
| 453 | Ga0316584_0451305 | 3300036712 | Bacteria | 909 |
| 454 | Ga0373925_0008518 | 3300037068 | Bacteria | 7472 |
| 455 | Ga0395900_1491857 | 3300037418 | Bacteria | 588 |
| 456 | Ga0395900_1527960 | 3300037418 | Bacteria | 579 |
| 457 | Ga0395898_0084064 | 3300037466 | Unclassified | 3068 |
| 458 | Ga0395905_0006366 | 3300037471 | Bacteria | 11898 |
| 459 | Ga0436365_0873465 | 3300039437 | Bacteria | 246686 |
| 460 | Ga0436365_1291084 | 3300039437 | Bacteria | 167262 |
| 461 | Ga0436362_0502872 | 3300039453 | Bacteria | 749 |
| 462 | Ga0439453_0126544 | 3300041408 | Bacteria | 590 |
| 463 | Ga0439445_0021844 | 3300042004 | Bacteria | 1610 |
| 464 | Ga0439435_0054705 | 3300042436 | Bacteria | 1150 |
| 465 | Ga0451577_0976734 | 3300042876 | Unclassified | 761 |
| 466 | Ga0439440_0021057 | 3300042993 | Bacteria | 1467 |
| 467 | Ga0466969_0079064 | 3300044656 | Bacteria | 1572 |
| 468 | Ga0453683_0044741 | 3300044673 | Bacteria | 2776 |
| 469 | Ga0453683_0265079 | 3300044673 | Bacteria | 1096 |
| 470 | Ga0453683_0534414 | 3300044673 | Bacteria | 762 |
| 471 | Ga0466964_0022281 | 3300044706 | Bacteria | 2456 |
| 472 | Ga0453684_1383091 | 3300044712 | Bacteria | 731 |
| 473 | Ga0453684_2361106 | 3300044712 | Bacteria | 528 |
| 474 | Ga0466960_0047547 | 3300044901 | Bacteria | 2058 |
| 475 | Ga0466960_0910732 | 3300044901 | Bacteria | 537 |
| 476 | Ga0451576_0000115 | 3300045051 | Bacteria | 208342 |
| 477 | Ga0451576_0293614 | 3300045051 | Bacteria | 1699 |
| 478 | Ga0495592_0233315 | 3300046454 | Bacteria | 1224 |
| 479 | Ga0495592_0825278 | 3300046454 | Unclassified | 549 |
| 480 | Ga0495603_0180843 | 3300046455 | Unclassified | 1220 |
| 481 | Ga0495629_0754581 | 3300046459 | Bacteria | 644 |
| 482 | Ga0495638_0000076 | 3300046460 | Bacteria | 158799 |
| 483 | Ga0495651_0044707 | 3300046462 | Bacteria | 3432 |
| 484 | Ga0495651_0227730 | 3300046462 | Bacteria | 1286 |
| 485 | Ga0495653_0089198 | 3300046463 | Bacteria | 2260 |
| 486 | Ga0495650_0000150 | 3300046471 | Bacteria | 158574 |
| 487 | Ga0495664_0408761 | 3300046477 | Unclassified | 815 |
| 488 | Ga0495610_0259474 | 3300046512 | Bacteria | 685 |
| 489 | Ga0495630_0545685 | 3300046517 | Bacteria | 889 |
| 490 | Ga0495652_0090745 | 3300046529 | Bacteria | 2499 |
| 491 | Ga0495652_0321354 | 3300046529 | Bacteria | 1118 |
| 492 | Ga0495587_0063049 | 3300046536 | Bacteria | 2169 |
| 493 | Ga0495587_0153507 | 3300046536 | Bacteria | 1312 |
| 494 | Ga0495645_0305683 | 3300046543 | Bacteria | 1037 |
| 495 | Ga0495667_0000715 | 3300046559 | Bacteria | 21273 |
| 496 | Ga0495667_0075055 | 3300046559 | Bacteria | 2201 |
| 497 | Ga0495634_0584056 | 3300046642 | Bacteria | 649 |
| 498 | Ga0495635_0002992 | 3300046663 | Bacteria | 11597 |
| 499 | Ga0495657_0036301 | 3300046675 | Bacteria | 3407 |
| 500 | Ga0495657_0126895 | 3300046675 | Bacteria | 1602 |
| 501 | Ga0495599_0201671 | 3300046678 | Bacteria | 1222 |
| 502 | Ga0495599_0262988 | 3300046678 | Bacteria | 1048 |
| 503 | Ga0495624_0335329 | 3300046690 | Bacteria | 910 |
| 504 | Ga0495600_0053077 | 3300046809 | Bacteria | 2647 |
| 505 | Ga0495600_0526848 | 3300046809 | Bacteria | 724 |
| 506 | Ga0495604_0402803 | 3300047317 | Bacteria | 901 |
| 507 | Ga0495674_0619039 | 3300047319 | Bacteria | 856 |
| 508 | Ga0495680_0003225 | 3300047322 | Bacteria | 16201 |
| 509 | Ga0495680_1105728 | 3300047322 | Unclassified | 500 |
| 510 | Ga0496100_0113237 | 3300048903 | Bacteria | 1888 |
| 511 | Ga0496100_0544462 | 3300048903 | Unclassified | 897 |
| 512 | Ga0496101_0128035 | 3300048904 | Bacteria | 1926 |
| 513 | Ga0496104_0304533 | 3300048907 | Bacteria | 1506 |
| 514 | Ga0496104_0376568 | 3300048907 | Unclassified | 1332 |
| 515 | Ga0496105_0226104 | 3300048908 | Bacteria | 1522 |
| 516 | Ga0496105_1397118 | 3300048908 | Bacteria | 507 |
| 517 | Ga0496106_0406971 | 3300048909 | Bacteria | 1093 |
| 518 | Ga0496107_0949561 | 3300048910 | Unclassified | 625 |
| 519 | Ga0496109_0967385 | 3300048912 | Bacteria | 789 |
| 520 | Ga0496112_0022373 | 3300048915 | Bacteria | 6025 |
| 521 | Ga0496112_0915187 | 3300048915 | Unclassified | 799 |
| 522 | Ga0496113_0394731 | 3300048916 | Bacteria | 1111 |
| 523 | Ga0496114_0113391 | 3300048917 | Bacteria | 2324 |
| 524 | Ga0496115_0006331 | 3300048918 | Bacteria | 8666 |
| 525 | Ga0496119_0003170 | 3300048922 | Bacteria | 17265 |
| 526 | Ga0501033_0000524 | 3300049570 | Bacteria | 35901 |
| 527 | Ga0501033_0019520 | 3300049570 | Bacteria | 5125 |
| 528 | Ga0501036_0070051 | 3300049572 | Bacteria | 2965 |
| 529 | Ga0501036_0244589 | 3300049572 | Bacteria | 1504 |
| 530 | Ga0501036_1402128 | 3300049572 | Bacteria | 566 |
| 531 | Ga0501037_0293279 | 3300049573 | Bacteria | 1131 |
| 532 | Ga0501038_0005856 | 3300049574 | Bacteria | 11370 |
| 533 | Ga0501038_0505541 | 3300049574 | Bacteria | 923 |
| 534 | Ga0501039_0135241 | 3300049575 | Bacteria | 1935 |
| 535 | Ga0501039_0224175 | 3300049575 | Bacteria | 1478 |
| 536 | Ga0501040_0010673 | 3300049576 | Bacteria | 6008 |
| 537 | Ga0501041_0014947 | 3300049577 | Bacteria | 4610 |
| 538 | Ga0501042_0418835 | 3300049578 | Bacteria | 970 |
| 539 | Ga0501043_0635896 | 3300049579 | Bacteria | 785 |
| 540 | Ga0501046_0148049 | 3300049580 | Bacteria | 1772 |
| 541 | Ga0501046_0308031 | 3300049580 | Bacteria | 1155 |
| 542 | Ga0501048_0388325 | 3300049582 | Bacteria | 997 |
| 543 | Ga0501048_1120313 | 3300049582 | Bacteria | 566 |
| 544 | Ga0501068_0536861 | 3300049584 | Bacteria | 760 |
| 545 | Ga0501069_0016632 | 3300049585 | Bacteria | 3952 |
| 546 | Ga0501069_0264321 | 3300049585 | Bacteria | 1005 |
| 547 | Ga0501069_0401358 | 3300049585 | Bacteria | 811 |
| 548 | Ga0501070_0386272 | 3300049586 | Bacteria | 1134 |
| 549 | Ga0501071_0017558 | 3300049587 | Bacteria | 4938 |
| 550 | Ga0501072_0000985 | 3300049588 | Bacteria | 21023 |
| 551 | Ga0501072_0401457 | 3300049588 | Bacteria | 1087 |
| 552 | Ga0501073_0033884 | 3300049589 | Bacteria | 3635 |
| 553 | Ga0501073_0058901 | 3300049589 | Bacteria | 2684 |
| 554 | Ga0501075_0000021 | 3300049591 | Bacteria | 66125 |
| 555 | Ga0501075_0845140 | 3300049591 | Bacteria | 696 |
| 556 | Ga0501076_0000070 | 3300049592 | Bacteria | 50841 |
| 557 | Ga0501076_0141837 | 3300049592 | Bacteria | 1952 |
| 558 | Ga0501077_0133185 | 3300049593 | Bacteria | 1576 |
| 559 | Ga0501077_0177151 | 3300049593 | Bacteria | 1355 |
| 560 | Ga0501077_0308660 | 3300049593 | Bacteria | 1008 |
| 561 | Ga0501202_000507 | 3300049652 | Bacteria | 5592 |
| 562 | Ga0501216_013641 | 3300049660 | Bacteria | 1350 |
| 563 | Ga0501217_002038 | 3300049661 | Bacteria | 3908 |
| 564 | Ga0501233_005464 | 3300049668 | Bacteria | 2359 |
| 565 | Ga0501236_039850 | 3300049670 | Bacteria | 775 |
| 566 | Ga0501240_036607 | 3300049673 | Bacteria | 804 |
| 567 | Ga0501250_077792 | 3300049680 | Bacteria | 559 |
| 568 | Ga0501229_008713 | 3300049706 | Bacteria | 1270 |
| 569 | Ga0501234_001766 | 3300049707 | Bacteria | 3405 |
| 570 | Ga0501079_0002267 | 3300049741 | Bacteria | 13890 |
