F469459

General Info

Members Datasets Scaffolds Average Seq Length
615 345 610 103

Family's Representative Sequence

Representative Sequence 3300041408|Ga0439453_0126544|Ga0439453_0126544_64_402
Length 112
Sequence LKEFHMPGFLLHVGATVLCSHAGQAQPTVPNPRVTVMGQPTVAITSPYVVAGCAMPPPIAGNGPCVTAQFVTSATRVLSNGQPLLLLDSQAICVPTGTPLMIVITQTRASAI

Samples

Sample ID Description Type Environment
1 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
2 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
3 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
4 2928963466 Dyella japonica 1073 Isolate Unclassified
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
7 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
8 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
9 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
10 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
11 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
12 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
13 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
14 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
15 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
16 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
17 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
18 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
19 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
20 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
21 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
22 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
23 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
32 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
40 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
41 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
42 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
43 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
44 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
45 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
46 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
47 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
48 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
49 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
50 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
51 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
52 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
53 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
54 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
55 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
56 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
57 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
58 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
59 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
60 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
61 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
62 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
63 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
64 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
65 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
66 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
67 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
68 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
69 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
70 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
71 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
72 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
73 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
74 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
75 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
76 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
77 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
78 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
79 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
80 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
81 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
82 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
83 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
84 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
85 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
86 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
87 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
88 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
89 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
90 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
91 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
93 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
94 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
95 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
96 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
97 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
98 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
99 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
101 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
102 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
104 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
106 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
107 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
108 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
109 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
110 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
111 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
112 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
113 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
114 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
115 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
116 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
117 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
118 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
119 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
120 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
121 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
122 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
123 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
124 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
125 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
126 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
127 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
128 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
129 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
130 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
136 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
137 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
139 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
142 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
196 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
197 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
198 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
199 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
200 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
201 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
202 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
203 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
204 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
205 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
206 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
207 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
208 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
209 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
210 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
211 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
212 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
213 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
214 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
215 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
216 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
217 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
218 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
219 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
220 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
221 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
222 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
223 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
224 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
225 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
226 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
227 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
228 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
229 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
230 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
231 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
232 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
233 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
234 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
235 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
236 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
237 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
238 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
239 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
240 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
241 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
242 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
243 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
244 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
245 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
246 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
247 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
248 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
249 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
250 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
251 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
252 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
253 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
254 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
255 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
256 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
257 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
258 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
259 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
260 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
261 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
262 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
263 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
264 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
265 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
266 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
267 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
268 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
269 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
270 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
271 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
272 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
273 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
274 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
275 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
276 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
277 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
278 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
279 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
280 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
281 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
282 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
283 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
284 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
285 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
286 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
287 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
288 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
289 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
290 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
291 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
292 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
293 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
294 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
295 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
302 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
305 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
306 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
307 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
308 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
309 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
310 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
311 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
312 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
313 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
314 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
315 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
316 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
317 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
318 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
319 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
320 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
321 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
322 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
323 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
324 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
325 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
326 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
327 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
328 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
329 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
330 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
331 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
332 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
333 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
334 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
335 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
336 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
337 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
338 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
339 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
340 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
341 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
342 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
343 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
344 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
345 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.35
Metatranscriptomes 0
Isolates 0.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.5
Nodule 0
Rhizoplane 2.44
Rhizosphere 88.13
Stem 0
Stem Tuber 0
Unclassified 2.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10067983 3300001989 Bacteria 1113
2 JGI24748J21848_1000002 3300002074 Bacteria 426946
3 JGI24034J26672_10000004 3300002239 Bacteria 426946
4 JGI25162J39368_1000021 3300002737 Bacteria 248155
5 JGI25157J39369_1014950 3300002741 Bacteria 959
6 JGI25163J39215_1007283 3300002771 Bacteria 624
7 JGI25165J46597_1000049 3300003214 Bacteria 248154
8 rootH1_10043042 3300003316 Bacteria 5272
9 rootH1_10118134 3300003316 Bacteria 1527
10 rootH2_10001362 3300003320 Bacteria 52723
11 rootH2_10256832 3300003320 Unclassified 1932
12 rootL2_10009982 3300003322 Bacteria 12131
13 rootL2_10038767 3300003322 Bacteria 14897
14 rootL2_10257985 3300003322 Unclassified 2208
15 Ga0055538_1000023 3300003751 Bacteria 248154
16 Ga0055539_1000030 3300003752 Bacteria 248154
17 Ga0055533_1000039 3300003756 Bacteria 248154
18 Ga0055533_1005338 3300003756 Bacteria 2082
19 Ga0055525_1000048 3300003759 Bacteria 248154
20 Ga0055525_1000207 3300003759 Bacteria 66980
21 Ga0055527_1000108 3300003760 Bacteria 59457
22 Ga0055535_1000646 3300003761 Bacteria 27765
23 Ga0055542_1000223 3300003762 Bacteria 68138
24 Ga0055542_1000447 3300003762 Bacteria 39214
25 Ga0055529_1000603 3300003763 Bacteria 27759
26 Ga0055541_1000021 3300003841 Bacteria 248154
27 Ga0070658_10011873 3300005327 Bacteria 6995
28 Ga0070658_10023784 3300005327 Bacteria 4914
29 Ga0070658_10155143 3300005327 Bacteria 1919
30 Ga0070670_100018852 3300005331 Bacteria 5917
31 Ga0070670_100029904 3300005331 Bacteria 4691
32 Ga0070670_100667457 3300005331 Bacteria 933
33 Ga0070670_101719437 3300005331 Unclassified 577
34 Ga0070670_101948063 3300005331 Bacteria 541
35 Ga0068869_100113390 3300005334 Unclassified 2065
36 Ga0068869_100498475 3300005334 Bacteria 1016
37 Ga0068869_100869545 3300005334 Bacteria 779
38 Ga0068869_101194413 3300005334 Unclassified 668
39 Ga0068869_101216558 3300005334 Unclassified 662
40 Ga0070680_100920761 3300005336 Bacteria 754
41 Ga0070682_100350214 3300005337 Bacteria 1101
42 Ga0068868_100094624 3300005338 Bacteria 2410
43 Ga0068868_100835553 3300005338 Unclassified 833
44 Ga0070689_100388737 3300005340 Bacteria 1177
45 Ga0070689_100780134 3300005340 Bacteria 839
46 Ga0070687_100120130 3300005343 Bacteria 1502
47 Ga0070692_10023635 3300005345 Unclassified 3013
48 Ga0070692_10230000 3300005345 Unclassified 1100
49 Ga0070692_11395584 3300005345 Unclassified 506
50 Ga0070669_100000019 3300005353 Bacteria 186509
51 Ga0070669_100048363 3300005353 Unclassified 3104
52 Ga0070669_101171723 3300005353 Bacteria 663
53 Ga0070669_101324743 3300005353 Unclassified 624
54 Ga0070675_100647377 3300005354 Unclassified 960
55 Ga0070671_100046913 3300005355 Bacteria 3593
56 Ga0070671_100312201 3300005355 Bacteria 1339
57 Ga0070673_100866591 3300005364 Bacteria 836
58 Ga0070673_101330275 3300005364 Bacteria 675
59 Ga0070688_101058548 3300005365 Bacteria 647
60 Ga0070667_100019678 3300005367 Bacteria 5600
61 Ga0070703_10000028 3300005406 Bacteria 70844
62 Ga0070703_10142371 3300005406 Unclassified 892
63 Ga0070709_10370028 3300005434 Bacteria 1063
64 Ga0070714_100078810 3300005435 Bacteria 2864
65 Ga0070714_100303404 3300005435 Bacteria 1489
66 Ga0070713_100009503 3300005436 Bacteria 6966
67 Ga0070713_101747329 3300005436 Bacteria 604
68 Ga0070710_10028354 3300005437 Bacteria 2994
69 Ga0070710_10940413 3300005437 Unclassified 626
70 Ga0070701_10188807 3300005438 Unclassified 1211
71 Ga0070701_10310877 3300005438 Bacteria 972
72 Ga0070711_100394796 3300005439 Bacteria 1121
73 Ga0070711_101911771 3300005439 Unclassified 521
74 Ga0070705_100000368 3300005440 Bacteria 26424
75 Ga0070705_100109133 3300005440 Bacteria 1764
76 Ga0070705_100229134 3300005440 Bacteria 1291
77 Ga0070705_100386094 3300005440 Unclassified 1032
78 Ga0070705_101143903 3300005440 Unclassified 639
79 Ga0070700_100000193 3300005441 Bacteria 34477
80 Ga0070700_100006039 3300005441 Bacteria 6448
81 Ga0070700_100587338 3300005441 Unclassified 871
82 Ga0070700_100639519 3300005441 Bacteria 839
83 Ga0070694_100241404 3300005444 Bacteria 1363
84 Ga0070694_100297183 3300005444 Bacteria 1236
85 Ga0070708_100000237 3300005445 Bacteria 40825
86 Ga0070708_100001158 3300005445 Bacteria 20294
87 Ga0070708_100031387 3300005445 Bacteria 4598
88 Ga0070708_100999912 3300005445 Unclassified 784
89 Ga0070663_100006820 3300005455 Bacteria 6906
90 Ga0070663_101348698 3300005455 Bacteria 630
91 Ga0070678_100101308 3300005456 Bacteria 2232
92 Ga0070662_100005929 3300005457 Bacteria 7839
93 Ga0070662_101830964 3300005457 Unclassified 524
94 Ga0070681_10175666 3300005458 Bacteria 2064
95 Ga0070681_10294969 3300005458 Unclassified 1531
96 Ga0070681_10375680 3300005458 Bacteria 1332
97 Ga0070685_10150822 3300005466 Bacteria 1473
98 Ga0070685_10281317 3300005466 Bacteria 1114
99 Ga0070685_10334027 3300005466 Bacteria 1031
100 Ga0070706_100001593 3300005467 Bacteria 23652
101 Ga0070706_100004834 3300005467 Bacteria 12903
102 Ga0070706_100253436 3300005467 Bacteria 1643
103 Ga0070706_100386337 3300005467 Bacteria 1303
104 Ga0070706_100711661 3300005467 Bacteria 931
105 Ga0070706_100932334 3300005467 Unclassified 802
106 Ga0070706_101296460 3300005467 Bacteria 668
107 Ga0070707_100034782 3300005468 Bacteria 4805
108 Ga0070707_100549387 3300005468 Bacteria 1117
109 Ga0070707_101452765 3300005468 Bacteria 652
110 Ga0070698_100001354 3300005471 Bacteria 27238
111 Ga0070698_100065472 3300005471 Bacteria 3659
112 Ga0070698_100067512 3300005471 Bacteria 3596
113 Ga0070698_100211259 3300005471 Bacteria 1875
114 Ga0070698_101012541 3300005471 Unclassified 778
115 Ga0070698_101845943 3300005471 Bacteria 557