| 571 | Ga0501079_0332411 | 3300049741 | Bacteria | 1190 |
| 572 | Ga0501079_0685943 | 3300049741 | Bacteria | 806 |
| 573 | Ga0501080_0006209 | 3300049742 | Bacteria | 10725 |
| 574 | Ga0501080_0193694 | 3300049742 | Bacteria | 1867 |
| 575 | Ga0501081_0001028 | 3300049743 | Bacteria | 16673 |
| 576 | Ga0501273_005459 | 3300049770 | Bacteria | 1436 |
| 577 | Ga0501035_0372915 | 3300049822 | Bacteria | 1191 |
| 578 | Ga0501035_0506827 | 3300049822 | Bacteria | 993 |
| 579 | Ga0501044_1104513 | 3300049823 | Bacteria | 662 |
| 580 | Ga0501045_0469091 | 3300049824 | Bacteria | 935 |
| 581 | Ga0501204_011255 | 3300049850 | Bacteria | 1060 |
| 582 | Ga0501212_109032 | 3300049851 | Bacteria | 527 |
| 583 | nmdc:mga05p37_1074328_c1 | 3300050507 | Bacteria | 846 |
| 584 | nmdc:mga05p37_1103861_c1 | 3300050507 | Bacteria | 830 |
| 585 | nmdc:mga05p37_197678_c1 | 3300050507 | Bacteria | 2437 |
| 586 | nmdc:mga05p37_983004_c1 | 3300050507 | Bacteria | 899 |
| 587 | nmdc:mga09592_1066814_c1 | 3300050508 | Unclassified | 673 |
| 588 | nmdc:mga0n895_120857_c1 | 3300050512 | Bacteria | 2640 |
| 589 | nmdc:mga0n895_19806_c1 | 3300050512 | Bacteria | 6260 |
| 590 | nmdc:mga0n895_2027102_c1 | 3300050512 | Bacteria | 533 |
| 591 | nmdc:mga0n895_737118_c1 | 3300050512 | Bacteria | 979 |
| 592 | nmdc:mga08x19_1217348_c1 | 3300050514 | Unclassified | 534 |
| 593 | nmdc:mga08x19_314442_c1 | 3300050514 | Bacteria | 1089 |
| 594 | nmdc:mga0a205_147027_c1 | 3300050515 | Bacteria | 2257 |
| 595 | nmdc:mga0a205_295924_c1 | 3300050515 | Bacteria | 1492 |
| 596 | nmdc:mga0a205_776747_c1 | 3300050515 | Bacteria | 806 |
| 597 | nmdc:mga0a205_888485_c1 | 3300050515 | Bacteria | 738 |
| 598 | Ga0495601_0575432 | 3300053077 | Unclassified | 724 |
| 599 | Ga0495595_0199292 | 3300053084 | Bacteria | 996 |
| 600 | Ga0495619_0418373 | 3300053085 | Bacteria | 925 |
| 601 | Ga0500651_0023045 | 3300053093 | Bacteria | 3896 |
| 602 | Ga0500555_021500 | 3300053103 | Bacteria | 1858 |
| 603 | Ga0500616_0000928 | 3300053153 | Bacteria | 32046 |
| 604 | Ga0501084_0009750 | 3300054114 | Bacteria | 7943 |
| 605 | Ga0501084_0256715 | 3300054114 | Bacteria | 1475 |
| 606 | Ga0501082_0002747 | 3300060353 | Bacteria | 15376 |
| 607 | Ga0501082_0454070 | 3300060353 | Bacteria | 1120 |
| 608 | Ga0530510_0000012 | 3300061734 | Bacteria | 115789 |
| 609 | Ga0530510_0170219 | 3300061734 | Bacteria | 1613 |
| 610 | Ga0530510_0309470 | 3300061734 | Bacteria | 1183 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300026089 | Ga0207648_10977978 | Ga0207648_109779782 | 82 |
| 2 | 3300005841 | Ga0068863_100816623 | Ga0068863_1008166232 | 84 |
| 3 | 3300006846 | Ga0075430_101157027 | Ga0075430_1011570272 | 89 |
| 4 | 3300005439 | Ga0070711_101911771 | Ga0070711_1019117711 | 90 |
| 5 | 3300003756 | Ga0055533_1005338 | Ga0055533_10053382 | 91 |
| 6 | 3300005337 | Ga0070682_100350214 | Ga0070682_1003502143 | 91 |
| 7 | 3300005353 | Ga0070669_101171723 | Ga0070669_1011717232 | 91 |
| 8 | 3300005616 | Ga0068852_100957396 | Ga0068852_1009573962 | 91 |
| 9 | 3300005617 | Ga0068859_101383415 | Ga0068859_1013834152 | 91 |
| 10 | 3300005719 | Ga0068861_100517884 | Ga0068861_1005178842 | 91 |
| 11 | 3300005840 | Ga0068870_10401408 | Ga0068870_104014081 | 91 |
| 12 | 3300005840 | Ga0068870_11281202 | Ga0068870_112812021 | 91 |
| 13 | 3300006931 | Ga0097620_101383513 | Ga0097620_1013835132 | 91 |
| 14 | 3300021384 | Ga0213876_10000053 | Ga0213876_1000005320 | 91 |
| 15 | 3300025226 | Ga0209674_100016 | Ga0209674_100016115 | 91 |
| 16 | 3300025908 | Ga0207643_10364701 | Ga0207643_103647011 | 91 |
| 17 | 3300025923 | Ga0207681_11012687 | Ga0207681_110126872 | 91 |
| 18 | 3300025927 | Ga0207687_11717788 | Ga0207687_117177881 | 91 |
| 19 | 3300025935 | Ga0207709_10980204 | Ga0207709_109802042 | 91 |
| 20 | 3300025949 | Ga0207667_10639533 | Ga0207667_106395332 | 91 |
| 21 | 3300026078 | Ga0207702_12485213 | Ga0207702_124852132 | 91 |
| 22 | 3300026118 | Ga0207675_100749100 | Ga0207675_1007491002 | 91 |
| 23 | 3300039437 | Ga0436365_0873465 | Ga0436365_0873465_89014_89334 | 91 |
| 24 | iso_pu_bacteria | 2582581280 | 2585151745 | 91 |
| 25 | iso_pu_bacteria | 2582581293 | 2585195372 | 91 |
| 26 | 3300005331 | Ga0070670_100667457 | Ga0070670_1006674572 | 92 |
| 27 | 3300005338 | Ga0068868_100094624 | Ga0068868_1000946243 | 92 |
| 28 | 3300005343 | Ga0070687_100120130 | Ga0070687_1001201302 | 92 |
| 29 | 3300005438 | Ga0070701_10310877 | Ga0070701_103108772 | 92 |
| 30 | 3300005441 | Ga0070700_100639519 | Ga0070700_1006395191 | 92 |
| 31 | 3300005466 | Ga0070685_10334027 | Ga0070685_103340272 | 92 |
| 32 | 3300005564 | Ga0070664_100295325 | Ga0070664_1002953253 | 92 |
| 33 | 3300005615 | Ga0070702_100007398 | Ga0070702_1000073983 | 92 |
| 34 | 3300005615 | Ga0070702_100756469 | Ga0070702_1007564692 | 92 |
| 35 | 3300005617 | Ga0068859_100011283 | Ga0068859_1000112838 | 92 |
| 36 | 3300005617 | Ga0068859_100084432 | Ga0068859_1000844323 | 92 |
| 37 | 3300005841 | Ga0068863_100340516 | Ga0068863_1003405163 | 92 |
| 38 | 3300005842 | Ga0068858_100215509 | Ga0068858_1002155093 | 92 |
| 39 | 3300005843 | Ga0068860_100136255 | Ga0068860_1001362553 | 92 |
| 40 | 3300005844 | Ga0068862_101075623 | Ga0068862_1010756232 | 92 |
| 41 | 3300006237 | Ga0097621_100106336 | Ga0097621_1001063363 | 92 |
| 42 | 3300006931 | Ga0097620_100011281 | Ga0097620_1000112814 | 92 |
| 43 | 3300006931 | Ga0097620_100084432 | Ga0097620_1000844323 | 92 |
| 44 | 3300009101 | Ga0105247_10258903 | Ga0105247_102589032 | 92 |
| 45 | 3300009174 | Ga0105241_10437883 | Ga0105241_104378833 | 92 |
| 46 | 3300009553 | Ga0105249_10623536 | Ga0105249_106235362 | 92 |
| 47 | 3300010375 | Ga0105239_11974907 | Ga0105239_119749071 | 92 |
| 48 | 3300013306 | Ga0163162_11371494 | Ga0163162_113714942 | 92 |
| 49 | 3300013306 | Ga0163162_11684493 | Ga0163162_116844932 | 92 |
| 50 | 3300014968 | Ga0157379_11088793 | Ga0157379_110887931 | 92 |
| 51 | 3300015687 | Ga0183368_1004 | Ga0183368_1004556 | 92 |
| 52 | 3300025900 | Ga0207710_10057290 | Ga0207710_100572903 | 92 |
| 53 | 3300025918 | Ga0207662_10029724 | Ga0207662_100297243 | 92 |
| 54 | 3300025933 | Ga0207706_10103590 | Ga0207706_101035905 | 92 |
| 55 | 3300025945 | Ga0207679_10021982 | Ga0207679_100219823 | 92 |
| 56 | 3300026023 | Ga0207677_10097872 | Ga0207677_100978723 | 92 |
| 57 | 3300026035 | Ga0207703_11062669 | Ga0207703_110626692 | 92 |
| 58 | 3300026088 | Ga0207641_10249276 | Ga0207641_102492763 | 92 |
| 59 | 3300026095 | Ga0207676_10234782 | Ga0207676_102347821 | 92 |
| 60 | 3300035083 | Ga0373926_0060992 | Ga0373926_0060992_980_1303 | 92 |
| 61 | 3300035113 | Ga0373936_0120871 | Ga0373936_0120871_541_864 | 92 |
| 62 | 3300035692 | Ga0373935_0107164 | Ga0373935_0107164_892_1215 | 92 |
| 63 | 3300037068 | Ga0373925_0008518 | Ga0373925_0008518_4696_5019 | 92 |
| 64 | 3300046529 | Ga0495652_0090745 | Ga0495652_0090745_1582_1905 | 92 |
| 65 | 3300046536 | Ga0495587_0153507 | Ga0495587_0153507_686_1009 | 92 |
| 66 | 3300046543 | Ga0495645_0305683 | Ga0495645_0305683_575_898 | 92 |
| 67 | 3300046678 | Ga0495599_0262988 | Ga0495599_0262988_398_721 | 92 |
| 68 | 3300048915 | Ga0496112_0915187 | Ga0496112_0915187_428_751 | 92 |
| 69 | 3300005334 | Ga0068869_101216558 | Ga0068869_1012165582 | 93 |
| 70 | 3300005340 | Ga0070689_100388737 | Ga0070689_1003887372 | 93 |
| 71 | 3300005353 | Ga0070669_101324743 | Ga0070669_1013247431 | 93 |
| 72 | 3300005354 | Ga0070675_100647377 | Ga0070675_1006473772 | 93 |
| 73 | 3300005438 | Ga0070701_10188807 | Ga0070701_101888072 | 93 |
| 74 | 3300005440 | Ga0070705_100229134 | Ga0070705_1002291342 | 93 |
| 75 | 3300005444 | Ga0070694_100297183 | Ga0070694_1002971832 | 93 |
| 76 | 3300005457 | Ga0070662_101830964 | Ga0070662_1018309641 | 93 |
| 77 | 3300005458 | Ga0070681_10175666 | Ga0070681_101756663 | 93 |
| 78 | 3300005543 | Ga0070672_100725387 | Ga0070672_1007253872 | 93 |
| 79 | 3300005577 | Ga0068857_100312327 | Ga0068857_1003123273 | 93 |
| 80 | 3300005578 | Ga0068854_100014355 | Ga0068854_1000143555 | 93 |
| 81 | 3300005614 | Ga0068856_100114766 | Ga0068856_1001147663 | 93 |
| 82 | 3300005617 | Ga0068859_100014042 | Ga0068859_1000140425 | 93 |
| 83 | 3300005618 | Ga0068864_100052563 | Ga0068864_1000525634 | 93 |
| 84 | 3300005718 | Ga0068866_10054750 | Ga0068866_100547503 | 93 |
| 85 | 3300005844 | Ga0068862_100052522 | Ga0068862_1000525223 | 93 |
| 86 | 3300006931 | Ga0097620_100014042 | Ga0097620_1000140425 | 93 |
| 87 | 3300025911 | Ga0207654_10293544 | Ga0207654_102935443 | 93 |
| 88 | 3300025936 | Ga0207670_10539625 | Ga0207670_105396252 | 93 |
| 89 | 3300026089 | Ga0207648_10065542 | Ga0207648_100655425 | 93 |
| 90 | 3300026095 | Ga0207676_10321737 | Ga0207676_103217373 | 93 |
| 91 | 3300026095 | Ga0207676_10632053 | Ga0207676_106320532 | 93 |
| 92 | 3300026116 | Ga0207674_10116463 | Ga0207674_101164632 | 93 |
| 93 | 3300026142 | Ga0207698_10634093 | Ga0207698_106340933 | 93 |
| 94 | 3300026142 | Ga0207698_12334579 | Ga0207698_123345792 | 93 |
| 95 | 3300028380 | Ga0268265_10027580 | Ga0268265_100275805 | 93 |
| 96 | 3300028381 | Ga0268264_10603839 | Ga0268264_106038393 | 93 |
| 97 | 3300035691 | Ga0373931_0969129 | Ga0373931_0969129_119_442 | 93 |
| 98 | 3300053153 | Ga0500616_0000928 | Ga0500616_0000928_17836_18159 | 93 |
| 99 | 3300005535 | Ga0070684_101406144 | Ga0070684_1014061441 | 94 |
| 100 | 3300005618 | Ga0068864_100122958 | Ga0068864_1001229582 | 94 |
| 101 | 3300009177 | Ga0105248_11589920 | Ga0105248_115899202 | 94 |
| 102 | 3300014325 | Ga0163163_10349333 | Ga0163163_103493333 | 94 |
| 103 | 3300026095 | Ga0207676_10401531 | Ga0207676_104015313 | 94 |
| 104 | 3300005616 | Ga0068852_100218565 | Ga0068852_1002185651 | 95 |
| 105 | 3300009545 | Ga0105237_10013242 | Ga0105237_100132423 | 95 |
| 106 | 3300013307 | Ga0157372_10786323 | Ga0157372_107863232 | 95 |
| 107 | 3300025913 | Ga0207695_10136047 | Ga0207695_101360473 | 95 |
| 108 | 3300025914 | Ga0207671_10020566 | Ga0207671_100205662 | 95 |
| 109 | 3300025921 | Ga0207652_10027349 | Ga0207652_100273496 | 95 |
| 110 | 3300026142 | Ga0207698_11258650 | Ga0207698_112586503 | 95 |
| 111 | 3300030733 | Ga0314311_1179633 | Ga0314311_11796332 | 95 |
| 112 | 3300035112 | Ga0373932_0320698 | Ga0373932_0320698_94_381 | 95 |
| 113 | 3300044712 | Ga0453684_2361106 | Ga0453684_2361106_180_503 | 95 |
| 114 | 3300048916 | Ga0496113_0394731 | Ga0496113_0394731_242_529 | 95 |
| 115 | 3300049589 | Ga0501073_0033884 | Ga0501073_0033884_338_625 | 95 |
| 116 | 3300005331 | Ga0070670_100029904 | Ga0070670_1000299045 | 96 |
| 117 | 3300005334 | Ga0068869_101194413 | Ga0068869_1011944132 | 96 |
| 118 | 3300005458 | Ga0070681_10375680 | Ga0070681_103756802 | 96 |
| 119 | 3300005618 | Ga0068864_100001094 | Ga0068864_1000010949 | 96 |
| 120 | 3300005840 | Ga0068870_10001396 | Ga0068870_100013964 | 96 |
| 121 | 3300011119 | Ga0105246_10406897 | Ga0105246_104068972 | 96 |
| 122 | 3300014325 | Ga0163163_10123336 | Ga0163163_101233363 | 96 |
| 123 | 3300014326 | Ga0157380_10001886 | Ga0157380_100018868 | 96 |
| 124 | 3300025908 | Ga0207643_10015698 | Ga0207643_100156984 | 96 |
| 125 | 3300025925 | Ga0207650_10021490 | Ga0207650_100214903 | 96 |
| 126 | 3300025942 | Ga0207689_11173765 | Ga0207689_111737652 | 96 |
| 127 | 3300026095 | Ga0207676_10003048 | Ga0207676_100030486 | 96 |
| 128 | 3300034818 | Ga0373950_0035216 | Ga0373950_0035216_19_309 | 96 |
| 129 | 3300049570 | Ga0501033_0000524 | Ga0501033_0000524_16697_17020 | 96 |
| 130 | 3300005345 | Ga0070692_10230000 | Ga0070692_102300002 | 97 |
| 131 | 3300005440 | Ga0070705_101143903 | Ga0070705_1011439032 | 97 |
| 132 | 3300005549 | Ga0070704_100017412 | Ga0070704_1000174124 | 97 |
| 133 | 3300005578 | Ga0068854_101324508 | Ga0068854_1013245082 | 97 |
| 134 | 3300005457 | Ga0070662_100005929 | Ga0070662_1000059292 | 98 |
| 135 | 3300005467 | Ga0070706_100004834 | Ga0070706_1000048347 | 98 |
| 136 | 3300005530 | Ga0070679_101888298 | Ga0070679_1018882981 | 98 |
| 137 | 3300005563 | Ga0068855_100000148 | Ga0068855_10000014828 | 98 |
| 138 | 3300005578 | Ga0068854_100000527 | Ga0068854_1000005273 | 98 |
| 139 | 3300005614 | Ga0068856_102526820 | Ga0068856_1025268202 | 98 |
| 140 | 3300005615 | Ga0070702_100685652 | Ga0070702_1006856521 | 98 |
| 141 | 3300006881 | Ga0068865_100947803 | Ga0068865_1009478031 | 98 |
| 142 | 3300009093 | Ga0105240_10007036 | Ga0105240_100070364 | 98 |
| 143 | 3300013102 | Ga0157371_10871202 | Ga0157371_108712022 | 98 |
| 144 | 3300014969 | Ga0157376_12618642 | Ga0157376_126186422 | 98 |
| 145 | 3300025910 | Ga0207684_10039886 | Ga0207684_100398863 | 98 |
| 146 | 3300025913 | Ga0207695_10008974 | Ga0207695_1000897412 | 98 |
| 147 | 3300025933 | Ga0207706_10012101 | Ga0207706_1001210110 | 98 |
| 148 | 3300025938 | Ga0207704_11653148 | Ga0207704_116531482 | 98 |
| 149 | 3300025949 | Ga0207667_10000062 | Ga0207667_1000006246 | 98 |
| 150 | 3300025981 | Ga0207640_10000022 | Ga0207640_1000002266 | 98 |
| 151 | 3300037418 | Ga0395900_1491857 | Ga0395900_1491857_97_393 | 98 |
| 152 | 3300037471 | Ga0395905_0006366 | Ga0395905_0006366_7156_7452 | 98 |
| 153 | 3300005327 | Ga0070658_10023784 | Ga0070658_100237844 | 99 |
| 154 | 3300005336 | Ga0070680_100920761 | Ga0070680_1009207611 | 99 |
| 155 | 3300005340 | Ga0070689_100780134 | Ga0070689_1007801342 | 99 |
| 156 | 3300005455 | Ga0070663_100006820 | Ga0070663_1000068206 | 99 |
| 157 | 3300005456 | Ga0070678_100101308 | Ga0070678_1001013083 | 99 |
| 158 | 3300025936 | Ga0207670_10494158 | Ga0207670_104941583 | 99 |
| 159 | 3300026067 | Ga0207678_10000399 | Ga0207678_100003993 | 99 |
| 160 | 3300026121 | Ga0207683_10023314 | Ga0207683_100233144 | 99 |
| 161 | 3300005471 | Ga0070698_101845943 | Ga0070698_1018459431 | 100 |
| 162 | 3300006844 | Ga0075428_100105443 | Ga0075428_1001054435 | 100 |
| 163 | 3300006871 | Ga0075434_100022420 | Ga0075434_1000224207 | 100 |
| 164 | 3300006914 | Ga0075436_100377736 | Ga0075436_1003777363 | 100 |