116 Ga0070699_100171861 3300005518 Unclassified 1920
117 Ga0070699_100290033 3300005518 Bacteria 1467
118 Ga0070699_100728702 3300005518 Bacteria 906
119 Ga0070679_100294754 3300005530 Bacteria 1573
120 Ga0070679_101888298 3300005530 Bacteria 546
121 Ga0070684_101406144 3300005535 Bacteria 657
122 Ga0070697_100000140 3300005536 Bacteria 58765
123 Ga0070697_100137905 3300005536 Bacteria 2049
124 Ga0068853_100193419 3300005539 Bacteria 1849
125 Ga0070672_100725387 3300005543 Bacteria 871
126 Ga0070672_100848305 3300005543 Bacteria 805
127 Ga0070695_100050977 3300005545 Bacteria 2654
128 Ga0070695_100128826 3300005545 Bacteria 1742
129 Ga0070696_100706402 3300005546 Bacteria 822
130 Ga0070693_100358456 3300005547 Bacteria 1000
131 Ga0070665_100000026 3300005548 Bacteria 365176
132 Ga0070665_100000365 3300005548 Bacteria 67635
133 Ga0070704_100017412 3300005549 Unclassified 4570
134 Ga0070704_100067136 3300005549 Bacteria 2589
135 Ga0070704_101693233 3300005549 Bacteria 584
136 Ga0068855_100000148 3300005563 Bacteria 89300
137 Ga0070664_100295325 3300005564 Bacteria 1463
138 Ga0068857_100312327 3300005577 Unclassified 1450
139 Ga0068857_102147862 3300005577 Unclassified 548
140 Ga0068854_100000527 3300005578 Bacteria 23195
141 Ga0068854_100014355 3300005578 Bacteria 5220
142 Ga0068854_100076177 3300005578 Bacteria 2465
143 Ga0068854_101324508 3300005578 Unclassified 649
144 Ga0068856_100114766 3300005614 Bacteria 2693
145 Ga0068856_102526820 3300005614 Bacteria 520
146 Ga0070702_100007398 3300005615 Bacteria 5257
147 Ga0070702_100685652 3300005615 Bacteria 779
148 Ga0070702_100704121 3300005615 Unclassified 770
149 Ga0070702_100756469 3300005615 Bacteria 747
150 Ga0068852_100218565 3300005616 Viruses 1811
151 Ga0068852_100328066 3300005616 Bacteria 1488
152 Ga0068852_100957396 3300005616 Bacteria 874
153 Ga0068859_100000046 3300005617 Bacteria 142733
154 Ga0068859_100003211 3300005617 Bacteria 16645
155 Ga0068859_100011283 3300005617 Bacteria 8991
156 Ga0068859_100014042 3300005617 Bacteria 8031
157 Ga0068859_100084432 3300005617 Bacteria 3221
158 Ga0068859_100304497 3300005617 Unclassified 1687
159 Ga0068859_100391782 3300005617 Bacteria 1485
160 Ga0068859_100701645 3300005617 Bacteria 1103
161 Ga0068859_101383415 3300005617 Bacteria 776
162 Ga0068859_101673465 3300005617 Bacteria 703
163 Ga0068864_100001094 3300005618 Bacteria 22718
164 Ga0068864_100052563 3300005618 Bacteria 3512
165 Ga0068864_100122958 3300005618 Bacteria 2323
166 Ga0068866_10054750 3300005718 Bacteria 2045
167 Ga0068861_100126977 3300005719 Unclassified 2065
168 Ga0068861_100517884 3300005719 Bacteria 1081
169 Ga0068870_10001396 3300005840 Bacteria 9746
170 Ga0068870_10401408 3300005840 Bacteria 892
171 Ga0068870_11281202 3300005840 Bacteria 533
172 Ga0068863_100340516 3300005841 Bacteria 1459
173 Ga0068863_100816623 3300005841 Unclassified 930
174 Ga0068863_101029225 3300005841 Bacteria 827
175 Ga0068863_102328343 3300005841 Unclassified 545
176 Ga0068858_100215509 3300005842 Bacteria 1817
177 Ga0068860_100136255 3300005843 Bacteria 2358
178 Ga0068862_100052522 3300005844 Unclassified 3487
179 Ga0068862_100918207 3300005844 Unclassified 862
180 Ga0068862_101075623 3300005844 Unclassified 798
181 Ga0068862_102492818 3300005844 Unclassified 529
182 Ga0081455_10108237 3300005937 Bacteria 2214
183 Ga0081455_10468211 3300005937 Bacteria 856
184 Ga0075365_10330246 3300006038 Bacteria 1074
185 Ga0070716_100018531 3300006173 Bacteria 3629
186 Ga0070712_100083329 3300006175 Bacteria 2322
187 Ga0070712_100092787 3300006175 Bacteria 2215
188 Ga0070712_100411240 3300006175 Bacteria 1119
189 Ga0070712_101795898 3300006175 Bacteria 537
190 Ga0075362_10726267 3300006177 Bacteria 519
191 Ga0075367_10663820 3300006178 Bacteria 663
192 Ga0097621_100106336 3300006237 Bacteria 2367
193 Ga0097621_100139737 3300006237 Bacteria 2069
194 Ga0068871_100014643 3300006358 Bacteria 5852
195 Ga0075428_100105443 3300006844 Bacteria 3074
196 Ga0075428_100125665 3300006844 Bacteria 2791
197 Ga0075428_102366264 3300006844 Unclassified 546
198 Ga0075430_101157027 3300006846 Bacteria 637
199 Ga0075433_10688767 3300006852 Bacteria 895
200 Ga0075433_10746275 3300006852 Bacteria 856
201 Ga0075433_10802231 3300006852 Bacteria 823
202 Ga0075434_100022420 3300006871 Bacteria 6151
203 Ga0075434_100216644 3300006871 Bacteria 1935
204 Ga0075434_100558606 3300006871 Bacteria 1164
205 Ga0075434_101706856 3300006871 Bacteria 637
206 Ga0075434_102415158 3300006871 Bacteria 528
207 Ga0068865_100947803 3300006881 Bacteria 751
208 Ga0075436_100064655 3300006914 Unclassified 2529
209 Ga0075436_100238498 3300006914 Bacteria 1293
210 Ga0075436_100377736 3300006914 Unclassified 1024
211 Ga0097620_100000046 3300006931 Bacteria 142733
212 Ga0097620_100003211 3300006931 Bacteria 16645
213 Ga0097620_100011281 3300006931 Bacteria 8991
214 Ga0097620_100014042 3300006931 Bacteria 8031
215 Ga0097620_100084432 3300006931 Bacteria 3221
216 Ga0097620_100304532 3300006931 Unclassified 1687
217 Ga0097620_100391765 3300006931 Bacteria 1485
218 Ga0097620_100701673 3300006931 Bacteria 1103
219 Ga0097620_101383513 3300006931 Bacteria 776
220 Ga0097620_101673240 3300006931 Bacteria 703
221 Ga0075435_100043004 3300007076 Bacteria 3616
222 Ga0075435_100290010 3300007076 Unclassified 1398
223 Ga0075435_100308590 3300007076 Bacteria 1354
224 Ga0105240_10007036 3300009093 Bacteria 16414
225 Ga0105240_10019513 3300009093 Bacteria 9056
226 Ga0111539_12523086 3300009094 Unclassified 596
227 Ga0105247_10064908 3300009101 Unclassified 2270
228 Ga0105247_10258903 3300009101 Bacteria 1192
229 Ga0114129_10223701 3300009147 Bacteria 2538
230 Ga0114129_10560851 3300009147 Bacteria 1484
231 Ga0114129_10901253 3300009147 Bacteria 1120
232 Ga0114129_11648250 3300009147 Bacteria 784
233 Ga0114129_12542384 3300009147 Unclassified 612
234 Ga0114129_13223032 3300009147 Bacteria 530
235 Ga0105243_11384659 3300009148 Unclassified 723
236 Ga0105241_10084903 3300009174 Unclassified 2487
237 Ga0105241_10437883 3300009174 Bacteria 1154
238 Ga0105242_10685628 3300009176 Bacteria 1000
239 Ga0105248_10003342 3300009177 Bacteria 17833
240 Ga0105248_11589920 3300009177 Bacteria 740
241 Ga0105237_10013242 3300009545 Bacteria 8654
242 Ga0105238_11096211 3300009551 Bacteria 819
243 Ga0105249_10623536 3300009553 Bacteria 1134
244 Ga0105239_10125152 3300010375 Bacteria 2856
245 Ga0105239_11974907 3300010375 Bacteria 677
246 Ga0105246_10033873 3300011119 Bacteria 3398
247 Ga0105246_10406897 3300011119 Bacteria 1131
248 Ga0105246_11763104 3300011119 Unclassified 590
249 Ga0157373_10000982 3300013100 Bacteria 22058
250 Ga0157371_10205741 3300013102 Bacteria 1412
251 Ga0157371_10871202 3300013102 Bacteria 682
252 Ga0157370_10006370 3300013104 Bacteria 13026
253 Ga0157378_11303248 3300013297 Bacteria 767
254 Ga0163162_11371494 3300013306 Bacteria 804
255 Ga0163162_11684493 3300013306 Unclassified 724
256 Ga0157372_10053589 3300013307 Bacteria 4496
257 Ga0157372_10786323 3300013307 Bacteria 1106
258 Ga0157375_12274491 3300013308 Unclassified 646
259 Ga0163163_10123336 3300014325 Bacteria 2626
260 Ga0163163_10308808 3300014325 Bacteria 1634
261 Ga0163163_10349333 3300014325 Bacteria 1535
262 Ga0157380_10001886 3300014326 Bacteria 13902
263 Ga0157377_10000198 3300014745 Bacteria 33472
264 Ga0157379_11088793 3300014968 Unclassified 765
265 Ga0157376_12618642 3300014969 Bacteria 544
266 Ga0183368_1004 3300015687 Bacteria 1211761
267 Ga0213873_10308738 3300021358 Unclassified 512
268 Ga0213876_10000053 3300021384 Bacteria 142404
269 Ga0213876_10000458 3300021384 Bacteria 32682
270 Ga0209760_100894 3300025207 Bacteria 3772
271 Ga0209784_100004 3300025224 Bacteria 1378156
272 Ga0209566_100004 3300025225 Bacteria 1531866
273 Ga0209674_100006 3300025226 Bacteria 1531866
274 Ga0209674_100016 3300025226 Bacteria 696756
275 Ga0209672_100103 3300025228 Bacteria 104244
276 Ga0209563_100009 3300025230 Bacteria 1378156
277 Ga0209563_100150 3300025230 Bacteria 65666
278 Ga0207427_100699 3300025231 Bacteria 15790
279 Ga0207427_100768 3300025231 Bacteria 14614
280 Ga0209437_100004 3300025233 Bacteria 1378156
281 Ga0209437_100228 3300025233 Bacteria 98265
282 Ga0209258_100232 3300025242 Bacteria 104244
283 Ga0209026_1003441 3300025250 Bacteria 5179
284 Ga0209677_100005 3300025253 Bacteria 1378156
285 Ga0209148_1000005 3300025254 Bacteria 1806504
286 Ga0209148_1000206 3300025254 Bacteria 104244
287 Ga0209233_1000005 3300025261 Bacteria 1531866
288 Ga0209233_1006577 3300025261 Bacteria 3736
289 Ga0209455_1000179 3300025272 Bacteria 104244
290 Ga0207653_10000047 3300025885 Bacteria 91340
291 Ga0207653_10230099 3300025885 Bacteria 706
292 Ga0207692_10446960 3300025898 Bacteria 813
293 Ga0207692_10643200 3300025898 Unclassified 685
294 Ga0207710_10000004 3300025900 Bacteria 846540
295 Ga0207710_10057290 3300025900 Bacteria 1760
296 Ga0207710_10127913 3300025900 Unclassified 1218
297 Ga0207699_10203582 3300025906 Bacteria 1343
298 Ga0207643_10015698 3300025908 Bacteria 4124
299 Ga0207643_10364701 3300025908 Bacteria 908
300 Ga0207705_10113411 3300025909 Bacteria 2004
301 Ga0207684_10001536 3300025910 Bacteria 24717
302 Ga0207684_10011559 3300025910 Bacteria 7714
303 Ga0207684_10039886 3300025910 Bacteria 3981
304 Ga0207684_10222783 3300025910 Bacteria 1628
305 Ga0207684_10858724 3300025910 Unclassified 765
306 Ga0207654_10293544 3300025911 Bacteria 1103
307 Ga0207695_10008974 3300025913 Bacteria 12443
308 Ga0207695_10136047 3300025913 Bacteria 2410
309 Ga0207671_10020566 3300025914 Bacteria 5022
310 Ga0207693_10171851 3300025915 Bacteria 1706
311 Ga0207693_10222704 3300025915 Bacteria 1482
312 Ga0207693_10802918 3300025915 Bacteria 725
313 Ga0207663_10436040 3300025916 Bacteria 1008
314 Ga0207660_10565813 3300025917 Bacteria 925
315 Ga0207662_10029724 3300025918 Bacteria 3168
316 Ga0207662_10068994 3300025918 Bacteria 2136
317 Ga0207652_10027349 3300025921 Unclassified 4752
318 Ga0207652_10286648 3300025921 Bacteria 1486
319 Ga0207646_10066305 3300025922 Bacteria 3223
320 Ga0207646_10200046 3300025922 Bacteria 1805
321 Ga0207646_11289967 3300025922 Bacteria 638
322 Ga0207681_10000110 3300025923 Bacteria 69649
323 Ga0207681_11012687 3300025923 Bacteria 697
324 Ga0207650_10021490 3300025925 Bacteria 4560
325 Ga0207650_10035327 3300025925 Bacteria 3628
326 Ga0207650_11612067 3300025925 Bacteria 551
327 Ga0207687_11717788 3300025927 Bacteria 538
328 Ga0207700_10682646 3300025928 Bacteria 916
329 Ga0207664_10518014 3300025929 Bacteria 1069
330 Ga0207664_11117009 3300025929 Bacteria 704
331 Ga0207644_10002425 3300025931 Bacteria 12009
332 Ga0207706_10012101 3300025933 Bacteria 7858
333 Ga0207706_10103590 3300025933 Bacteria 2503
334 Ga0207686_10575050 3300025934 Bacteria 884
335 Ga0207709_10980204 3300025935 Bacteria 690
336 Ga0207670_10494158 3300025936 Bacteria 993
337 Ga0207670_10539625 3300025936 Bacteria 952
338 Ga0207669_11048466 3300025937 Bacteria 687
339 Ga0207704_11653148 3300025938 Bacteria 550
340 Ga0207665_10002211 3300025939 Bacteria 13127
341 Ga0207691_10660462 3300025940 Bacteria 883
342 Ga0207711_10006529 3300025941 Bacteria 9818
343 Ga0207711_10327137 3300025941 Bacteria 1417
344 Ga0207689_10420880 3300025942 Unclassified 1115
345 Ga0207689_10648309 3300025942 Bacteria 889
346 Ga0207689_10694071 3300025942 Bacteria 858
347 Ga0207689_11173765 3300025942 Bacteria 646
348 Ga0207679_10021982 3300025945 Bacteria 4336
349 Ga0207667_10000062 3300025949 Bacteria 190422
350 Ga0207667_10639533 3300025949 Bacteria 1070
351 Ga0207651_10427614 3300025960 Bacteria 1132
352 Ga0207640_10000022 3300025981 Bacteria 167526
353 Ga0207640_10138412 3300025981 Bacteria 1771
354 Ga0207640_10693592 3300025981 Unclassified 872
355 Ga0207658_10056487 3300025986 Bacteria 2913
356 Ga0207677_10097872 3300026023 Bacteria 2151
357 Ga0207677_10465063 3300026023 Unclassified 1087
358 Ga0207677_11114831 3300026023 Bacteria 720
359 Ga0207703_11062669 3300026035 Bacteria 777
360 Ga0207678_10000399 3300026067 Bacteria 39734
361 Ga0207678_11778088 3300026067 Bacteria 540
362 Ga0207708_10001354 3300026075 Bacteria 18401
363 Ga0207708_10064775 3300026075 Bacteria 2793
364 Ga0207708_10222027 3300026075 Unclassified 1514
365 Ga0207702_12485213 3300026078 Bacteria 504
366 Ga0207641_10249276 3300026088 Bacteria 1658
367 Ga0207641_10503382 3300026088 Bacteria 1177
368 Ga0207641_12244409 3300026088 Unclassified 546
369 Ga0207648_10065542 3300026089 Bacteria 3166
370 Ga0207648_10977978 3300026089 Unclassified 792
371 Ga0207676_10003048 3300026095 Bacteria 11958
372 Ga0207676_10234782 3300026095 Bacteria 1642
373 Ga0207676_10321737 3300026095 Bacteria 1420
374 Ga0207676_10401531 3300026095 Bacteria 1281
375 Ga0207676_10535770 3300026095 Bacteria 1117
376 Ga0207676_10632053 3300026095 Unclassified 1031
377 Ga0207674_10116463 3300026116 Unclassified 2643
378 Ga0207675_100749100 3300026118 Bacteria 988
379 Ga0207683_10023314 3300026121 Bacteria 5323
380 Ga0207698_10403005 3300026142 Bacteria 1308
381 Ga0207698_10634093 3300026142 Bacteria 1057
382 Ga0207698_11258650 3300026142 Unclassified 754
383 Ga0207698_12334579 3300026142 Unclassified 547
384 Ga0268266_10000001 3300028379 Bacteria 4040580
385 Ga0268266_10000252 3300028379 Bacteria 90702
386 Ga0268265_10027580 3300028380 Unclassified 4055
387 Ga0268264_10603839 3300028381 Bacteria 1082
388 Ga0307515_10158966 3300028794 Bacteria 2316
389 Ga0265338_10000016 3300028800 Bacteria 347424
390 Ga0265338_11016878 3300028800 Bacteria 561
391 Ga0316177_1016443 3300030731 Bacteria 1040
392 Ga0316177_1164940 3300030731 Bacteria 6988
393 Ga0316176_1204343 3300030732 Bacteria 1392
394 Ga0314311_1179633 3300030733 Bacteria 636
395 Ga0316180_1010538 3300030736 Bacteria 696
396 Ga0316181_1073040 3300030744 Bacteria 569
397 Ga0316182_1014446 3300030745 Bacteria 1373
398 Ga0316182_1171846 3300030745 Unclassified 526
399 Ga0316182_1276313 3300030745 Bacteria 2544
400 Ga0265325_10008493 3300031241 Bacteria 6057
401 Ga0265325_10491617 3300031241 Bacteria 532
402 Ga0307408_100006007 3300031548 Bacteria 8080
403 Ga0316579_10140560 3300031691 Bacteria 1164
404 Ga0316579_10318330 3300031691 Unclassified 752
405 Ga0316576_10302392 3300031727 Bacteria 1195
406 Ga0316576_10327990 3300031727 Bacteria 1141
407 Ga0316576_10957124 3300031727 Unclassified 611
408 Ga0316578_10034292 3300031728 Bacteria 2914
409 Ga0307405_10023447 3300031731 Bacteria 3507
410 Ga0307405_10710433 3300031731 Unclassified 833
411 Ga0307410_10009883 3300031852 Bacteria 5377
412 Ga0307406_10022338 3300031901 Bacteria 3752
413 Ga0307407_10257659 3300031903 Bacteria 1198
414 Ga0307412_10058787 3300031911 Bacteria 2573
415 Ga0307409_100288644 3300031995 Bacteria 1520
416 Ga0307416_100016556 3300032002 Bacteria 5129
417 Ga0307414_10006929 3300032004 Bacteria 6349
418 Ga0307414_10104660 3300032004 Bacteria 2138
419 Ga0307411_10359936 3300032005 Bacteria 1189
420 Ga0307415_100005575 3300032126 Bacteria 6699
421 Ga0307507_10465604 3300033179 Unclassified 693
422 Ga0373950_0035216 3300034818 Bacteria 941
423 Ga0373959_0182950 3300034820 Bacteria 546
424 Ga0373926_0060992 3300035083 Bacteria 1375
425 Ga0373934_0001012 3300035086 Bacteria 10172
426 Ga0373934_0451575 3300035086 Bacteria 539
427 Ga0373951_0133263 3300035091 Unclassified 685
428 Ga0373923_0315660 3300035111 Bacteria 742
429 Ga0373932_0320698 3300035112 Unclassified 583
430 Ga0373936_0019359 3300035113 Bacteria 2637
431 Ga0373936_0120871 3300035113 Bacteria 1119
432 Ga0373939_0044604 3300035114 Bacteria 1350
433 Ga0373941_0029730 3300035115 Bacteria 1614
434 Ga0373954_0124634 3300035118 Bacteria 1252
435 Ga0373943_0072420 3300035170 Bacteria 1748
436 Ga0373943_0384926 3300035170 Bacteria 808
437 Ga0373955_0027178 3300035172 Bacteria 2955
438 Ga0316574_0046118 3300035398 Bacteria 2701
439 Ga0373924_0009892 3300035410 Bacteria 3507
440 Ga0373931_0969129 3300035691 Unclassified 574
441 Ga0373931_0980338 3300035691 Unclassified 571
442 Ga0373935_0089201 3300035692 Bacteria 2016
443 Ga0373935_0107164 3300035692 Bacteria 1850
444 Ga0373927_0653456 3300035695 Bacteria 695
445 Ga0373933_0074937 3300035724 Bacteria 2065
446 Ga0373933_0084023 3300035724 Bacteria 1956
447 Ga0373947_0126186 3300035725 Bacteria 1630
448 Ga0373947_0687014 3300035725 Bacteria 698
449 Ga0373937_0001923 3300036401 Bacteria 17365
450 Ga0373937_0004880 3300036401 Bacteria 11404
451 Ga0373937_0530741 3300036401 Bacteria 1118
452 Ga0316582_0172665 3300036647 Bacteria 1468
453 Ga0316584_0451305 3300036712 Bacteria 909
454 Ga0373925_0008518 3300037068 Bacteria 7472
455 Ga0395900_1491857 3300037418 Bacteria 588
456 Ga0395900_1527960 3300037418 Bacteria 579
457 Ga0395898_0084064 3300037466 Unclassified 3068
458 Ga0395905_0006366 3300037471 Bacteria 11898
459 Ga0436365_0873465 3300039437 Bacteria 246686
460 Ga0436365_1291084 3300039437 Bacteria 167262
461 Ga0436362_0502872 3300039453 Bacteria 749
462 Ga0439453_0126544 3300041408 Bacteria 590
463 Ga0439445_0021844 3300042004 Bacteria 1610
464 Ga0439435_0054705 3300042436 Bacteria 1150
465 Ga0451577_0976734 3300042876 Unclassified 761
466 Ga0439440_0021057 3300042993 Bacteria 1467
467 Ga0466969_0079064 3300044656 Bacteria 1572
468 Ga0453683_0044741 3300044673 Bacteria 2776
469 Ga0453683_0265079 3300044673 Bacteria 1096
470 Ga0453683_0534414 3300044673 Bacteria 762
471 Ga0466964_0022281 3300044706 Bacteria 2456
472 Ga0453684_1383091 3300044712 Bacteria 731
473 Ga0453684_2361106 3300044712 Bacteria 528
474 Ga0466960_0047547 3300044901 Bacteria 2058
475 Ga0466960_0910732 3300044901 Bacteria 537
476 Ga0451576_0000115 3300045051 Bacteria 208342
477 Ga0451576_0293614 3300045051 Bacteria 1699
478 Ga0495592_0233315 3300046454 Bacteria 1224
479 Ga0495592_0825278 3300046454 Unclassified 549
480 Ga0495603_0180843 3300046455 Unclassified 1220
481 Ga0495629_0754581 3300046459 Bacteria 644
482 Ga0495638_0000076 3300046460 Bacteria 158799
483 Ga0495651_0044707 3300046462 Bacteria 3432
484 Ga0495651_0227730 3300046462 Bacteria 1286
485 Ga0495653_0089198 3300046463 Bacteria 2260
486 Ga0495650_0000150 3300046471 Bacteria 158574
487 Ga0495664_0408761 3300046477 Unclassified 815
488 Ga0495610_0259474 3300046512 Bacteria 685
489 Ga0495630_0545685 3300046517 Bacteria 889
490 Ga0495652_0090745 3300046529 Bacteria 2499
491 Ga0495652_0321354 3300046529 Bacteria 1118
492 Ga0495587_0063049 3300046536 Bacteria 2169
493 Ga0495587_0153507 3300046536 Bacteria 1312
494 Ga0495645_0305683 3300046543 Bacteria 1037
495 Ga0495667_0000715 3300046559 Bacteria 21273
496 Ga0495667_0075055 3300046559 Bacteria 2201
497 Ga0495634_0584056 3300046642 Bacteria 649
498 Ga0495635_0002992 3300046663 Bacteria 11597
499 Ga0495657_0036301 3300046675 Bacteria 3407
500 Ga0495657_0126895 3300046675 Bacteria 1602
501 Ga0495599_0201671 3300046678 Bacteria 1222
502 Ga0495599_0262988 3300046678 Bacteria 1048
503 Ga0495624_0335329 3300046690 Bacteria 910
504 Ga0495600_0053077 3300046809 Bacteria 2647
505 Ga0495600_0526848 3300046809 Bacteria 724
506 Ga0495604_0402803 3300047317 Bacteria 901
507 Ga0495674_0619039 3300047319 Bacteria 856
508 Ga0495680_0003225 3300047322 Bacteria 16201
509 Ga0495680_1105728 3300047322 Unclassified 500
510 Ga0496100_0113237 3300048903 Bacteria 1888
511 Ga0496100_0544462 3300048903 Unclassified 897
512 Ga0496101_0128035 3300048904 Bacteria 1926
513 Ga0496104_0304533 3300048907 Bacteria 1506
514 Ga0496104_0376568 3300048907 Unclassified 1332
515 Ga0496105_0226104 3300048908 Bacteria 1522
516 Ga0496105_1397118 3300048908 Bacteria 507
517 Ga0496106_0406971 3300048909 Bacteria 1093
518 Ga0496107_0949561 3300048910 Unclassified 625
519 Ga0496109_0967385 3300048912 Bacteria 789
520 Ga0496112_0022373 3300048915 Bacteria 6025
521 Ga0496112_0915187 3300048915 Unclassified 799
522 Ga0496113_0394731 3300048916 Bacteria 1111
523 Ga0496114_0113391 3300048917 Bacteria 2324
524 Ga0496115_0006331 3300048918 Bacteria 8666
525 Ga0496119_0003170 3300048922 Bacteria 17265
526 Ga0501033_0000524 3300049570 Bacteria 35901
527 Ga0501033_0019520 3300049570 Bacteria 5125
528 Ga0501036_0070051 3300049572 Bacteria 2965
529 Ga0501036_0244589 3300049572 Bacteria 1504
530 Ga0501036_1402128 3300049572 Bacteria 566
531 Ga0501037_0293279 3300049573 Bacteria 1131
532 Ga0501038_0005856 3300049574 Bacteria 11370
533 Ga0501038_0505541 3300049574 Bacteria 923
534 Ga0501039_0135241 3300049575 Bacteria 1935
535 Ga0501039_0224175 3300049575 Bacteria 1478
536 Ga0501040_0010673 3300049576 Bacteria 6008
537 Ga0501041_0014947 3300049577 Bacteria 4610
538 Ga0501042_0418835 3300049578 Bacteria 970
539 Ga0501043_0635896 3300049579 Bacteria 785
540 Ga0501046_0148049 3300049580 Bacteria 1772
541 Ga0501046_0308031 3300049580 Bacteria 1155
542 Ga0501048_0388325 3300049582 Bacteria 997
543 Ga0501048_1120313 3300049582 Bacteria 566
544 Ga0501068_0536861 3300049584 Bacteria 760
545 Ga0501069_0016632 3300049585 Bacteria 3952
546 Ga0501069_0264321 3300049585 Bacteria 1005
547 Ga0501069_0401358 3300049585 Bacteria 811