| 165 | 3300007076 | Ga0075435_100043004 | Ga0075435_1000430043 | 100 |
| 166 | 3300009147 | Ga0114129_10560851 | Ga0114129_105608512 | 100 |
| 167 | 3300003759 | Ga0055525_1000207 | Ga0055525_100020725 | 101 |
| 168 | 3300003760 | Ga0055527_1000108 | Ga0055527_100010822 | 101 |
| 169 | 3300003761 | Ga0055535_1000646 | Ga0055535_100064621 | 101 |
| 170 | 3300003762 | Ga0055542_1000447 | Ga0055542_100044710 | 101 |
| 171 | 3300003763 | Ga0055529_1000603 | Ga0055529_10006035 | 101 |
| 172 | 3300006177 | Ga0075362_10726267 | Ga0075362_107262672 | 101 |
| 173 | 3300025228 | Ga0209672_100103 | Ga0209672_10010339 | 101 |
| 174 | 3300025230 | Ga0209563_100150 | Ga0209563_10015025 | 101 |
| 175 | 3300025242 | Ga0209258_100232 | Ga0209258_10023239 | 101 |
| 176 | 3300025254 | Ga0209148_1000206 | Ga0209148_100020639 | 101 |
| 177 | 3300025272 | Ga0209455_1000179 | Ga0209455_100017939 | 101 |
| 178 | 3300050507 | nmdc:mga05p37_983004_c1 | nmdc:mga05p37_983004_c1_392_715 | 101 |
| 179 | 3300050512 | nmdc:mga0n895_19806_c1 | nmdc:mga0n895_19806_c1_1203_1526 | 101 |
| 180 | 3300050514 | nmdc:mga08x19_1217348_c1 | nmdc:mga08x19_1217348_c1_124_447 | 101 |
| 181 | 3300005345 | Ga0070692_11395584 | Ga0070692_113955841 | 102 |
| 182 | 3300005364 | Ga0070673_100866591 | Ga0070673_1008665912 | 102 |
| 183 | 3300005441 | Ga0070700_100000193 | Ga0070700_10000019330 | 102 |
| 184 | 3300005547 | Ga0070693_100358456 | Ga0070693_1003584562 | 102 |
| 185 | 3300005617 | Ga0068859_100003211 | Ga0068859_10000321111 | 102 |
| 186 | 3300006931 | Ga0097620_100003211 | Ga0097620_1000032116 | 102 |
| 187 | 3300009101 | Ga0105247_10064908 | Ga0105247_100649083 | 102 |
| 188 | 3300009177 | Ga0105248_10003342 | Ga0105248_100033429 | 102 |
| 189 | 3300025900 | Ga0207710_10127913 | Ga0207710_101279133 | 102 |
| 190 | 3300025941 | Ga0207711_10006529 | Ga0207711_1000652910 | 102 |
| 191 | 3300026075 | Ga0207708_10001354 | Ga0207708_1000135414 | 102 |
| 192 | 3300042993 | Ga0439440_0021057 | Ga0439440_0021057_667_975 | 102 |
| 193 | 3300035086 | Ga0373934_0451575 | Ga0373934_0451575_192_503 | 103 |
| 194 | 3300035111 | Ga0373923_0315660 | Ga0373923_0315660_172_483 | 103 |
| 195 | 3300035113 | Ga0373936_0019359 | Ga0373936_0019359_1881_2192 | 103 |
| 196 | 3300035692 | Ga0373935_0089201 | Ga0373935_0089201_741_1052 | 103 |
| 197 | 3300035695 | Ga0373927_0653456 | Ga0373927_0653456_351_662 | 103 |
| 198 | 3300035724 | Ga0373933_0074937 | Ga0373933_0074937_1452_1763 | 103 |
| 199 | 3300035725 | Ga0373947_0126186 | Ga0373947_0126186_616_927 | 103 |
| 200 | 3300036401 | Ga0373937_0001923 | Ga0373937_0001923_7108_7419 | 103 |
| 201 | 3300046454 | Ga0495592_0233315 | Ga0495592_0233315_870_1181 | 103 |
| 202 | 3300046459 | Ga0495629_0754581 | Ga0495629_0754581_114_425 | 103 |
| 203 | 3300046462 | Ga0495651_0044707 | Ga0495651_0044707_283_594 | 103 |
| 204 | 3300046463 | Ga0495653_0089198 | Ga0495653_0089198_491_802 | 103 |
| 205 | 3300046517 | Ga0495630_0545685 | Ga0495630_0545685_399_710 | 103 |
| 206 | 3300046536 | Ga0495587_0063049 | Ga0495587_0063049_1736_2047 | 103 |
| 207 | 3300046559 | Ga0495667_0000715 | Ga0495667_0000715_12949_13260 | 103 |
| 208 | 3300046663 | Ga0495635_0002992 | Ga0495635_0002992_5013_5324 | 103 |
| 209 | 3300046675 | Ga0495657_0036301 | Ga0495657_0036301_3014_3325 | 103 |
| 210 | 3300046678 | Ga0495599_0201671 | Ga0495599_0201671_398_709 | 103 |
| 211 | 3300046690 | Ga0495624_0335329 | Ga0495624_0335329_63_374 | 103 |
| 212 | 3300046809 | Ga0495600_0053077 | Ga0495600_0053077_482_793 | 103 |
| 213 | 3300047319 | Ga0495674_0619039 | Ga0495674_0619039_310_621 | 103 |
| 214 | 3300047322 | Ga0495680_0003225 | Ga0495680_0003225_12510_12821 | 103 |
| 215 | iso_pu_bacteria | 2904699407 | 2904700860 | 103 |
| 216 | iso_pu_bacteria | 2919450847 | 2919451448 | 103 |
| 217 | iso_pu_bacteria | 2928963466 | 2928967171 | 103 |
| 218 | 3300005334 | Ga0068869_100498475 | Ga0068869_1004984752 | 105 |
| 219 | 3300005436 | Ga0070713_101747329 | Ga0070713_1017473291 | 105 |
| 220 | 3300005445 | Ga0070708_100031387 | Ga0070708_1000313872 | 105 |
| 221 | 3300005468 | Ga0070707_100549387 | Ga0070707_1005493872 | 105 |
| 222 | 3300005578 | Ga0068854_100076177 | Ga0068854_1000761773 | 105 |
| 223 | 3300005719 | Ga0068861_100126977 | Ga0068861_1001269773 | 105 |
| 224 | 3300005937 | Ga0081455_10108237 | Ga0081455_101082373 | 105 |
| 225 | 3300009147 | Ga0114129_10901253 | Ga0114129_109012533 | 105 |
| 226 | 3300014745 | Ga0157377_10000198 | Ga0157377_1000019833 | 105 |
| 227 | 3300025942 | Ga0207689_10694071 | Ga0207689_106940712 | 105 |
| 228 | 3300025981 | Ga0207640_10138412 | Ga0207640_101384122 | 105 |
| 229 | 3300030731 | Ga0316177_1016443 | Ga0316177_10164433 | 105 |
| 230 | 3300030732 | Ga0316176_1204343 | Ga0316176_12043433 | 105 |
| 231 | 3300030744 | Ga0316181_1073040 | Ga0316181_10730402 | 105 |
| 232 | 3300030745 | Ga0316182_1014446 | Ga0316182_10144463 | 105 |
| 233 | 3300031691 | Ga0316579_10140560 | Ga0316579_101405603 | 105 |
| 234 | 3300031727 | Ga0316576_10302392 | Ga0316576_103023922 | 105 |
| 235 | 3300031728 | Ga0316578_10034292 | Ga0316578_100342923 | 105 |
| 236 | 3300035170 | Ga0373943_0384926 | Ga0373943_0384926_134_451 | 105 |
| 237 | 3300035398 | Ga0316574_0046118 | Ga0316574_0046118_1919_2236 | 105 |
| 238 | 3300035725 | Ga0373947_0687014 | Ga0373947_0687014_125_442 | 105 |
| 239 | 3300036401 | Ga0373937_0530741 | Ga0373937_0530741_735_1052 | 105 |
| 240 | 3300036712 | Ga0316584_0451305 | Ga0316584_0451305_109_426 | 105 |
| 241 | 3300046455 | Ga0495603_0180843 | Ga0495603_0180843_660_977 | 105 |
| 242 | 3300046462 | Ga0495651_0227730 | Ga0495651_0227730_212_529 | 105 |
| 243 | 3300046559 | Ga0495667_0075055 | Ga0495667_0075055_668_985 | 105 |
| 244 | 3300046642 | Ga0495634_0584056 | Ga0495634_0584056_249_566 | 105 |
| 245 | 3300046675 | Ga0495657_0126895 | Ga0495657_0126895_37_354 | 105 |
| 246 | 3300046809 | Ga0495600_0526848 | Ga0495600_0526848_171_488 | 105 |
| 247 | 3300047317 | Ga0495604_0402803 | Ga0495604_0402803_521_838 | 105 |
| 248 | 3300047322 | Ga0495680_1105728 | Ga0495680_1105728_39_356 | 105 |
| 249 | 3300048907 | Ga0496104_0376568 | Ga0496104_0376568_855_1172 | 105 |
| 250 | 3300048908 | Ga0496105_1397118 | Ga0496105_1397118_34_351 | 105 |
| 251 | 3300048922 | Ga0496119_0003170 | Ga0496119_0003170_7351_7668 | 105 |
| 252 | 3300049585 | Ga0501069_0016632 | Ga0501069_0016632_2903_3220 | 105 |
| 253 | 3300049741 | Ga0501079_0685943 | Ga0501079_0685943_460_777 | 105 |
| 254 | 3300050507 | nmdc:mga05p37_1103861_c1 | nmdc:mga05p37_1103861_c1_237_554 | 105 |
| 255 | 3300053084 | Ga0495595_0199292 | Ga0495595_0199292_42_359 | 105 |
| 256 | 3300053085 | Ga0495619_0418373 | Ga0495619_0418373_255_572 | 105 |
| 257 | 3300044673 | Ga0453683_0044741 | Ga0453683_0044741_2201_2521 | 106 |
| 258 | 3300045051 | Ga0451576_0293614 | Ga0451576_0293614_914_1234 | 106 |
| 259 | 3300048903 | Ga0496100_0113237 | Ga0496100_0113237_661_981 | 106 |