548 Ga0501070_0386272 3300049586 Bacteria 1134
549 Ga0501071_0017558 3300049587 Bacteria 4938
550 Ga0501072_0000985 3300049588 Bacteria 21023
551 Ga0501072_0401457 3300049588 Bacteria 1087
552 Ga0501073_0033884 3300049589 Bacteria 3635
553 Ga0501073_0058901 3300049589 Bacteria 2684
554 Ga0501075_0000021 3300049591 Bacteria 66125
555 Ga0501075_0845140 3300049591 Bacteria 696
556 Ga0501076_0000070 3300049592 Bacteria 50841
557 Ga0501076_0141837 3300049592 Bacteria 1952
558 Ga0501077_0133185 3300049593 Bacteria 1576
559 Ga0501077_0177151 3300049593 Bacteria 1355
560 Ga0501077_0308660 3300049593 Bacteria 1008
561 Ga0501202_000507 3300049652 Bacteria 5592
562 Ga0501216_013641 3300049660 Bacteria 1350
563 Ga0501217_002038 3300049661 Bacteria 3908
564 Ga0501233_005464 3300049668 Bacteria 2359
565 Ga0501236_039850 3300049670 Bacteria 775
566 Ga0501240_036607 3300049673 Bacteria 804
567 Ga0501250_077792 3300049680 Bacteria 559
568 Ga0501229_008713 3300049706 Bacteria 1270
569 Ga0501234_001766 3300049707 Bacteria 3405
570 Ga0501079_0002267 3300049741 Bacteria 13890
571 Ga0501079_0332411 3300049741 Bacteria 1190
572 Ga0501079_0685943 3300049741 Bacteria 806
573 Ga0501080_0006209 3300049742 Bacteria 10725
574 Ga0501080_0193694 3300049742 Bacteria 1867
575 Ga0501081_0001028 3300049743 Bacteria 16673
576 Ga0501273_005459 3300049770 Bacteria 1436
577 Ga0501035_0372915 3300049822 Bacteria 1191
578 Ga0501035_0506827 3300049822 Bacteria 993
579 Ga0501044_1104513 3300049823 Bacteria 662
580 Ga0501045_0469091 3300049824 Bacteria 935
581 Ga0501204_011255 3300049850 Bacteria 1060
582 Ga0501212_109032 3300049851 Bacteria 527
583 nmdc:mga05p37_1074328_c1 3300050507 Bacteria 846
584 nmdc:mga05p37_1103861_c1 3300050507 Bacteria 830
585 nmdc:mga05p37_197678_c1 3300050507 Bacteria 2437
586 nmdc:mga05p37_983004_c1 3300050507 Bacteria 899
587 nmdc:mga09592_1066814_c1 3300050508 Unclassified 673
588 nmdc:mga0n895_120857_c1 3300050512 Bacteria 2640
589 nmdc:mga0n895_19806_c1 3300050512 Bacteria 6260
590 nmdc:mga0n895_2027102_c1 3300050512 Bacteria 533
591 nmdc:mga0n895_737118_c1 3300050512 Bacteria 979
592 nmdc:mga08x19_1217348_c1 3300050514 Unclassified 534
593 nmdc:mga08x19_314442_c1 3300050514 Bacteria 1089
594 nmdc:mga0a205_147027_c1 3300050515 Bacteria 2257
595 nmdc:mga0a205_295924_c1 3300050515 Bacteria 1492
596 nmdc:mga0a205_776747_c1 3300050515 Bacteria 806
597 nmdc:mga0a205_888485_c1 3300050515 Bacteria 738
598 Ga0495601_0575432 3300053077 Unclassified 724
599 Ga0495595_0199292 3300053084 Bacteria 996
600 Ga0495619_0418373 3300053085 Bacteria 925
601 Ga0500651_0023045 3300053093 Bacteria 3896
602 Ga0500555_021500 3300053103 Bacteria 1858
603 Ga0500616_0000928 3300053153 Bacteria 32046
604 Ga0501084_0009750 3300054114 Bacteria 7943
605 Ga0501084_0256715 3300054114 Bacteria 1475
606 Ga0501082_0002747 3300060353 Bacteria 15376
607 Ga0501082_0454070 3300060353 Bacteria 1120
608 Ga0530510_0000012 3300061734 Bacteria 115789
609 Ga0530510_0170219 3300061734 Bacteria 1613
610 Ga0530510_0309470 3300061734 Bacteria 1183

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026089 Ga0207648_10977978 Ga0207648_109779782 82
2 3300005841 Ga0068863_100816623 Ga0068863_1008166232 84
3 3300006846 Ga0075430_101157027 Ga0075430_1011570272 89
4 3300005439 Ga0070711_101911771 Ga0070711_1019117711 90
5 3300003756 Ga0055533_1005338 Ga0055533_10053382 91
6 3300005337 Ga0070682_100350214 Ga0070682_1003502143 91
7 3300005353 Ga0070669_101171723 Ga0070669_1011717232 91
8 3300005616 Ga0068852_100957396 Ga0068852_1009573962 91
9 3300005617 Ga0068859_101383415 Ga0068859_1013834152 91
10 3300005719 Ga0068861_100517884 Ga0068861_1005178842 91
11 3300005840 Ga0068870_10401408 Ga0068870_104014081 91
12 3300005840 Ga0068870_11281202 Ga0068870_112812021 91
13 3300006931 Ga0097620_101383513 Ga0097620_1013835132 91
14 3300021384 Ga0213876_10000053 Ga0213876_1000005320 91
15 3300025226 Ga0209674_100016 Ga0209674_100016115 91
16 3300025908 Ga0207643_10364701 Ga0207643_103647011 91
17 3300025923 Ga0207681_11012687 Ga0207681_110126872 91
18 3300025927 Ga0207687_11717788 Ga0207687_117177881 91
19 3300025935 Ga0207709_10980204 Ga0207709_109802042 91
20 3300025949 Ga0207667_10639533 Ga0207667_106395332 91
21 3300026078 Ga0207702_12485213 Ga0207702_124852132 91
22 3300026118 Ga0207675_100749100 Ga0207675_1007491002 91
23 3300039437 Ga0436365_0873465 Ga0436365_0873465_89014_89334 91
24 iso_pu_bacteria 2582581280 2585151745 91
25 iso_pu_bacteria 2582581293 2585195372 91
26 3300005331 Ga0070670_100667457 Ga0070670_1006674572 92
27 3300005338 Ga0068868_100094624 Ga0068868_1000946243 92
28 3300005343 Ga0070687_100120130 Ga0070687_1001201302 92
29 3300005438 Ga0070701_10310877 Ga0070701_103108772 92
30 3300005441 Ga0070700_100639519 Ga0070700_1006395191 92
31 3300005466 Ga0070685_10334027 Ga0070685_103340272 92
32 3300005564 Ga0070664_100295325 Ga0070664_1002953253 92
33 3300005615 Ga0070702_100007398 Ga0070702_1000073983 92
34 3300005615 Ga0070702_100756469 Ga0070702_1007564692 92
35 3300005617 Ga0068859_100011283 Ga0068859_1000112838 92
36 3300005617 Ga0068859_100084432 Ga0068859_1000844323 92
37 3300005841 Ga0068863_100340516 Ga0068863_1003405163 92
38 3300005842 Ga0068858_100215509 Ga0068858_1002155093 92
39 3300005843 Ga0068860_100136255 Ga0068860_1001362553 92
40 3300005844 Ga0068862_101075623 Ga0068862_1010756232 92
41 3300006237 Ga0097621_100106336 Ga0097621_1001063363 92
42 3300006931 Ga0097620_100011281 Ga0097620_1000112814 92
43 3300006931 Ga0097620_100084432 Ga0097620_1000844323 92
44 3300009101 Ga0105247_10258903 Ga0105247_102589032 92
45 3300009174 Ga0105241_10437883 Ga0105241_104378833 92
46 3300009553 Ga0105249_10623536 Ga0105249_106235362 92
47 3300010375 Ga0105239_11974907 Ga0105239_119749071 92
48 3300013306 Ga0163162_11371494 Ga0163162_113714942 92
49 3300013306 Ga0163162_11684493 Ga0163162_116844932 92
50 3300014968 Ga0157379_11088793 Ga0157379_110887931 92
51 3300015687 Ga0183368_1004 Ga0183368_1004556 92
52 3300025900 Ga0207710_10057290 Ga0207710_100572903 92
53 3300025918 Ga0207662_10029724 Ga0207662_100297243 92
54 3300025933 Ga0207706_10103590 Ga0207706_101035905 92
55 3300025945 Ga0207679_10021982 Ga0207679_100219823 92
56 3300026023 Ga0207677_10097872 Ga0207677_100978723 92
57 3300026035 Ga0207703_11062669 Ga0207703_110626692 92
58 3300026088 Ga0207641_10249276 Ga0207641_102492763 92
59 3300026095 Ga0207676_10234782 Ga0207676_102347821 92
60 3300035083 Ga0373926_0060992 Ga0373926_0060992_980_1303 92
61 3300035113 Ga0373936_0120871 Ga0373936_0120871_541_864 92
62 3300035692 Ga0373935_0107164 Ga0373935_0107164_892_1215 92
63 3300037068 Ga0373925_0008518 Ga0373925_0008518_4696_5019 92
64 3300046529 Ga0495652_0090745 Ga0495652_0090745_1582_1905 92
65 3300046536 Ga0495587_0153507 Ga0495587_0153507_686_1009 92
66 3300046543 Ga0495645_0305683 Ga0495645_0305683_575_898 92
67 3300046678 Ga0495599_0262988 Ga0495599_0262988_398_721 92
68 3300048915 Ga0496112_0915187 Ga0496112_0915187_428_751 92
69 3300005334 Ga0068869_101216558 Ga0068869_1012165582 93
70 3300005340 Ga0070689_100388737 Ga0070689_1003887372 93
71 3300005353 Ga0070669_101324743 Ga0070669_1013247431 93
72 3300005354 Ga0070675_100647377 Ga0070675_1006473772 93
73 3300005438 Ga0070701_10188807 Ga0070701_101888072 93
74 3300005440 Ga0070705_100229134 Ga0070705_1002291342 93
75 3300005444 Ga0070694_100297183 Ga0070694_1002971832 93
76 3300005457 Ga0070662_101830964 Ga0070662_1018309641 93
77 3300005458 Ga0070681_10175666 Ga0070681_101756663 93
78 3300005543 Ga0070672_100725387 Ga0070672_1007253872 93
79 3300005577 Ga0068857_100312327 Ga0068857_1003123273 93
80 3300005578 Ga0068854_100014355 Ga0068854_1000143555 93
81 3300005614 Ga0068856_100114766 Ga0068856_1001147663 93
82 3300005617 Ga0068859_100014042 Ga0068859_1000140425 93
83 3300005618 Ga0068864_100052563 Ga0068864_1000525634 93
84 3300005718 Ga0068866_10054750 Ga0068866_100547503 93
85 3300005844 Ga0068862_100052522 Ga0068862_1000525223 93
86 3300006931 Ga0097620_100014042 Ga0097620_1000140425 93
87 3300025911 Ga0207654_10293544 Ga0207654_102935443 93
88 3300025936 Ga0207670_10539625 Ga0207670_105396252 93
89 3300026089 Ga0207648_10065542 Ga0207648_100655425 93
90 3300026095 Ga0207676_10321737 Ga0207676_103217373 93
91 3300026095 Ga0207676_10632053 Ga0207676_106320532 93
92 3300026116 Ga0207674_10116463 Ga0207674_101164632 93
93 3300026142 Ga0207698_10634093 Ga0207698_106340933 93
94 3300026142 Ga0207698_12334579 Ga0207698_123345792 93
95 3300028380 Ga0268265_10027580 Ga0268265_100275805 93
96 3300028381 Ga0268264_10603839 Ga0268264_106038393 93
97 3300035691 Ga0373931_0969129 Ga0373931_0969129_119_442 93
98 3300053153 Ga0500616_0000928 Ga0500616_0000928_17836_18159 93
99 3300005535 Ga0070684_101406144 Ga0070684_1014061441 94
100 3300005618 Ga0068864_100122958 Ga0068864_1001229582 94
101 3300009177 Ga0105248_11589920 Ga0105248_115899202 94
102 3300014325 Ga0163163_10349333 Ga0163163_103493333 94
103 3300026095 Ga0207676_10401531 Ga0207676_104015313 94
104 3300005616 Ga0068852_100218565 Ga0068852_1002185651 95
105 3300009545 Ga0105237_10013242 Ga0105237_100132423 95
106 3300013307 Ga0157372_10786323 Ga0157372_107863232 95
107 3300025913 Ga0207695_10136047 Ga0207695_101360473 95
108 3300025914 Ga0207671_10020566 Ga0207671_100205662 95
109 3300025921 Ga0207652_10027349 Ga0207652_100273496 95
110 3300026142 Ga0207698_11258650 Ga0207698_112586503 95
111 3300030733 Ga0314311_1179633 Ga0314311_11796332 95
112 3300035112 Ga0373932_0320698 Ga0373932_0320698_94_381 95
113 3300044712 Ga0453684_2361106 Ga0453684_2361106_180_503 95
114 3300048916 Ga0496113_0394731 Ga0496113_0394731_242_529 95
115 3300049589 Ga0501073_0033884 Ga0501073_0033884_338_625 95
116 3300005331 Ga0070670_100029904 Ga0070670_1000299045 96
117 3300005334 Ga0068869_101194413 Ga0068869_1011944132 96
118 3300005458 Ga0070681_10375680 Ga0070681_103756802 96
119 3300005618 Ga0068864_100001094 Ga0068864_1000010949 96
120 3300005840 Ga0068870_10001396 Ga0068870_100013964 96
121 3300011119 Ga0105246_10406897 Ga0105246_104068972 96
122 3300014325 Ga0163163_10123336 Ga0163163_101233363 96
123 3300014326 Ga0157380_10001886 Ga0157380_100018868 96
124 3300025908 Ga0207643_10015698 Ga0207643_100156984 96
125 3300025925 Ga0207650_10021490 Ga0207650_100214903 96
126 3300025942 Ga0207689_11173765 Ga0207689_111737652 96
127 3300026095 Ga0207676_10003048 Ga0207676_100030486 96
128 3300034818 Ga0373950_0035216 Ga0373950_0035216_19_309 96