| 260 | 3300049570 | Ga0501033_0019520 | Ga0501033_0019520_2904_3224 | 106 |
| 261 | 3300049572 | Ga0501036_0070051 | Ga0501036_0070051_2490_2810 | 106 |
| 262 | 3300049572 | Ga0501036_1402128 | Ga0501036_1402128_59_379 | 106 |
| 263 | 3300049573 | Ga0501037_0293279 | Ga0501037_0293279_341_661 | 106 |
| 264 | 3300049574 | Ga0501038_0005856 | Ga0501038_0005856_10871_11191 | 106 |
| 265 | 3300049574 | Ga0501038_0505541 | Ga0501038_0505541_495_815 | 106 |
| 266 | 3300049575 | Ga0501039_0135241 | Ga0501039_0135241_735_1055 | 106 |
| 267 | 3300049575 | Ga0501039_0224175 | Ga0501039_0224175_273_593 | 106 |
| 268 | 3300049576 | Ga0501040_0010673 | Ga0501040_0010673_1675_1995 | 106 |
| 269 | 3300049577 | Ga0501041_0014947 | Ga0501041_0014947_3520_3840 | 106 |
| 270 | 3300049578 | Ga0501042_0418835 | Ga0501042_0418835_404_724 | 106 |
| 271 | 3300049579 | Ga0501043_0635896 | Ga0501043_0635896_355_675 | 106 |
| 272 | 3300049580 | Ga0501046_0148049 | Ga0501046_0148049_471_791 | 106 |
| 273 | 3300049580 | Ga0501046_0308031 | Ga0501046_0308031_88_408 | 106 |
| 274 | 3300049582 | Ga0501048_0388325 | Ga0501048_0388325_667_987 | 106 |
| 275 | 3300049584 | Ga0501068_0536861 | Ga0501068_0536861_354_674 | 106 |
| 276 | 3300049585 | Ga0501069_0264321 | Ga0501069_0264321_426_746 | 106 |
| 277 | 3300049585 | Ga0501069_0401358 | Ga0501069_0401358_330_650 | 106 |
| 278 | 3300049586 | Ga0501070_0386272 | Ga0501070_0386272_44_364 | 106 |
| 279 | 3300049587 | Ga0501071_0017558 | Ga0501071_0017558_2663_2983 | 106 |
| 280 | 3300049588 | Ga0501072_0000985 | Ga0501072_0000985_527_847 | 106 |
| 281 | 3300049588 | Ga0501072_0401457 | Ga0501072_0401457_13_333 | 106 |
| 282 | 3300049589 | Ga0501073_0058901 | Ga0501073_0058901_232_552 | 106 |
| 283 | 3300049591 | Ga0501075_0000021 | Ga0501075_0000021_38728_39048 | 106 |
| 284 | 3300049591 | Ga0501075_0845140 | Ga0501075_0845140_247_567 | 106 |
| 285 | 3300049592 | Ga0501076_0000070 | Ga0501076_0000070_31241_31561 | 106 |
| 286 | 3300049592 | Ga0501076_0141837 | Ga0501076_0141837_1289_1609 | 106 |
| 287 | 3300049593 | Ga0501077_0133185 | Ga0501077_0133185_482_802 | 106 |
| 288 | 3300049593 | Ga0501077_0177151 | Ga0501077_0177151_326_646 | 106 |
| 289 | 3300049593 | Ga0501077_0308660 | Ga0501077_0308660_518_838 | 106 |
| 290 | 3300049741 | Ga0501079_0002267 | Ga0501079_0002267_2391_2711 | 106 |
| 291 | 3300049741 | Ga0501079_0332411 | Ga0501079_0332411_300_620 | 106 |
| 292 | 3300049742 | Ga0501080_0006209 | Ga0501080_0006209_2039_2359 | 106 |
| 293 | 3300049742 | Ga0501080_0193694 | Ga0501080_0193694_271_591 | 106 |
| 294 | 3300049743 | Ga0501081_0001028 | Ga0501081_0001028_2431_2751 | 106 |
| 295 | 3300049822 | Ga0501035_0372915 | Ga0501035_0372915_572_892 | 106 |
| 296 | 3300049823 | Ga0501044_1104513 | Ga0501044_1104513_133_453 | 106 |
| 297 | 3300049824 | Ga0501045_0469091 | Ga0501045_0469091_390_710 | 106 |
| 298 | 3300054114 | Ga0501084_0009750 | Ga0501084_0009750_5578_5898 | 106 |
| 299 | 3300054114 | Ga0501084_0256715 | Ga0501084_0256715_663_983 | 106 |
| 300 | 3300060353 | Ga0501082_0002747 | Ga0501082_0002747_4191_4511 | 106 |
| 301 | 3300060353 | Ga0501082_0454070 | Ga0501082_0454070_203_523 | 106 |
| 302 | 3300061734 | Ga0530510_0000012 | Ga0530510_0000012_67825_68145 | 106 |
| 303 | 3300061734 | Ga0530510_0170219 | Ga0530510_0170219_97_417 | 106 |
| 304 | 3300001989 | JGI24739J22299_10067983 | JGI24739J22299_100679833 | 107 |
| 305 | 3300002074 | JGI24748J21848_1000002 | JGI24748J21848_1000002262 | 107 |
| 306 | 3300002239 | JGI24034J26672_10000004 | JGI24034J26672_10000004112 | 107 |
| 307 | 3300002737 | JGI25162J39368_1000021 | JGI25162J39368_1000021144 | 107 |
| 308 | 3300002741 | JGI25157J39369_1014950 | JGI25157J39369_10149502 | 107 |
| 309 | 3300002771 | JGI25163J39215_1007283 | JGI25163J39215_10072831 | 107 |
| 310 | 3300003214 | JGI25165J46597_1000049 | JGI25165J46597_100004980 | 107 |
| 311 | 3300003316 | rootH1_10043042 | rootH1_100430424 | 107 |
| 312 | 3300003316 | rootH1_10118134 | rootH1_101181343 | 107 |
| 313 | 3300003320 | rootH2_10001362 | rootH2_1000136233 | 107 |
| 314 | 3300003320 | rootH2_10256832 | rootH2_102568323 | 107 |
| 315 | 3300003322 | rootL2_10009982 | rootL2_100099827 | 107 |
| 316 | 3300003322 | rootL2_10038767 | rootL2_100387676 | 107 |
| 317 | 3300003322 | rootL2_10257985 | rootL2_102579853 | 107 |
| 318 | 3300003751 | Ga0055538_1000023 | Ga0055538_1000023144 | 107 |
| 319 | 3300003752 | Ga0055539_1000030 | Ga0055539_1000030144 | 107 |
| 320 | 3300003756 | Ga0055533_1000039 | Ga0055533_1000039144 | 107 |
| 321 | 3300003759 | Ga0055525_1000048 | Ga0055525_100004880 | 107 |
| 322 | 3300003762 | Ga0055542_1000223 | Ga0055542_100022320 | 107 |
| 323 | 3300003841 | Ga0055541_1000021 | Ga0055541_100002180 | 107 |
| 324 | 3300005327 | Ga0070658_10011873 | Ga0070658_100118732 | 107 |
| 325 | 3300005327 | Ga0070658_10155143 | Ga0070658_101551433 | 107 |
| 326 | 3300005331 | Ga0070670_100018852 | Ga0070670_1000188527 | 107 |
| 327 | 3300005331 | Ga0070670_101719437 | Ga0070670_1017194372 | 107 |
| 328 | 3300005331 | Ga0070670_101948063 | Ga0070670_1019480631 | 107 |
| 329 | 3300005334 | Ga0068869_100113390 | Ga0068869_1001133902 | 107 |
| 330 | 3300005334 | Ga0068869_100869545 | Ga0068869_1008695451 | 107 |
| 331 | 3300005338 | Ga0068868_100835553 | Ga0068868_1008355532 | 107 |
| 332 | 3300005345 | Ga0070692_10023635 | Ga0070692_100236354 | 107 |
| 333 | 3300005353 | Ga0070669_100000019 | Ga0070669_10000001944 | 107 |
| 334 | 3300005353 | Ga0070669_100048363 | Ga0070669_1000483632 | 107 |
| 335 | 3300005355 | Ga0070671_100046913 | Ga0070671_1000469136 | 107 |
| 336 | 3300005355 | Ga0070671_100312201 | Ga0070671_1003122013 | 107 |
| 337 | 3300005364 | Ga0070673_101330275 | Ga0070673_1013302752 | 107 |
| 338 | 3300005365 | Ga0070688_101058548 | Ga0070688_1010585482 | 107 |
| 339 | 3300005367 | Ga0070667_100019678 | Ga0070667_1000196783 | 107 |
| 340 | 3300005406 | Ga0070703_10000028 | Ga0070703_1000002835 | 107 |
| 341 | 3300005406 | Ga0070703_10142371 | Ga0070703_101423711 | 107 |
| 342 | 3300005434 | Ga0070709_10370028 | Ga0070709_103700282 | 107 |
| 343 | 3300005435 | Ga0070714_100078810 | Ga0070714_1000788103 | 107 |
| 344 | 3300005435 | Ga0070714_100303404 | Ga0070714_1003034041 | 107 |
| 345 | 3300005436 | Ga0070713_100009503 | Ga0070713_1000095033 | 107 |
| 346 | 3300005437 | Ga0070710_10028354 | Ga0070710_100283543 | 107 |
| 347 | 3300005437 | Ga0070710_10940413 | Ga0070710_109404131 | 107 |
| 348 | 3300005439 | Ga0070711_100394796 | Ga0070711_1003947962 | 107 |
| 349 | 3300005440 | Ga0070705_100000368 | Ga0070705_10000036823 | 107 |
| 350 | 3300005440 | Ga0070705_100109133 | Ga0070705_1001091333 | 107 |
| 351 | 3300005440 | Ga0070705_100386094 | Ga0070705_1003860942 | 107 |
| 352 | 3300005441 | Ga0070700_100006039 | Ga0070700_1000060394 | 107 |
| 353 | 3300005441 | Ga0070700_100587338 | Ga0070700_1005873383 | 107 |
| 354 | 3300005444 | Ga0070694_100241404 | Ga0070694_1002414042 | 107 |