129 3300049570 Ga0501033_0000524 Ga0501033_0000524_16697_17020 96
130 3300005345 Ga0070692_10230000 Ga0070692_102300002 97
131 3300005440 Ga0070705_101143903 Ga0070705_1011439032 97
132 3300005549 Ga0070704_100017412 Ga0070704_1000174124 97
133 3300005578 Ga0068854_101324508 Ga0068854_1013245082 97
134 3300005457 Ga0070662_100005929 Ga0070662_1000059292 98
135 3300005467 Ga0070706_100004834 Ga0070706_1000048347 98
136 3300005530 Ga0070679_101888298 Ga0070679_1018882981 98
137 3300005563 Ga0068855_100000148 Ga0068855_10000014828 98
138 3300005578 Ga0068854_100000527 Ga0068854_1000005273 98
139 3300005614 Ga0068856_102526820 Ga0068856_1025268202 98
140 3300005615 Ga0070702_100685652 Ga0070702_1006856521 98
141 3300006881 Ga0068865_100947803 Ga0068865_1009478031 98
142 3300009093 Ga0105240_10007036 Ga0105240_100070364 98
143 3300013102 Ga0157371_10871202 Ga0157371_108712022 98
144 3300014969 Ga0157376_12618642 Ga0157376_126186422 98
145 3300025910 Ga0207684_10039886 Ga0207684_100398863 98
146 3300025913 Ga0207695_10008974 Ga0207695_1000897412 98
147 3300025933 Ga0207706_10012101 Ga0207706_1001210110 98
148 3300025938 Ga0207704_11653148 Ga0207704_116531482 98
149 3300025949 Ga0207667_10000062 Ga0207667_1000006246 98
150 3300025981 Ga0207640_10000022 Ga0207640_1000002266 98
151 3300037418 Ga0395900_1491857 Ga0395900_1491857_97_393 98
152 3300037471 Ga0395905_0006366 Ga0395905_0006366_7156_7452 98
153 3300005327 Ga0070658_10023784 Ga0070658_100237844 99
154 3300005336 Ga0070680_100920761 Ga0070680_1009207611 99
155 3300005340 Ga0070689_100780134 Ga0070689_1007801342 99
156 3300005455 Ga0070663_100006820 Ga0070663_1000068206 99
157 3300005456 Ga0070678_100101308 Ga0070678_1001013083 99
158 3300025936 Ga0207670_10494158 Ga0207670_104941583 99
159 3300026067 Ga0207678_10000399 Ga0207678_100003993 99
160 3300026121 Ga0207683_10023314 Ga0207683_100233144 99
161 3300005471 Ga0070698_101845943 Ga0070698_1018459431 100
162 3300006844 Ga0075428_100105443 Ga0075428_1001054435 100
163 3300006871 Ga0075434_100022420 Ga0075434_1000224207 100
164 3300006914 Ga0075436_100377736 Ga0075436_1003777363 100
165 3300007076 Ga0075435_100043004 Ga0075435_1000430043 100
166 3300009147 Ga0114129_10560851 Ga0114129_105608512 100
167 3300003759 Ga0055525_1000207 Ga0055525_100020725 101
168 3300003760 Ga0055527_1000108 Ga0055527_100010822 101
169 3300003761 Ga0055535_1000646 Ga0055535_100064621 101
170 3300003762 Ga0055542_1000447 Ga0055542_100044710 101
171 3300003763 Ga0055529_1000603 Ga0055529_10006035 101
172 3300006177 Ga0075362_10726267 Ga0075362_107262672 101
173 3300025228 Ga0209672_100103 Ga0209672_10010339 101
174 3300025230 Ga0209563_100150 Ga0209563_10015025 101
175 3300025242 Ga0209258_100232 Ga0209258_10023239 101
176 3300025254 Ga0209148_1000206 Ga0209148_100020639 101
177 3300025272 Ga0209455_1000179 Ga0209455_100017939 101
178 3300050507 nmdc:mga05p37_983004_c1 nmdc:mga05p37_983004_c1_392_715 101
179 3300050512 nmdc:mga0n895_19806_c1 nmdc:mga0n895_19806_c1_1203_1526 101
180 3300050514 nmdc:mga08x19_1217348_c1 nmdc:mga08x19_1217348_c1_124_447 101
181 3300005345 Ga0070692_11395584 Ga0070692_113955841 102
182 3300005364 Ga0070673_100866591 Ga0070673_1008665912 102
183 3300005441 Ga0070700_100000193 Ga0070700_10000019330 102
184 3300005547 Ga0070693_100358456 Ga0070693_1003584562 102
185 3300005617 Ga0068859_100003211 Ga0068859_10000321111 102
186 3300006931 Ga0097620_100003211 Ga0097620_1000032116 102
187 3300009101 Ga0105247_10064908 Ga0105247_100649083 102
188 3300009177 Ga0105248_10003342 Ga0105248_100033429 102
189 3300025900 Ga0207710_10127913 Ga0207710_101279133 102
190 3300025941 Ga0207711_10006529 Ga0207711_1000652910 102
191 3300026075 Ga0207708_10001354 Ga0207708_1000135414 102
192 3300042993 Ga0439440_0021057 Ga0439440_0021057_667_975 102
193 3300035086 Ga0373934_0451575 Ga0373934_0451575_192_503 103
194 3300035111 Ga0373923_0315660 Ga0373923_0315660_172_483 103
195 3300035113 Ga0373936_0019359 Ga0373936_0019359_1881_2192 103
196 3300035692 Ga0373935_0089201 Ga0373935_0089201_741_1052 103
197 3300035695 Ga0373927_0653456 Ga0373927_0653456_351_662 103
198 3300035724 Ga0373933_0074937 Ga0373933_0074937_1452_1763 103
199 3300035725 Ga0373947_0126186 Ga0373947_0126186_616_927 103
200 3300036401 Ga0373937_0001923 Ga0373937_0001923_7108_7419 103
201 3300046454 Ga0495592_0233315 Ga0495592_0233315_870_1181 103
202 3300046459 Ga0495629_0754581 Ga0495629_0754581_114_425 103
203 3300046462 Ga0495651_0044707 Ga0495651_0044707_283_594 103
204 3300046463 Ga0495653_0089198 Ga0495653_0089198_491_802 103
205 3300046517 Ga0495630_0545685 Ga0495630_0545685_399_710 103
206 3300046536 Ga0495587_0063049 Ga0495587_0063049_1736_2047 103
207 3300046559 Ga0495667_0000715 Ga0495667_0000715_12949_13260 103
208 3300046663 Ga0495635_0002992 Ga0495635_0002992_5013_5324 103
209 3300046675 Ga0495657_0036301 Ga0495657_0036301_3014_3325 103
210 3300046678 Ga0495599_0201671 Ga0495599_0201671_398_709 103
211 3300046690 Ga0495624_0335329 Ga0495624_0335329_63_374 103
212 3300046809 Ga0495600_0053077 Ga0495600_0053077_482_793 103
213 3300047319 Ga0495674_0619039 Ga0495674_0619039_310_621 103
214 3300047322 Ga0495680_0003225 Ga0495680_0003225_12510_12821 103
215 iso_pu_bacteria 2904699407 2904700860 103
216 iso_pu_bacteria 2919450847 2919451448 103
217 iso_pu_bacteria 2928963466 2928967171 103
218 3300005334 Ga0068869_100498475 Ga0068869_1004984752 105
219 3300005436 Ga0070713_101747329 Ga0070713_1017473291 105
220 3300005445 Ga0070708_100031387 Ga0070708_1000313872 105
221 3300005468 Ga0070707_100549387 Ga0070707_1005493872 105
222 3300005578 Ga0068854_100076177 Ga0068854_1000761773 105
223 3300005719 Ga0068861_100126977 Ga0068861_1001269773 105
224 3300005937 Ga0081455_10108237 Ga0081455_101082373 105
225 3300009147 Ga0114129_10901253 Ga0114129_109012533 105
226 3300014745 Ga0157377_10000198 Ga0157377_1000019833 105
227 3300025942 Ga0207689_10694071 Ga0207689_106940712 105
228 3300025981 Ga0207640_10138412 Ga0207640_101384122 105
229 3300030731 Ga0316177_1016443 Ga0316177_10164433 105
230 3300030732 Ga0316176_1204343 Ga0316176_12043433 105
231 3300030744 Ga0316181_1073040 Ga0316181_10730402 105
232 3300030745 Ga0316182_1014446 Ga0316182_10144463 105
233 3300031691 Ga0316579_10140560 Ga0316579_101405603 105
234 3300031727 Ga0316576_10302392 Ga0316576_103023922 105
235 3300031728 Ga0316578_10034292 Ga0316578_100342923 105
236 3300035170 Ga0373943_0384926 Ga0373943_0384926_134_451 105
237 3300035398 Ga0316574_0046118 Ga0316574_0046118_1919_2236 105
238 3300035725 Ga0373947_0687014 Ga0373947_0687014_125_442 105
239 3300036401 Ga0373937_0530741 Ga0373937_0530741_735_1052 105
240 3300036712 Ga0316584_0451305 Ga0316584_0451305_109_426 105
241 3300046455 Ga0495603_0180843 Ga0495603_0180843_660_977 105
242 3300046462 Ga0495651_0227730 Ga0495651_0227730_212_529 105
243 3300046559 Ga0495667_0075055 Ga0495667_0075055_668_985 105
244 3300046642 Ga0495634_0584056 Ga0495634_0584056_249_566 105
245 3300046675 Ga0495657_0126895 Ga0495657_0126895_37_354 105
246 3300046809 Ga0495600_0526848 Ga0495600_0526848_171_488 105
247 3300047317 Ga0495604_0402803 Ga0495604_0402803_521_838 105
248 3300047322 Ga0495680_1105728 Ga0495680_1105728_39_356 105
249 3300048907 Ga0496104_0376568 Ga0496104_0376568_855_1172 105
250 3300048908 Ga0496105_1397118 Ga0496105_1397118_34_351 105
251 3300048922 Ga0496119_0003170 Ga0496119_0003170_7351_7668 105
252 3300049585 Ga0501069_0016632 Ga0501069_0016632_2903_3220 105
253 3300049741 Ga0501079_0685943 Ga0501079_0685943_460_777 105
254 3300050507 nmdc:mga05p37_1103861_c1 nmdc:mga05p37_1103861_c1_237_554 105
255 3300053084 Ga0495595_0199292 Ga0495595_0199292_42_359 105
256 3300053085 Ga0495619_0418373 Ga0495619_0418373_255_572 105
257 3300044673 Ga0453683_0044741 Ga0453683_0044741_2201_2521 106
258 3300045051 Ga0451576_0293614 Ga0451576_0293614_914_1234 106
259 3300048903 Ga0496100_0113237 Ga0496100_0113237_661_981 106
260 3300049570 Ga0501033_0019520 Ga0501033_0019520_2904_3224 106
261 3300049572 Ga0501036_0070051 Ga0501036_0070051_2490_2810 106
262 3300049572 Ga0501036_1402128 Ga0501036_1402128_59_379 106
263 3300049573 Ga0501037_0293279 Ga0501037_0293279_341_661 106
264 3300049574 Ga0501038_0005856 Ga0501038_0005856_10871_11191 106
265 3300049574 Ga0501038_0505541 Ga0501038_0505541_495_815 106
266 3300049575 Ga0501039_0135241 Ga0501039_0135241_735_1055 106
267 3300049575 Ga0501039_0224175 Ga0501039_0224175_273_593 106
268 3300049576 Ga0501040_0010673 Ga0501040_0010673_1675_1995 106
269 3300049577 Ga0501041_0014947 Ga0501041_0014947_3520_3840 106
270 3300049578 Ga0501042_0418835 Ga0501042_0418835_404_724 106
271 3300049579 Ga0501043_0635896 Ga0501043_0635896_355_675 106
272 3300049580 Ga0501046_0148049 Ga0501046_0148049_471_791 106
273 3300049580 Ga0501046_0308031 Ga0501046_0308031_88_408 106
274 3300049582 Ga0501048_0388325 Ga0501048_0388325_667_987 106
275 3300049584 Ga0501068_0536861 Ga0501068_0536861_354_674 106
276 3300049585 Ga0501069_0264321 Ga0501069_0264321_426_746 106
277 3300049585 Ga0501069_0401358 Ga0501069_0401358_330_650 106
278 3300049586 Ga0501070_0386272 Ga0501070_0386272_44_364 106
279 3300049587 Ga0501071_0017558 Ga0501071_0017558_2663_2983 106
280 3300049588 Ga0501072_0000985 Ga0501072_0000985_527_847 106
281 3300049588 Ga0501072_0401457 Ga0501072_0401457_13_333 106
282 3300049589 Ga0501073_0058901 Ga0501073_0058901_232_552 106
283 3300049591 Ga0501075_0000021 Ga0501075_0000021_38728_39048 106
284 3300049591 Ga0501075_0845140 Ga0501075_0845140_247_567 106
285 3300049592 Ga0501076_0000070 Ga0501076_0000070_31241_31561 106
286 3300049592 Ga0501076_0141837 Ga0501076_0141837_1289_1609 106
287 3300049593 Ga0501077_0133185 Ga0501077_0133185_482_802 106
288 3300049593 Ga0501077_0177151 Ga0501077_0177151_326_646 106
289 3300049593 Ga0501077_0308660 Ga0501077_0308660_518_838 106
290 3300049741 Ga0501079_0002267 Ga0501079_0002267_2391_2711 106
291 3300049741 Ga0501079_0332411 Ga0501079_0332411_300_620 106
292 3300049742 Ga0501080_0006209 Ga0501080_0006209_2039_2359 106
293 3300049742 Ga0501080_0193694 Ga0501080_0193694_271_591 106
294 3300049743 Ga0501081_0001028 Ga0501081_0001028_2431_2751 106
295 3300049822 Ga0501035_0372915 Ga0501035_0372915_572_892 106
296 3300049823 Ga0501044_1104513 Ga0501044_1104513_133_453 106
297 3300049824 Ga0501045_0469091 Ga0501045_0469091_390_710 106
298 3300054114 Ga0501084_0009750 Ga0501084_0009750_5578_5898 106
299 3300054114 Ga0501084_0256715 Ga0501084_0256715_663_983 106