| 355 | 3300005445 | Ga0070708_100000237 | Ga0070708_10000023715 | 107 |
| 356 | 3300005445 | Ga0070708_100001158 | Ga0070708_10000115812 | 107 |
| 357 | 3300005445 | Ga0070708_100999912 | Ga0070708_1009999121 | 107 |
| 358 | 3300005455 | Ga0070663_101348698 | Ga0070663_1013486981 | 107 |
| 359 | 3300005458 | Ga0070681_10294969 | Ga0070681_102949692 | 107 |
| 360 | 3300005466 | Ga0070685_10150822 | Ga0070685_101508223 | 107 |
| 361 | 3300005466 | Ga0070685_10281317 | Ga0070685_102813172 | 107 |
| 362 | 3300005467 | Ga0070706_100001593 | Ga0070706_10000159314 | 107 |
| 363 | 3300005467 | Ga0070706_100253436 | Ga0070706_1002534363 | 107 |
| 364 | 3300005467 | Ga0070706_100386337 | Ga0070706_1003863373 | 107 |
| 365 | 3300005467 | Ga0070706_100711661 | Ga0070706_1007116611 | 107 |
| 366 | 3300005467 | Ga0070706_100932334 | Ga0070706_1009323342 | 107 |
| 367 | 3300005467 | Ga0070706_101296460 | Ga0070706_1012964602 | 107 |
| 368 | 3300005468 | Ga0070707_100034782 | Ga0070707_1000347823 | 107 |
| 369 | 3300005468 | Ga0070707_101452765 | Ga0070707_1014527651 | 107 |
| 370 | 3300005471 | Ga0070698_100001354 | Ga0070698_10000135411 | 107 |
| 371 | 3300005471 | Ga0070698_100065472 | Ga0070698_1000654723 | 107 |
| 372 | 3300005471 | Ga0070698_100067512 | Ga0070698_1000675125 | 107 |
| 373 | 3300005471 | Ga0070698_100211259 | Ga0070698_1002112592 | 107 |
| 374 | 3300005471 | Ga0070698_101012541 | Ga0070698_1010125412 | 107 |
| 375 | 3300005518 | Ga0070699_100171861 | Ga0070699_1001718613 | 107 |
| 376 | 3300005518 | Ga0070699_100290033 | Ga0070699_1002900332 | 107 |
| 377 | 3300005518 | Ga0070699_100728702 | Ga0070699_1007287022 | 107 |
| 378 | 3300005530 | Ga0070679_100294754 | Ga0070679_1002947543 | 107 |
| 379 | 3300005536 | Ga0070697_100000140 | Ga0070697_10000014023 | 107 |
| 380 | 3300005536 | Ga0070697_100137905 | Ga0070697_1001379054 | 107 |
| 381 | 3300005539 | Ga0068853_100193419 | Ga0068853_1001934192 | 107 |
| 382 | 3300005543 | Ga0070672_100848305 | Ga0070672_1008483051 | 107 |
| 383 | 3300005545 | Ga0070695_100050977 | Ga0070695_1000509773 | 107 |
| 384 | 3300005545 | Ga0070695_100128826 | Ga0070695_1001288262 | 107 |
| 385 | 3300005546 | Ga0070696_100706402 | Ga0070696_1007064022 | 107 |
| 386 | 3300005548 | Ga0070665_100000026 | Ga0070665_10000002631 | 107 |
| 387 | 3300005548 | Ga0070665_100000365 | Ga0070665_10000036528 | 107 |
| 388 | 3300005549 | Ga0070704_100067136 | Ga0070704_1000671363 | 107 |
| 389 | 3300005549 | Ga0070704_101693233 | Ga0070704_1016932332 | 107 |
| 390 | 3300005577 | Ga0068857_102147862 | Ga0068857_1021478622 | 107 |
| 391 | 3300005615 | Ga0070702_100704121 | Ga0070702_1007041212 | 107 |
| 392 | 3300005616 | Ga0068852_100328066 | Ga0068852_1003280663 | 107 |
| 393 | 3300005617 | Ga0068859_100000046 | Ga0068859_10000004665 | 107 |
| 394 | 3300005617 | Ga0068859_100304497 | Ga0068859_1003044973 | 107 |
| 395 | 3300005617 | Ga0068859_100391782 | Ga0068859_1003917822 | 107 |
| 396 | 3300005617 | Ga0068859_100701645 | Ga0068859_1007016452 | 107 |
| 397 | 3300005617 | Ga0068859_101673465 | Ga0068859_1016734652 | 107 |
| 398 | 3300005841 | Ga0068863_101029225 | Ga0068863_1010292251 | 107 |
| 399 | 3300005841 | Ga0068863_102328343 | Ga0068863_1023283431 | 107 |
| 400 | 3300005844 | Ga0068862_100918207 | Ga0068862_1009182072 | 107 |
| 401 | 3300005844 | Ga0068862_102492818 | Ga0068862_1024928182 | 107 |
| 402 | 3300005937 | Ga0081455_10468211 | Ga0081455_104682112 | 107 |
| 403 | 3300006038 | Ga0075365_10330246 | Ga0075365_103302461 | 107 |
| 404 | 3300006173 | Ga0070716_100018531 | Ga0070716_1000185313 | 107 |
| 405 | 3300006175 | Ga0070712_100083329 | Ga0070712_1000833293 | 107 |
| 406 | 3300006175 | Ga0070712_100092787 | Ga0070712_1000927873 | 107 |
| 407 | 3300006175 | Ga0070712_100411240 | Ga0070712_1004112401 | 107 |
| 408 | 3300006175 | Ga0070712_101795898 | Ga0070712_1017958982 | 107 |
| 409 | 3300006178 | Ga0075367_10663820 | Ga0075367_106638202 | 107 |
| 410 | 3300006237 | Ga0097621_100139737 | Ga0097621_1001397373 | 107 |
| 411 | 3300006358 | Ga0068871_100014643 | Ga0068871_1000146437 | 107 |
| 412 | 3300006844 | Ga0075428_100125665 | Ga0075428_1001256654 | 107 |
| 413 | 3300006844 | Ga0075428_102366264 | Ga0075428_1023662642 | 107 |
| 414 | 3300006852 | Ga0075433_10688767 | Ga0075433_106887672 | 107 |
| 415 | 3300006852 | Ga0075433_10746275 | Ga0075433_107462752 | 107 |
| 416 | 3300006852 | Ga0075433_10802231 | Ga0075433_108022312 | 107 |
| 417 | 3300006871 | Ga0075434_100216644 | Ga0075434_1002166443 | 107 |
| 418 | 3300006871 | Ga0075434_100558606 | Ga0075434_1005586062 | 107 |
| 419 | 3300006871 | Ga0075434_101706856 | Ga0075434_1017068562 | 107 |
| 420 | 3300006871 | Ga0075434_102415158 | Ga0075434_1024151581 | 107 |
| 421 | 3300006914 | Ga0075436_100064655 | Ga0075436_1000646553 | 107 |
| 422 | 3300006914 | Ga0075436_100238498 | Ga0075436_1002384983 | 107 |
| 423 | 3300006931 | Ga0097620_100000046 | Ga0097620_10000004665 | 107 |
| 424 | 3300006931 | Ga0097620_100304532 | Ga0097620_1003045323 | 107 |
| 425 | 3300006931 | Ga0097620_100391765 | Ga0097620_1003917652 | 107 |
| 426 | 3300006931 | Ga0097620_100701673 | Ga0097620_1007016732 | 107 |
| 427 | 3300006931 | Ga0097620_101673240 | Ga0097620_1016732402 | 107 |
| 428 | 3300007076 | Ga0075435_100290010 | Ga0075435_1002900101 | 107 |
| 429 | 3300007076 | Ga0075435_100308590 | Ga0075435_1003085902 | 107 |
| 430 | 3300009093 | Ga0105240_10019513 | Ga0105240_100195132 | 107 |
| 431 | 3300009094 | Ga0111539_12523086 | Ga0111539_125230862 | 107 |
| 432 | 3300009147 | Ga0114129_10223701 | Ga0114129_102237013 | 107 |
| 433 | 3300009147 | Ga0114129_11648250 | Ga0114129_116482502 | 107 |
| 434 | 3300009147 | Ga0114129_12542384 | Ga0114129_125423842 | 107 |
| 435 | 3300009147 | Ga0114129_13223032 | Ga0114129_132230322 | 107 |
| 436 | 3300009148 | Ga0105243_11384659 | Ga0105243_113846591 | 107 |
| 437 | 3300009174 | Ga0105241_10084903 | Ga0105241_100849033 | 107 |
| 438 | 3300009176 | Ga0105242_10685628 | Ga0105242_106856283 | 107 |
| 439 | 3300009551 | Ga0105238_11096211 | Ga0105238_110962112 | 107 |
| 440 | 3300010375 | Ga0105239_10125152 | Ga0105239_101251523 | 107 |
| 441 | 3300011119 | Ga0105246_10033873 | Ga0105246_100338732 | 107 |
| 442 | 3300011119 | Ga0105246_11763104 | Ga0105246_117631041 | 107 |
| 443 | 3300013100 | Ga0157373_10000982 | Ga0157373_1000098212 | 107 |
| 444 | 3300013102 | Ga0157371_10205741 | Ga0157371_102057413 | 107 |
| 445 | 3300013104 | Ga0157370_10006370 | Ga0157370_100063704 | 107 |
| 446 | 3300013297 | Ga0157378_11303248 | Ga0157378_113032481 | 107 |
| 447 | 3300013307 | Ga0157372_10053589 | Ga0157372_100535892 | 107 |
| 448 | 3300013308 | Ga0157375_12274491 | Ga0157375_122744912 | 107 |
| 449 | 3300014325 | Ga0163163_10308808 | Ga0163163_103088082 | 107 |
| 450 | 3300021358 | Ga0213873_10308738 | Ga0213873_103087382 | 107 |
| 451 | 3300021384 | Ga0213876_10000458 | Ga0213876_100004584 | 107 |
| 452 | 3300025207 | Ga0209760_100894 | Ga0209760_1008943 | 107 |
| 453 | 3300025224 | Ga0209784_100004 | Ga0209784_1000041185 | 107 |
| 454 | 3300025225 | Ga0209566_100004 | Ga0209566_1000041342 | 107 |
| 455 | 3300025226 | Ga0209674_100006 | Ga0209674_1000061342 | 107 |
| 456 | 3300025230 | Ga0209563_100009 | Ga0209563_1000091185 | 107 |
| 457 | 3300025231 | Ga0207427_100699 | Ga0207427_10069913 | 107 |
| 458 | 3300025231 | Ga0207427_100768 | Ga0207427_10076816 | 107 |
| 459 | 3300025233 | Ga0209437_100004 | Ga0209437_1000041185 | 107 |
| 460 | 3300025233 | Ga0209437_100228 | Ga0209437_1002288 | 107 |
| 461 | 3300025250 | Ga0209026_1003441 | Ga0209026_10034415 | 107 |
| 462 | 3300025253 | Ga0209677_100005 | Ga0209677_1000051185 | 107 |
| 463 | 3300025254 | Ga0209148_1000005 | Ga0209148_1000005814 | 107 |
| 464 | 3300025261 | Ga0209233_1000005 | Ga0209233_10000051342 | 107 |
| 465 | 3300025261 | Ga0209233_1006577 | Ga0209233_10065773 | 107 |
| 466 | 3300025885 | Ga0207653_10000047 | Ga0207653_1000004721 | 107 |
| 467 | 3300025885 | Ga0207653_10230099 | Ga0207653_102300992 | 107 |
| 468 | 3300025898 | Ga0207692_10446960 | Ga0207692_104469602 | 107 |
| 469 | 3300025898 | Ga0207692_10643200 | Ga0207692_106432001 | 107 |
| 470 | 3300025900 | Ga0207710_10000004 | Ga0207710_10000004105 | 107 |
| 471 | 3300025906 | Ga0207699_10203582 | Ga0207699_102035822 | 107 |
| 472 | 3300025909 | Ga0207705_10113411 | Ga0207705_101134113 | 107 |
| 473 | 3300025910 | Ga0207684_10001536 | Ga0207684_1000153617 | 107 |
| 474 | 3300025910 | Ga0207684_10011559 | Ga0207684_100115591 | 107 |
| 475 | 3300025910 | Ga0207684_10222783 | Ga0207684_102227832 | 107 |
| 476 | 3300025910 | Ga0207684_10858724 | Ga0207684_108587242 | 107 |
| 477 | 3300025915 | Ga0207693_10171851 | Ga0207693_101718513 | 107 |
| 478 | 3300025915 | Ga0207693_10222704 | Ga0207693_102227043 | 107 |
| 479 | 3300025915 | Ga0207693_10802918 | Ga0207693_108029182 | 107 |
| 480 | 3300025916 | Ga0207663_10436040 | Ga0207663_104360402 | 107 |
| 481 | 3300025917 | Ga0207660_10565813 | Ga0207660_105658131 | 107 |
| 482 | 3300025918 | Ga0207662_10068994 | Ga0207662_100689942 | 107 |
| 483 | 3300025921 | Ga0207652_10286648 | Ga0207652_102866482 | 107 |
| 484 | 3300025922 | Ga0207646_10066305 | Ga0207646_100663053 | 107 |
| 485 | 3300025922 | Ga0207646_10200046 | Ga0207646_102000463 | 107 |
| 486 | 3300025922 | Ga0207646_11289967 | Ga0207646_112899672 | 107 |
| 487 | 3300025923 | Ga0207681_10000110 | Ga0207681_1000011016 | 107 |
| 488 | 3300025925 | Ga0207650_10035327 | Ga0207650_100353273 | 107 |
| 489 | 3300025925 | Ga0207650_11612067 | Ga0207650_116120671 | 107 |
| 490 | 3300025928 | Ga0207700_10682646 | Ga0207700_106826462 | 107 |
| 491 | 3300025929 | Ga0207664_10518014 | Ga0207664_105180142 | 107 |
| 492 | 3300025929 | Ga0207664_11117009 | Ga0207664_111170092 | 107 |
| 493 | 3300025931 | Ga0207644_10002425 | Ga0207644_100024254 | 107 |
| 494 | 3300025934 | Ga0207686_10575050 | Ga0207686_105750502 | 107 |
| 495 | 3300025937 | Ga0207669_11048466 | Ga0207669_110484661 | 107 |
| 496 | 3300025939 | Ga0207665_10002211 | Ga0207665_100022116 | 107 |
| 497 | 3300025940 | Ga0207691_10660462 | Ga0207691_106604621 | 107 |
| 498 | 3300025941 | Ga0207711_10327137 | Ga0207711_103271372 | 107 |
| 499 | 3300025942 | Ga0207689_10420880 | Ga0207689_104208802 | 107 |
| 500 | 3300025942 | Ga0207689_10648309 | Ga0207689_106483092 | 107 |
| 501 | 3300025960 | Ga0207651_10427614 | Ga0207651_104276142 | 107 |
| 502 | 3300025981 | Ga0207640_10693592 | Ga0207640_106935922 | 107 |
| 503 | 3300025986 | Ga0207658_10056487 | Ga0207658_100564873 | 107 |
| 504 | 3300026023 | Ga0207677_10465063 | Ga0207677_104650633 | 107 |
| 505 | 3300026023 | Ga0207677_11114831 | Ga0207677_111148312 | 107 |
| 506 | 3300026067 | Ga0207678_11778088 | Ga0207678_117780882 | 107 |
| 507 | 3300026075 | Ga0207708_10064775 | Ga0207708_100647755 | 107 |
| 508 | 3300026075 | Ga0207708_10222027 | Ga0207708_102220272 | 107 |
| 509 | 3300026088 | Ga0207641_10503382 | Ga0207641_105033823 | 107 |
| 510 | 3300026088 | Ga0207641_12244409 | Ga0207641_122444091 | 107 |
| 511 | 3300026095 | Ga0207676_10535770 | Ga0207676_105357702 | 107 |
| 512 | 3300026142 | Ga0207698_10403005 | Ga0207698_104030052 | 107 |
| 513 | 3300028379 | Ga0268266_10000001 | Ga0268266_100000011238 | 107 |
| 514 | 3300028379 | Ga0268266_10000252 | Ga0268266_1000025256 | 107 |
| 515 | 3300028794 | Ga0307515_10158966 | Ga0307515_101589662 | 107 |
| 516 | 3300028800 | Ga0265338_10000016 | Ga0265338_10000016121 | 107 |
| 517 | 3300028800 | Ga0265338_11016878 | Ga0265338_110168782 | 107 |
| 518 | 3300030731 | Ga0316177_1164940 | Ga0316177_11649403 | 107 |
| 519 | 3300030736 | Ga0316180_1010538 | Ga0316180_10105382 | 107 |
| 520 | 3300030745 | Ga0316182_1171846 | Ga0316182_11718462 | 107 |
| 521 | 3300030745 | Ga0316182_1276313 | Ga0316182_12763133 | 107 |
| 522 | 3300031241 | Ga0265325_10008493 | Ga0265325_100084933 | 107 |
| 523 | 3300031241 | Ga0265325_10491617 | Ga0265325_104916171 | 107 |
| 524 | 3300031548 | Ga0307408_100006007 | Ga0307408_1000060076 | 107 |
| 525 | 3300031691 | Ga0316579_10318330 | Ga0316579_103183302 | 107 |
| 526 | 3300031727 | Ga0316576_10327990 | Ga0316576_103279902 | 107 |
| 527 | 3300031727 | Ga0316576_10957124 | Ga0316576_109571242 | 107 |
| 528 | 3300031731 | Ga0307405_10023447 | Ga0307405_100234475 | 107 |
| 529 | 3300031731 | Ga0307405_10710433 | Ga0307405_107104332 | 107 |
| 530 | 3300031852 | Ga0307410_10009883 | Ga0307410_100098832 | 107 |
| 531 | 3300031901 | Ga0307406_10022338 | Ga0307406_100223383 | 107 |
| 532 | 3300031903 | Ga0307407_10257659 | Ga0307407_102576592 | 107 |
| 533 | 3300031911 | Ga0307412_10058787 | Ga0307412_100587873 | 107 |
| 534 | 3300031995 | Ga0307409_100288644 | Ga0307409_1002886443 | 107 |
| 535 | 3300032002 | Ga0307416_100016556 | Ga0307416_1000165563 | 107 |
| 536 | 3300032004 | Ga0307414_10006929 | Ga0307414_100069293 | 107 |
| 537 | 3300032004 | Ga0307414_10104660 | Ga0307414_101046603 | 107 |
| 538 | 3300032005 | Ga0307411_10359936 | Ga0307411_103599362 | 107 |
| 539 | 3300032126 | Ga0307415_100005575 | Ga0307415_1000055756 | 107 |
| 540 | 3300033179 | Ga0307507_10465604 | Ga0307507_104656042 | 107 |
| 541 | 3300034820 | Ga0373959_0182950 | Ga0373959_0182950_122_445 | 107 |
| 542 | 3300035086 | Ga0373934_0001012 | Ga0373934_0001012_5472_5795 | 107 |
| 543 | 3300035091 | Ga0373951_0133263 | Ga0373951_0133263_336_659 | 107 |
| 544 | 3300035114 | Ga0373939_0044604 | Ga0373939_0044604_573_896 | 107 |
| 545 | 3300035115 | Ga0373941_0029730 | Ga0373941_0029730_868_1191 | 107 |
| 546 | 3300035118 | Ga0373954_0124634 | Ga0373954_0124634_484_807 | 107 |
| 547 | 3300035170 | Ga0373943_0072420 | Ga0373943_0072420_99_422 | 107 |
| 548 | 3300035172 | Ga0373955_0027178 | Ga0373955_0027178_159_482 | 107 |
| 549 | 3300035410 | Ga0373924_0009892 | Ga0373924_0009892_2952_3275 | 107 |
| 550 | 3300035691 | Ga0373931_0980338 | Ga0373931_0980338_125_448 | 107 |