300 3300060353 Ga0501082_0002747 Ga0501082_0002747_4191_4511 106
301 3300060353 Ga0501082_0454070 Ga0501082_0454070_203_523 106
302 3300061734 Ga0530510_0000012 Ga0530510_0000012_67825_68145 106
303 3300061734 Ga0530510_0170219 Ga0530510_0170219_97_417 106
304 3300001989 JGI24739J22299_10067983 JGI24739J22299_100679833 107
305 3300002074 JGI24748J21848_1000002 JGI24748J21848_1000002262 107
306 3300002239 JGI24034J26672_10000004 JGI24034J26672_10000004112 107
307 3300002737 JGI25162J39368_1000021 JGI25162J39368_1000021144 107
308 3300002741 JGI25157J39369_1014950 JGI25157J39369_10149502 107
309 3300002771 JGI25163J39215_1007283 JGI25163J39215_10072831 107
310 3300003214 JGI25165J46597_1000049 JGI25165J46597_100004980 107
311 3300003316 rootH1_10043042 rootH1_100430424 107
312 3300003316 rootH1_10118134 rootH1_101181343 107
313 3300003320 rootH2_10001362 rootH2_1000136233 107
314 3300003320 rootH2_10256832 rootH2_102568323 107
315 3300003322 rootL2_10009982 rootL2_100099827 107
316 3300003322 rootL2_10038767 rootL2_100387676 107
317 3300003322 rootL2_10257985 rootL2_102579853 107
318 3300003751 Ga0055538_1000023 Ga0055538_1000023144 107
319 3300003752 Ga0055539_1000030 Ga0055539_1000030144 107
320 3300003756 Ga0055533_1000039 Ga0055533_1000039144 107
321 3300003759 Ga0055525_1000048 Ga0055525_100004880 107
322 3300003762 Ga0055542_1000223 Ga0055542_100022320 107
323 3300003841 Ga0055541_1000021 Ga0055541_100002180 107
324 3300005327 Ga0070658_10011873 Ga0070658_100118732 107
325 3300005327 Ga0070658_10155143 Ga0070658_101551433 107
326 3300005331 Ga0070670_100018852 Ga0070670_1000188527 107
327 3300005331 Ga0070670_101719437 Ga0070670_1017194372 107
328 3300005331 Ga0070670_101948063 Ga0070670_1019480631 107
329 3300005334 Ga0068869_100113390 Ga0068869_1001133902 107
330 3300005334 Ga0068869_100869545 Ga0068869_1008695451 107
331 3300005338 Ga0068868_100835553 Ga0068868_1008355532 107
332 3300005345 Ga0070692_10023635 Ga0070692_100236354 107
333 3300005353 Ga0070669_100000019 Ga0070669_10000001944 107
334 3300005353 Ga0070669_100048363 Ga0070669_1000483632 107
335 3300005355 Ga0070671_100046913 Ga0070671_1000469136 107
336 3300005355 Ga0070671_100312201 Ga0070671_1003122013 107
337 3300005364 Ga0070673_101330275 Ga0070673_1013302752 107
338 3300005365 Ga0070688_101058548 Ga0070688_1010585482 107
339 3300005367 Ga0070667_100019678 Ga0070667_1000196783 107
340 3300005406 Ga0070703_10000028 Ga0070703_1000002835 107
341 3300005406 Ga0070703_10142371 Ga0070703_101423711 107
342 3300005434 Ga0070709_10370028 Ga0070709_103700282 107
343 3300005435 Ga0070714_100078810 Ga0070714_1000788103 107
344 3300005435 Ga0070714_100303404 Ga0070714_1003034041 107
345 3300005436 Ga0070713_100009503 Ga0070713_1000095033 107
346 3300005437 Ga0070710_10028354 Ga0070710_100283543 107
347 3300005437 Ga0070710_10940413 Ga0070710_109404131 107
348 3300005439 Ga0070711_100394796 Ga0070711_1003947962 107
349 3300005440 Ga0070705_100000368 Ga0070705_10000036823 107
350 3300005440 Ga0070705_100109133 Ga0070705_1001091333 107
351 3300005440 Ga0070705_100386094 Ga0070705_1003860942 107
352 3300005441 Ga0070700_100006039 Ga0070700_1000060394 107
353 3300005441 Ga0070700_100587338 Ga0070700_1005873383 107
354 3300005444 Ga0070694_100241404 Ga0070694_1002414042 107
355 3300005445 Ga0070708_100000237 Ga0070708_10000023715 107
356 3300005445 Ga0070708_100001158 Ga0070708_10000115812 107
357 3300005445 Ga0070708_100999912 Ga0070708_1009999121 107
358 3300005455 Ga0070663_101348698 Ga0070663_1013486981 107
359 3300005458 Ga0070681_10294969 Ga0070681_102949692 107
360 3300005466 Ga0070685_10150822 Ga0070685_101508223 107
361 3300005466 Ga0070685_10281317 Ga0070685_102813172 107
362 3300005467 Ga0070706_100001593 Ga0070706_10000159314 107
363 3300005467 Ga0070706_100253436 Ga0070706_1002534363 107
364 3300005467 Ga0070706_100386337 Ga0070706_1003863373 107
365 3300005467 Ga0070706_100711661 Ga0070706_1007116611 107
366 3300005467 Ga0070706_100932334 Ga0070706_1009323342 107
367 3300005467 Ga0070706_101296460 Ga0070706_1012964602 107
368 3300005468 Ga0070707_100034782 Ga0070707_1000347823 107
369 3300005468 Ga0070707_101452765 Ga0070707_1014527651 107
370 3300005471 Ga0070698_100001354 Ga0070698_10000135411 107
371 3300005471 Ga0070698_100065472 Ga0070698_1000654723 107
372 3300005471 Ga0070698_100067512 Ga0070698_1000675125 107
373 3300005471 Ga0070698_100211259 Ga0070698_1002112592 107
374 3300005471 Ga0070698_101012541 Ga0070698_1010125412 107
375 3300005518 Ga0070699_100171861 Ga0070699_1001718613 107
376 3300005518 Ga0070699_100290033 Ga0070699_1002900332 107
377 3300005518 Ga0070699_100728702 Ga0070699_1007287022 107
378 3300005530 Ga0070679_100294754 Ga0070679_1002947543 107
379 3300005536 Ga0070697_100000140 Ga0070697_10000014023 107
380 3300005536 Ga0070697_100137905 Ga0070697_1001379054 107
381 3300005539 Ga0068853_100193419 Ga0068853_1001934192 107
382 3300005543 Ga0070672_100848305 Ga0070672_1008483051 107
383 3300005545 Ga0070695_100050977 Ga0070695_1000509773 107
384 3300005545 Ga0070695_100128826 Ga0070695_1001288262 107
385 3300005546 Ga0070696_100706402 Ga0070696_1007064022 107
386 3300005548 Ga0070665_100000026 Ga0070665_10000002631 107
387 3300005548 Ga0070665_100000365 Ga0070665_10000036528 107
388 3300005549 Ga0070704_100067136 Ga0070704_1000671363 107
389 3300005549 Ga0070704_101693233 Ga0070704_1016932332 107
390 3300005577 Ga0068857_102147862 Ga0068857_1021478622 107
391 3300005615 Ga0070702_100704121 Ga0070702_1007041212 107
392 3300005616 Ga0068852_100328066 Ga0068852_1003280663 107
393 3300005617 Ga0068859_100000046 Ga0068859_10000004665 107
394 3300005617 Ga0068859_100304497 Ga0068859_1003044973 107
395 3300005617 Ga0068859_100391782 Ga0068859_1003917822 107
396 3300005617 Ga0068859_100701645 Ga0068859_1007016452 107
397 3300005617 Ga0068859_101673465 Ga0068859_1016734652 107
398 3300005841 Ga0068863_101029225 Ga0068863_1010292251 107
399 3300005841 Ga0068863_102328343 Ga0068863_1023283431 107
400 3300005844 Ga0068862_100918207 Ga0068862_1009182072 107
401 3300005844 Ga0068862_102492818 Ga0068862_1024928182 107
402 3300005937 Ga0081455_10468211 Ga0081455_104682112 107
403 3300006038 Ga0075365_10330246 Ga0075365_103302461 107
404 3300006173 Ga0070716_100018531 Ga0070716_1000185313 107
405 3300006175 Ga0070712_100083329 Ga0070712_1000833293 107
406 3300006175 Ga0070712_100092787 Ga0070712_1000927873 107
407 3300006175 Ga0070712_100411240 Ga0070712_1004112401 107
408 3300006175 Ga0070712_101795898 Ga0070712_1017958982 107
409 3300006178 Ga0075367_10663820 Ga0075367_106638202 107
410 3300006237 Ga0097621_100139737 Ga0097621_1001397373 107
411 3300006358 Ga0068871_100014643 Ga0068871_1000146437 107
412 3300006844 Ga0075428_100125665 Ga0075428_1001256654 107
413 3300006844 Ga0075428_102366264 Ga0075428_1023662642 107
414 3300006852 Ga0075433_10688767 Ga0075433_106887672 107
415 3300006852 Ga0075433_10746275 Ga0075433_107462752 107
416 3300006852 Ga0075433_10802231 Ga0075433_108022312 107
417 3300006871 Ga0075434_100216644 Ga0075434_1002166443 107
418 3300006871 Ga0075434_100558606 Ga0075434_1005586062 107
419 3300006871 Ga0075434_101706856 Ga0075434_1017068562 107
420 3300006871 Ga0075434_102415158 Ga0075434_1024151581 107
421 3300006914 Ga0075436_100064655 Ga0075436_1000646553 107
422 3300006914 Ga0075436_100238498 Ga0075436_1002384983 107
423 3300006931 Ga0097620_100000046 Ga0097620_10000004665 107
424 3300006931 Ga0097620_100304532 Ga0097620_1003045323 107
425 3300006931 Ga0097620_100391765 Ga0097620_1003917652 107
426 3300006931 Ga0097620_100701673 Ga0097620_1007016732 107
427 3300006931 Ga0097620_101673240 Ga0097620_1016732402 107
428 3300007076 Ga0075435_100290010 Ga0075435_1002900101 107
429 3300007076 Ga0075435_100308590 Ga0075435_1003085902 107
430 3300009093 Ga0105240_10019513 Ga0105240_100195132 107
431 3300009094 Ga0111539_12523086 Ga0111539_125230862 107
432 3300009147 Ga0114129_10223701 Ga0114129_102237013 107
433 3300009147 Ga0114129_11648250 Ga0114129_116482502 107
434 3300009147 Ga0114129_12542384 Ga0114129_125423842 107
435 3300009147 Ga0114129_13223032 Ga0114129_132230322 107
436 3300009148 Ga0105243_11384659 Ga0105243_113846591 107
437 3300009174 Ga0105241_10084903 Ga0105241_100849033 107
438 3300009176 Ga0105242_10685628 Ga0105242_106856283 107
439 3300009551 Ga0105238_11096211 Ga0105238_110962112 107
440 3300010375 Ga0105239_10125152 Ga0105239_101251523 107
441 3300011119 Ga0105246_10033873 Ga0105246_100338732 107
442 3300011119 Ga0105246_11763104 Ga0105246_117631041 107
443 3300013100 Ga0157373_10000982 Ga0157373_1000098212 107
444 3300013102 Ga0157371_10205741 Ga0157371_102057413 107
445 3300013104 Ga0157370_10006370 Ga0157370_100063704 107
446 3300013297 Ga0157378_11303248 Ga0157378_113032481 107
447 3300013307 Ga0157372_10053589 Ga0157372_100535892 107
448 3300013308 Ga0157375_12274491 Ga0157375_122744912 107
449 3300014325 Ga0163163_10308808 Ga0163163_103088082 107
450 3300021358 Ga0213873_10308738 Ga0213873_103087382 107
451 3300021384 Ga0213876_10000458 Ga0213876_100004584 107
452 3300025207 Ga0209760_100894 Ga0209760_1008943 107
453 3300025224 Ga0209784_100004 Ga0209784_1000041185 107
454 3300025225 Ga0209566_100004 Ga0209566_1000041342 107
455 3300025226 Ga0209674_100006 Ga0209674_1000061342 107
456 3300025230 Ga0209563_100009 Ga0209563_1000091185 107
457 3300025231 Ga0207427_100699 Ga0207427_10069913 107
458 3300025231 Ga0207427_100768 Ga0207427_10076816 107
459 3300025233 Ga0209437_100004 Ga0209437_1000041185 107
460 3300025233 Ga0209437_100228 Ga0209437_1002288 107
461 3300025250 Ga0209026_1003441 Ga0209026_10034415 107
462 3300025253 Ga0209677_100005 Ga0209677_1000051185 107
463 3300025254 Ga0209148_1000005 Ga0209148_1000005814 107
464 3300025261 Ga0209233_1000005 Ga0209233_10000051342 107
465 3300025261 Ga0209233_1006577 Ga0209233_10065773 107
466 3300025885 Ga0207653_10000047 Ga0207653_1000004721 107
467 3300025885 Ga0207653_10230099 Ga0207653_102300992 107
468 3300025898 Ga0207692_10446960 Ga0207692_104469602 107
469 3300025898 Ga0207692_10643200 Ga0207692_106432001 107
470 3300025900 Ga0207710_10000004 Ga0207710_10000004105 107
471 3300025906 Ga0207699_10203582 Ga0207699_102035822 107
472 3300025909 Ga0207705_10113411 Ga0207705_101134113 107
473 3300025910 Ga0207684_10001536 Ga0207684_1000153617 107
474 3300025910 Ga0207684_10011559 Ga0207684_100115591 107
475 3300025910 Ga0207684_10222783 Ga0207684_102227832 107
476 3300025910 Ga0207684_10858724 Ga0207684_108587242 107
477 3300025915 Ga0207693_10171851 Ga0207693_101718513 107
478 3300025915 Ga0207693_10222704 Ga0207693_102227043 107
479 3300025915 Ga0207693_10802918 Ga0207693_108029182 107
480 3300025916 Ga0207663_10436040 Ga0207663_104360402 107
481 3300025917 Ga0207660_10565813 Ga0207660_105658131 107
482 3300025918 Ga0207662_10068994 Ga0207662_100689942 107
483 3300025921 Ga0207652_10286648 Ga0207652_102866482 107
484 3300025922 Ga0207646_10066305 Ga0207646_100663053 107
485 3300025922 Ga0207646_10200046 Ga0207646_102000463 107
486 3300025922 Ga0207646_11289967 Ga0207646_112899672 107
487 3300025923 Ga0207681_10000110 Ga0207681_1000011016 107
488 3300025925 Ga0207650_10035327 Ga0207650_100353273 107
489 3300025925 Ga0207650_11612067 Ga0207650_116120671 107
490 3300025928 Ga0207700_10682646 Ga0207700_106826462 107
491 3300025929 Ga0207664_10518014 Ga0207664_105180142 107
492 3300025929 Ga0207664_11117009 Ga0207664_111170092 107
493 3300025931 Ga0207644_10002425 Ga0207644_100024254 107
494 3300025934 Ga0207686_10575050 Ga0207686_105750502 107
495 3300025937 Ga0207669_11048466 Ga0207669_110484661 107
496 3300025939 Ga0207665_10002211 Ga0207665_100022116 107
497 3300025940 Ga0207691_10660462 Ga0207691_106604621 107
498 3300025941 Ga0207711_10327137 Ga0207711_103271372 107
499 3300025942 Ga0207689_10420880 Ga0207689_104208802 107
500 3300025942 Ga0207689_10648309 Ga0207689_106483092 107
501 3300025960 Ga0207651_10427614 Ga0207651_104276142 107
502 3300025981 Ga0207640_10693592 Ga0207640_106935922 107
503 3300025986 Ga0207658_10056487 Ga0207658_100564873 107
504 3300026023 Ga0207677_10465063 Ga0207677_104650633 107
505 3300026023 Ga0207677_11114831 Ga0207677_111148312 107
506 3300026067 Ga0207678_11778088 Ga0207678_117780882 107
507 3300026075 Ga0207708_10064775 Ga0207708_100647755 107
508 3300026075 Ga0207708_10222027 Ga0207708_102220272 107
509 3300026088 Ga0207641_10503382 Ga0207641_105033823 107
510 3300026088 Ga0207641_12244409 Ga0207641_122444091 107
511 3300026095 Ga0207676_10535770 Ga0207676_105357702 107
512 3300026142 Ga0207698_10403005 Ga0207698_104030052 107
513 3300028379 Ga0268266_10000001 Ga0268266_100000011238 107
514 3300028379 Ga0268266_10000252 Ga0268266_1000025256 107
515 3300028794 Ga0307515_10158966 Ga0307515_101589662 107
516 3300028800 Ga0265338_10000016 Ga0265338_10000016121 107
517 3300028800 Ga0265338_11016878 Ga0265338_110168782 107
518 3300030731 Ga0316177_1164940 Ga0316177_11649403 107
519 3300030736 Ga0316180_1010538 Ga0316180_10105382 107
520 3300030745 Ga0316182_1171846 Ga0316182_11718462 107
521 3300030745 Ga0316182_1276313 Ga0316182_12763133 107
522 3300031241 Ga0265325_10008493 Ga0265325_100084933 107
523 3300031241 Ga0265325_10491617 Ga0265325_104916171 107
524 3300031548 Ga0307408_100006007 Ga0307408_1000060076 107
525 3300031691 Ga0316579_10318330 Ga0316579_103183302 107
526 3300031727 Ga0316576_10327990 Ga0316576_103279902 107
527 3300031727 Ga0316576_10957124 Ga0316576_109571242 107
528 3300031731 Ga0307405_10023447 Ga0307405_100234475 107
529 3300031731 Ga0307405_10710433 Ga0307405_107104332 107
530 3300031852 Ga0307410_10009883 Ga0307410_100098832 107
531 3300031901 Ga0307406_10022338 Ga0307406_100223383 107
532 3300031903 Ga0307407_10257659 Ga0307407_102576592 107
533 3300031911 Ga0307412_10058787 Ga0307412_100587873 107
534 3300031995 Ga0307409_100288644 Ga0307409_1002886443 107
535 3300032002 Ga0307416_100016556 Ga0307416_1000165563 107
536 3300032004 Ga0307414_10006929 Ga0307414_100069293 107
537 3300032004 Ga0307414_10104660 Ga0307414_101046603 107
538 3300032005 Ga0307411_10359936 Ga0307411_103599362 107
539 3300032126 Ga0307415_100005575 Ga0307415_1000055756 107
540 3300033179 Ga0307507_10465604 Ga0307507_104656042 107
541 3300034820 Ga0373959_0182950 Ga0373959_0182950_122_445 107
542 3300035086 Ga0373934_0001012 Ga0373934_0001012_5472_5795 107
543 3300035091 Ga0373951_0133263 Ga0373951_0133263_336_659 107
544 3300035114 Ga0373939_0044604 Ga0373939_0044604_573_896 107
545 3300035115 Ga0373941_0029730 Ga0373941_0029730_868_1191 107
546 3300035118 Ga0373954_0124634 Ga0373954_0124634_484_807 107
547 3300035170 Ga0373943_0072420 Ga0373943_0072420_99_422 107
548 3300035172 Ga0373955_0027178 Ga0373955_0027178_159_482 107
549 3300035410 Ga0373924_0009892 Ga0373924_0009892_2952_3275 107
550 3300035691 Ga0373931_0980338 Ga0373931_0980338_125_448 107
551 3300035724 Ga0373933_0084023 Ga0373933_0084023_1134_1457 107
552 3300036401 Ga0373937_0004880 Ga0373937_0004880_4018_4341 107
553 3300036647 Ga0316582_0172665 Ga0316582_0172665_949_1272 107
554 3300037418 Ga0395900_1527960 Ga0395900_1527960_209_532 107
555 3300037466 Ga0395898_0084064 Ga0395898_0084064_2570_2893 107
556 3300039437 Ga0436365_1291084 Ga0436365_1291084_162805_163128 107
557 3300039453 Ga0436362_0502872 Ga0436362_0502872_380_703 107
558 3300041408 Ga0439453_0126544 Ga0439453_0126544_64_402 107
559 3300042004 Ga0439445_0021844 Ga0439445_0021844_1215_1538 107
560 3300042436 Ga0439435_0054705 Ga0439435_0054705_656_994 107
561 3300042876 Ga0451577_0976734 Ga0451577_0976734_39_362 107
562 3300044656 Ga0466969_0079064 Ga0466969_0079064_336_659 107
563 3300044673 Ga0453683_0265079 Ga0453683_0265079_487_810 107
564 3300044673 Ga0453683_0534414 Ga0453683_0534414_409_732 107
565 3300044706 Ga0466964_0022281 Ga0466964_0022281_888_1211 107
566 3300044712 Ga0453684_1383091 Ga0453684_1383091_133_456 107
567 3300044901 Ga0466960_0047547 Ga0466960_0047547_45_368 107
568 3300044901 Ga0466960_0910732 Ga0466960_0910732_124_447 107
569 3300045051 Ga0451576_0000115 Ga0451576_0000115_57115_57438 107
570 3300046454 Ga0495592_0825278 Ga0495592_0825278_171_494 107
571 3300046460 Ga0495638_0000076 Ga0495638_0000076_65423_65746 107
572 3300046471 Ga0495650_0000150 Ga0495650_0000150_31652_31975 107
573 3300046477 Ga0495664_0408761 Ga0495664_0408761_209_532 107
574 3300046512 Ga0495610_0259474 Ga0495610_0259474_131_454 107
575 3300046529 Ga0495652_0321354 Ga0495652_0321354_539_862 107
576 3300048903 Ga0496100_0544462 Ga0496100_0544462_233_556 107
577 3300048904 Ga0496101_0128035 Ga0496101_0128035_731_1054 107
578 3300048907 Ga0496104_0304533 Ga0496104_0304533_546_869 107
579 3300048908 Ga0496105_0226104 Ga0496105_0226104_419_742 107
580 3300048909 Ga0496106_0406971 Ga0496106_0406971_347_670 107
581 3300048910 Ga0496107_0949561 Ga0496107_0949561_34_357 107
582 3300048912 Ga0496109_0967385 Ga0496109_0967385_156_479 107
583 3300048915 Ga0496112_0022373 Ga0496112_0022373_3104_3427 107
584 3300048917 Ga0496114_0113391 Ga0496114_0113391_603_926 107
585 3300048918 Ga0496115_0006331 Ga0496115_0006331_6930_7253 107
586 3300049572 Ga0501036_0244589 Ga0501036_0244589_652_975 107
587 3300049582 Ga0501048_1120313 Ga0501048_1120313_55_378 107
588 3300049652 Ga0501202_000507 Ga0501202_000507_1151_1474 107
589 3300049660 Ga0501216_013641 Ga0501216_013641_901_1224 107
590 3300049661 Ga0501217_002038 Ga0501217_002038_453_776 107
591 3300049668 Ga0501233_005464 Ga0501233_005464_1527_1850 107
592 3300049670 Ga0501236_039850 Ga0501236_039850_373_696 107
593 3300049673 Ga0501240_036607 Ga0501240_036607_281_604 107
594 3300049680 Ga0501250_077792 Ga0501250_077792_91_414 107
595 3300049706 Ga0501229_008713 Ga0501229_008713_29_352 107
596 3300049707 Ga0501234_001766 Ga0501234_001766_281_604 107
597 3300049770 Ga0501273_005459 Ga0501273_005459_519_842 107
598 3300049822 Ga0501035_0506827 Ga0501035_0506827_533_856 107
599 3300049850 Ga0501204_011255 Ga0501204_011255_379_702 107
600 3300049851 Ga0501212_109032 Ga0501212_109032_46_369 107
601 3300050507 nmdc:mga05p37_1074328_c1 nmdc:mga05p37_1074328_c1_35_358 107
602 3300050507 nmdc:mga05p37_197678_c1 nmdc:mga05p37_197678_c1_32_355 107
603 3300050508 nmdc:mga09592_1066814_c1 nmdc:mga09592_1066814_c1_35_358 107
604 3300050512 nmdc:mga0n895_120857_c1 nmdc:mga0n895_120857_c1_630_953 107
605 3300050512 nmdc:mga0n895_2027102_c1 nmdc:mga0n895_2027102_c1_140_463 107
606 3300050512 nmdc:mga0n895_737118_c1 nmdc:mga0n895_737118_c1_107_430 107
607 3300050514 nmdc:mga08x19_314442_c1 nmdc:mga08x19_314442_c1_36_359 107
608 3300050515 nmdc:mga0a205_147027_c1 nmdc:mga0a205_147027_c1_594_917 107
609 3300050515 nmdc:mga0a205_295924_c1 nmdc:mga0a205_295924_c1_489_812 107
610 3300050515 nmdc:mga0a205_776747_c1 nmdc:mga0a205_776747_c1_440_763 107
611 3300050515 nmdc:mga0a205_888485_c1 nmdc:mga0a205_888485_c1_139_462 107
612 3300053077 Ga0495601_0575432 Ga0495601_0575432_45_368 107
613 3300053093 Ga0500651_0023045 Ga0500651_0023045_1916_2239 107
614 3300053103 Ga0500555_021500 Ga0500555_021500_332_655 107
615 3300061734 Ga0530510_0309470 Ga0530510_0309470_729_1052 107

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ku0-assembly1.cif.gz_D enterobacteria phage t4 gp5.4 paar repeat protein in complex with t4 gp5 beta-helix fragment 0.7024 4 103
4jiw-assembly3.cif.gz_L c1882 paar-repeat protein from escherichia coli in complex with a vgrg-like beta-helix that is based on a fragment of t4 gp5 0.7014 4 101
4jiw-assembly3.cif.gz_L c1882 paar-repeat protein from escherichia coli in complex with a vgrg-like beta-helix that is based on a fragment of t4 gp5 0.6707 4 101
4ku0-assembly1.cif.gz_D enterobacteria phage t4 gp5.4 paar repeat protein in complex with t4 gp5 beta-helix fragment 0.6662 4 103
4jiv-assembly1.cif.gz_D vca0105 paar-repeat protein from vibrio cholerae in complex with a vgrg-like beta-helix that is based on a fragment of t4 gp5 0.6556 1 101
ID Description Score Start End Superfamily
4ku0D00 Mainly Beta;Sandwich;Tumour Suppressor Smad4; 0.7024 4 103 2.60.200.60
4jiwP00 Mainly Beta;Sandwich;Tumour Suppressor Smad4; 0.6911 4 101 2.60.200.60
4ku0D00 Mainly Beta;Sandwich;Tumour Suppressor Smad4; 0.6662 4 103 2.60.200.60
4jiwP00 Mainly Beta;Sandwich;Tumour Suppressor Smad4; 0.6606 4 101 2.60.200.60
af_M9PG15_444_630_3.40.1110.10 Alpha Beta;3-Layer(aba) Sandwich;Calcium-transporting ATPase, cytoplasmic domain N;Calcium-transporting ATPase, cytoplasmic domain N 0.5533 4 50 3.40.1110.10
ID Description Score Start End GO Terms
AF-A0A3C1QG25-F1-model_v4 deleted 0.9811 13 104
AF-A0A177NR14-F1-model_v4 DUF4280 domain-containing protein 0.9807 1 107
AF-A0A7W1R643-F1-model_v4 DUF4280 domain-containing protein 0.9757 1 107
AF-A0A7C9GRM5-F1-model_v4 DUF4280 domain-containing protein 0.9752 1 107
AF-A0A0Q8MG94-F1-model_v4 Uncharacterized protein 0.97 1 107

Feature Viewer

pLDDT pTM Quality
93.95 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map