| 551 | 3300035724 | Ga0373933_0084023 | Ga0373933_0084023_1134_1457 | 107 |
| 552 | 3300036401 | Ga0373937_0004880 | Ga0373937_0004880_4018_4341 | 107 |
| 553 | 3300036647 | Ga0316582_0172665 | Ga0316582_0172665_949_1272 | 107 |
| 554 | 3300037418 | Ga0395900_1527960 | Ga0395900_1527960_209_532 | 107 |
| 555 | 3300037466 | Ga0395898_0084064 | Ga0395898_0084064_2570_2893 | 107 |
| 556 | 3300039437 | Ga0436365_1291084 | Ga0436365_1291084_162805_163128 | 107 |
| 557 | 3300039453 | Ga0436362_0502872 | Ga0436362_0502872_380_703 | 107 |
| 558 | 3300041408 | Ga0439453_0126544 | Ga0439453_0126544_64_402 | 107 |
| 559 | 3300042004 | Ga0439445_0021844 | Ga0439445_0021844_1215_1538 | 107 |
| 560 | 3300042436 | Ga0439435_0054705 | Ga0439435_0054705_656_994 | 107 |
| 561 | 3300042876 | Ga0451577_0976734 | Ga0451577_0976734_39_362 | 107 |
| 562 | 3300044656 | Ga0466969_0079064 | Ga0466969_0079064_336_659 | 107 |
| 563 | 3300044673 | Ga0453683_0265079 | Ga0453683_0265079_487_810 | 107 |
| 564 | 3300044673 | Ga0453683_0534414 | Ga0453683_0534414_409_732 | 107 |
| 565 | 3300044706 | Ga0466964_0022281 | Ga0466964_0022281_888_1211 | 107 |
| 566 | 3300044712 | Ga0453684_1383091 | Ga0453684_1383091_133_456 | 107 |
| 567 | 3300044901 | Ga0466960_0047547 | Ga0466960_0047547_45_368 | 107 |
| 568 | 3300044901 | Ga0466960_0910732 | Ga0466960_0910732_124_447 | 107 |
| 569 | 3300045051 | Ga0451576_0000115 | Ga0451576_0000115_57115_57438 | 107 |
| 570 | 3300046454 | Ga0495592_0825278 | Ga0495592_0825278_171_494 | 107 |
| 571 | 3300046460 | Ga0495638_0000076 | Ga0495638_0000076_65423_65746 | 107 |
| 572 | 3300046471 | Ga0495650_0000150 | Ga0495650_0000150_31652_31975 | 107 |
| 573 | 3300046477 | Ga0495664_0408761 | Ga0495664_0408761_209_532 | 107 |
| 574 | 3300046512 | Ga0495610_0259474 | Ga0495610_0259474_131_454 | 107 |
| 575 | 3300046529 | Ga0495652_0321354 | Ga0495652_0321354_539_862 | 107 |
| 576 | 3300048903 | Ga0496100_0544462 | Ga0496100_0544462_233_556 | 107 |
| 577 | 3300048904 | Ga0496101_0128035 | Ga0496101_0128035_731_1054 | 107 |
| 578 | 3300048907 | Ga0496104_0304533 | Ga0496104_0304533_546_869 | 107 |
| 579 | 3300048908 | Ga0496105_0226104 | Ga0496105_0226104_419_742 | 107 |
| 580 | 3300048909 | Ga0496106_0406971 | Ga0496106_0406971_347_670 | 107 |
| 581 | 3300048910 | Ga0496107_0949561 | Ga0496107_0949561_34_357 | 107 |
| 582 | 3300048912 | Ga0496109_0967385 | Ga0496109_0967385_156_479 | 107 |
| 583 | 3300048915 | Ga0496112_0022373 | Ga0496112_0022373_3104_3427 | 107 |
| 584 | 3300048917 | Ga0496114_0113391 | Ga0496114_0113391_603_926 | 107 |
| 585 | 3300048918 | Ga0496115_0006331 | Ga0496115_0006331_6930_7253 | 107 |
| 586 | 3300049572 | Ga0501036_0244589 | Ga0501036_0244589_652_975 | 107 |
| 587 | 3300049582 | Ga0501048_1120313 | Ga0501048_1120313_55_378 | 107 |
| 588 | 3300049652 | Ga0501202_000507 | Ga0501202_000507_1151_1474 | 107 |
| 589 | 3300049660 | Ga0501216_013641 | Ga0501216_013641_901_1224 | 107 |
| 590 | 3300049661 | Ga0501217_002038 | Ga0501217_002038_453_776 | 107 |
| 591 | 3300049668 | Ga0501233_005464 | Ga0501233_005464_1527_1850 | 107 |
| 592 | 3300049670 | Ga0501236_039850 | Ga0501236_039850_373_696 | 107 |
| 593 | 3300049673 | Ga0501240_036607 | Ga0501240_036607_281_604 | 107 |
| 594 | 3300049680 | Ga0501250_077792 | Ga0501250_077792_91_414 | 107 |
| 595 | 3300049706 | Ga0501229_008713 | Ga0501229_008713_29_352 | 107 |
| 596 | 3300049707 | Ga0501234_001766 | Ga0501234_001766_281_604 | 107 |
| 597 | 3300049770 | Ga0501273_005459 | Ga0501273_005459_519_842 | 107 |
| 598 | 3300049822 | Ga0501035_0506827 | Ga0501035_0506827_533_856 | 107 |
| 599 | 3300049850 | Ga0501204_011255 | Ga0501204_011255_379_702 | 107 |
| 600 | 3300049851 | Ga0501212_109032 | Ga0501212_109032_46_369 | 107 |
| 601 | 3300050507 | nmdc:mga05p37_1074328_c1 | nmdc:mga05p37_1074328_c1_35_358 | 107 |
| 602 | 3300050507 | nmdc:mga05p37_197678_c1 | nmdc:mga05p37_197678_c1_32_355 | 107 |
| 603 | 3300050508 | nmdc:mga09592_1066814_c1 | nmdc:mga09592_1066814_c1_35_358 | 107 |
| 604 | 3300050512 | nmdc:mga0n895_120857_c1 | nmdc:mga0n895_120857_c1_630_953 | 107 |
| 605 | 3300050512 | nmdc:mga0n895_2027102_c1 | nmdc:mga0n895_2027102_c1_140_463 | 107 |
| 606 | 3300050512 | nmdc:mga0n895_737118_c1 | nmdc:mga0n895_737118_c1_107_430 | 107 |
| 607 | 3300050514 | nmdc:mga08x19_314442_c1 | nmdc:mga08x19_314442_c1_36_359 | 107 |
| 608 | 3300050515 | nmdc:mga0a205_147027_c1 | nmdc:mga0a205_147027_c1_594_917 | 107 |
| 609 | 3300050515 | nmdc:mga0a205_295924_c1 | nmdc:mga0a205_295924_c1_489_812 | 107 |
| 610 | 3300050515 | nmdc:mga0a205_776747_c1 | nmdc:mga0a205_776747_c1_440_763 | 107 |
| 611 | 3300050515 | nmdc:mga0a205_888485_c1 | nmdc:mga0a205_888485_c1_139_462 | 107 |
| 612 | 3300053077 | Ga0495601_0575432 | Ga0495601_0575432_45_368 | 107 |
| 613 | 3300053093 | Ga0500651_0023045 | Ga0500651_0023045_1916_2239 | 107 |
| 614 | 3300053103 | Ga0500555_021500 | Ga0500555_021500_332_655 | 107 |
| 615 | 3300061734 | Ga0530510_0309470 | Ga0530510_0309470_729_1052 | 107 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4ku0-assembly1.cif.gz_D | enterobacteria phage t4 gp5.4 paar repeat protein in complex with t4 gp5 beta-helix fragment | 0.7024 | 4 | 103 |
| 4jiw-assembly3.cif.gz_L | c1882 paar-repeat protein from escherichia coli in complex with a vgrg-like beta-helix that is based on a fragment of t4 gp5 | 0.7014 | 4 | 101 |
| 4jiw-assembly3.cif.gz_L | c1882 paar-repeat protein from escherichia coli in complex with a vgrg-like beta-helix that is based on a fragment of t4 gp5 | 0.6707 | 4 | 101 |
| 4ku0-assembly1.cif.gz_D | enterobacteria phage t4 gp5.4 paar repeat protein in complex with t4 gp5 beta-helix fragment | 0.6662 | 4 | 103 |
| 4jiv-assembly1.cif.gz_D | vca0105 paar-repeat protein from vibrio cholerae in complex with a vgrg-like beta-helix that is based on a fragment of t4 gp5 | 0.6556 | 1 | 101 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4ku0D00 | Mainly Beta;Sandwich;Tumour Suppressor Smad4; | 0.7024 | 4 | 103 | 2.60.200.60 |
| 4jiwP00 | Mainly Beta;Sandwich;Tumour Suppressor Smad4; | 0.6911 | 4 | 101 | 2.60.200.60 |
| 4ku0D00 | Mainly Beta;Sandwich;Tumour Suppressor Smad4; | 0.6662 | 4 | 103 | 2.60.200.60 |
| 4jiwP00 | Mainly Beta;Sandwich;Tumour Suppressor Smad4; | 0.6606 | 4 | 101 | 2.60.200.60 |
| af_M9PG15_444_630_3.40.1110.10 | Alpha Beta;3-Layer(aba) Sandwich;Calcium-transporting ATPase, cytoplasmic domain N;Calcium-transporting ATPase, cytoplasmic domain N | 0.5533 | 4 | 50 | 3.40.1110.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3C1QG25-F1-model_v4 | deleted | 0.9811 | 13 | 104 |
|
| AF-A0A177NR14-F1-model_v4 | DUF4280 domain-containing protein | 0.9807 | 1 | 107 |
|
| AF-A0A7W1R643-F1-model_v4 | DUF4280 domain-containing protein | 0.9757 | 1 | 107 |
|
| AF-A0A7C9GRM5-F1-model_v4 | DUF4280 domain-containing protein | 0.9752 | 1 | 107 |
|
| AF-A0A0Q8MG94-F1-model_v4 | Uncharacterized protein | 0.97 | 1 | 107 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar