F469474

General Info

Members Datasets Scaffolds Average Seq Length
615 330 610 208

Family's Representative Sequence

Representative Sequence 3300047469|Ga0495673_0126810|Ga0495673_0126810_219_929
Length 236
Sequence MKRVDKTVRMKLASAKVSHEKPKETHMTRYTLPDLPYDYGALEPHLAGAIMQLHHDKHHRAYVDGANKTIEKLAELRRDDKFESVAALEHALAFNVSGHVLHSIFWQNLTPKGGGTPGGELASAIERDFGGFEKFKKQLIQTAATVTGSGWAALVWEPVGQRLATTQIHDHQSQVTQGSVPLLVLDVWEHAYYLQYKNEKLKYFESVWNLWNWEDVGKRYAKARAVDLGIVGTARS

Samples

Sample ID Description Type Environment
1 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
2 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
3 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
4 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
10 3300003559 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
12 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
13 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
49 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
50 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
53 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
54 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
55 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
102 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
103 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
104 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
105 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
147 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
148 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
152 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
153 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
154 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
155 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
156 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
157 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
158 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
159 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
160 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
161 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
162 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
163 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
164 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
165 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
166 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
167 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
168 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
169 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
170 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
171 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
172 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
173 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
174 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
175 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
176 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
177 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
178 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
179 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
180 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
181 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
182 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
183 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
184 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
185 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
186 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
187 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
188 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
189 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
190 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
191 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
192 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
193 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
194 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
195 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
196 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
197 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
198 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
199 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
200 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
201 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
202 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
203 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
204 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
205 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
206 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
207 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
208 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
209 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
210 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
211 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
212 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
213 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
214 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
215 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
216 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
217 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
218 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
219 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
220 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
221 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
222 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
223 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
224 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
225 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
226 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
227 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
228 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
229 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
230 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
231 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
232 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
233 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
234 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
235 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
236 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
237 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
238 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
239 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
240 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
241 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
242 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
243 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
244 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
245 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
246 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
247 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
248 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
249 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
250 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
251 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
252 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
253 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
254 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
268 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
269 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
270 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
271 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
272 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
273 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
274 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
275 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
276 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
277 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
279 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
280 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
281 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
282 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
283 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
284 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
285 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
286 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
287 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
288 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
289 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
290 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
291 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
292 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
293 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
294 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
295 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
296 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
297 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
298 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
299 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
300 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
301 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
302 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
303 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
304 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
305 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
306 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
307 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
308 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
309 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
310 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
311 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
312 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
313 3300059603 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 62R_AD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
314 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
315 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
316 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
317 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
318 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
319 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
320 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
321 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
322 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
323 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
324 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
325 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
326 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
327 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
328 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
329 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
330 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.2
Metatranscriptomes 7.15
Isolates 0.65

Biome Distribution

Category Percentage (%)
Aerial Root 0.33
Bulb 0
Endosphere 14.31
Nodule 0
Rhizoplane 7.32
Rhizosphere 66.5
Stem 0
Stem Tuber 0
Unclassified 11.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10005429 3300001979 Bacteria 5389
2 Ga0006777J48905_1075518 3300003308 Bacteria 657
3 rootH1_10021975 3300003316 Bacteria 4381
4 rootH2_10115003 3300003320 Bacteria 2642
5 JGI25407J50210_10005288 3300003373 Bacteria 3168
6 Ga0007427J51700_105926 3300003559 Bacteria 2148
7 Ga0032354_1110763 3300003693 Bacteria 648
8 Ga0006780_1008331 3300003735 Bacteria 3645
9 Ga0055540_1000038 3300003792 Bacteria 161988
10 Ga0055540_1003784 3300003792 Bacteria 7132
11 Ga0070683_100157648 3300005329 Bacteria 2153
12 Ga0068869_100147204 3300005334 Bacteria 1824
13 Ga0070666_10025598 3300005335 Bacteria 3848
14 Ga0070666_10148061 3300005335 Bacteria 1637
15 Ga0070682_100148263 3300005337 Bacteria 1607
16 Ga0070682_100155270 3300005337 Bacteria 1575
17 Ga0070682_100322331 3300005337 Bacteria 1142
18 Ga0070668_100042491 3300005347 Bacteria 3485
19 Ga0070668_100159624 3300005347 Bacteria 1829
20 Ga0070671_100161721 3300005355 Bacteria 1893
21 Ga0070659_100052957 3300005366 Bacteria 3194
22 Ga0070667_100000883 3300005367 Bacteria 27691
23 Ga0070667_100034375 3300005367 Bacteria 4240
24 Ga0070667_100217744 3300005367 Bacteria 1699
25 Ga0070714_100594129 3300005435 Bacteria 1063
26 Ga0070713_100692151 3300005436 Bacteria 973
27 Ga0070694_100840447 3300005444 Bacteria 755
28 Ga0070663_100004514 3300005455 Bacteria 8197
29 Ga0070663_100033919 3300005455 Bacteria 3530
30 Ga0070678_100280349 3300005456 Bacteria 1409
31 Ga0070678_100829076 3300005456 Bacteria 841
32 Ga0070662_100019711 3300005457 Bacteria 4583
33 Ga0070662_100640234 3300005457 Bacteria 896
34 Ga0070684_100209224 3300005535 Bacteria 1778
35 Ga0070684_100341013 3300005535 Bacteria 1378
36 Ga0070684_100637972 3300005535 Bacteria 991
37 Ga0068853_100588154 3300005539 Bacteria 1056
38 Ga0070665_100019267 3300005548 Bacteria 6846
39 Ga0070665_100030195 3300005548 Bacteria 5455
40 Ga0070665_100063466 3300005548 Bacteria 3704
41 Ga0070665_101633095 3300005548 Bacteria 652
42 Ga0068855_100206407 3300005563 Bacteria 2210
43 Ga0068855_100328541 3300005563 Bacteria 1689
44 Ga0070664_100186793 3300005564 Bacteria 1845
45 Ga0068857_100212955 3300005577 Bacteria 1763
46 Ga0070702_100391043 3300005615 Bacteria 992
47 Ga0068852_100269682 3300005616 Bacteria 1637
48 Ga0068852_100320633 3300005616 Bacteria 1505
49 Ga0068852_100516158 3300005616 Bacteria 1192
50 Ga0068859_100335786 3300005617 Bacteria 1605
51 Ga0068864_100513670 3300005618 Bacteria 1154
52 Ga0068864_100559063 3300005618 Bacteria 1107
53 Ga0068866_10453684 3300005718 Bacteria 839
54 Ga0068861_100033383 3300005719 Bacteria 3795
55 Ga0068863_100006671 3300005841 Bacteria 11330
56 Ga0068863_100339613 3300005841 Bacteria 1461
57 Ga0068863_100856370 3300005841 Bacteria 908
58 Ga0068858_100009215 3300005842 Bacteria 9428
59 Ga0068858_100425812 3300005842 Bacteria 1277
60 Ga0068860_100001398 3300005843 Bacteria 26152
61 Ga0068860_100108047 3300005843 Bacteria 2659
62 Ga0068860_101159170 3300005843 Bacteria 793
63 Ga0068862_100323257 3300005844 Bacteria 1425
64 Ga0081455_10000207 3300005937 Bacteria 74809
65 Ga0081455_10013608 3300005937 Bacteria 8016
66 Ga0081455_10064417 3300005937 Bacteria 3069
67 Ga0081538_10000264 3300005981 Bacteria 59881
68 Ga0081539_10000238 3300005985 Bacteria 129119
69 Ga0070717_10286919 3300006028 Bacteria 1461
70 Ga0075365_10003782 3300006038 Bacteria 7887
71 Ga0075365_10058912 3300006038 Bacteria 2558
72 Ga0075365_10077292 3300006038 Bacteria 2249
73 Ga0075365_10321481 3300006038 Bacteria 1090
74 Ga0075368_10011756 3300006042 Bacteria 3191
75 Ga0075363_100001042 3300006048 Bacteria 9980
76 Ga0075363_100001275 3300006048 Bacteria 9367
77 Ga0075363_100147015 3300006048 Bacteria 1329
78 Ga0075363_100164763 3300006048 Bacteria 1256
79 Ga0075364_10001524 3300006051 Bacteria 12621
80 Ga0075364_10024010 3300006051 Bacteria 3866
81 Ga0075364_10026964 3300006051 Bacteria 3668
82 Ga0075364_10039469 3300006051 Bacteria 3060
83 Ga0075364_10044222 3300006051 Bacteria 2896
84 Ga0075364_10061223 3300006051 Bacteria 2468
85 Ga0075432_10000510 3300006058 Bacteria 11647
86 Ga0075432_10004766 3300006058 Bacteria 4617
87 Ga0075362_10013146 3300006177 Bacteria 3306
88 Ga0075362_10158376 3300006177 Bacteria 1089
89 Ga0075362_10161873 3300006177 Bacteria 1078
90 Ga0075367_10034537 3300006178 Bacteria 2922
91 Ga0075367_10197659 3300006178 Bacteria 1256
92 Ga0075367_10240779 3300006178 Bacteria 1134
93 Ga0075369_10009203 3300006186 Bacteria 3829
94 Ga0075369_10011183 3300006186 Bacteria 3525
95 Ga0075369_10031646 3300006186 Bacteria 2235
96 Ga0075369_10044045 3300006186 Bacteria 1917
97 Ga0075369_10084148 3300006186 Bacteria 1413
98 Ga0075366_10112553 3300006195 Bacteria 1638
99 Ga0075370_10000679 3300006353 Bacteria 13324
100 Ga0075370_10000831 3300006353 Bacteria 12465
101 Ga0075370_10019884 3300006353 Bacteria 3660
102 Ga0075370_10057888 3300006353 Bacteria 2204
103 Ga0075370_10078689 3300006353 Bacteria 1894
104 Ga0075370_10350692 3300006353 Bacteria 882
105 Ga0068871_100140176 3300006358 Bacteria 2056
106 Ga0075428_100027233 3300006844 Bacteria 6328
107 Ga0075428_100706748 3300006844 Bacteria 1074
108 Ga0075431_100021145 3300006847 Bacteria 6649
109 Ga0075433_10001532 3300006852 Bacteria 17068
110 Ga0075433_10079522 3300006852 Bacteria 2889
111 Ga0075433_10110140 3300006852 Bacteria 2443
112 Ga0075434_100015448 3300006871 Bacteria 7321
113 Ga0075434_100016447 3300006871 Bacteria 7111
114 Ga0075429_100004156 3300006880 Bacteria 12385
115 Ga0075436_100003245 3300006914 Bacteria 11142
116 Ga0075436_100236204 3300006914 Bacteria 1299
117 Ga0097620_100335805 3300006931 Bacteria 1605
118 Ga0075435_100010972 3300007076 Bacteria 6642
119 Ga0075435_100029647 3300007076 Bacteria 4296
120 Ga0075435_100135837 3300007076 Bacteria 2060
121 Ga0099794_10000738 3300007265 Bacteria 11010
122 Ga0099794_10005735 3300007265 Bacteria 5004
123 Ga0105240_10104170 3300009093 Bacteria 3445
124 Ga0105240_10132289 3300009093 Bacteria 2991
125 Ga0105240_10366424 3300009093 Bacteria 1631
126 Ga0111539_10003621 3300009094 Bacteria 20353
127 Ga0111539_10070087 3300009094 Bacteria 4138
128 Ga0105245_10164386 3300009098 Bacteria 2108
129 Ga0105245_10252616 3300009098 Bacteria 1713
130 Ga0105245_10612284 3300009098 Bacteria 1116
131 Ga0105247_10144497 3300009101 Bacteria 1562
132 Ga0114129_10001176 3300009147 Bacteria 34702
133 Ga0114129_10001788 3300009147 Bacteria 29288
134 Ga0114129_10361425 3300009147 Bacteria 1921
135 Ga0105243_10155893 3300009148 Bacteria 1964
136 Ga0105241_10032975 3300009174 Unclassified 3885
137 Ga0105242_10868133 3300009176 Bacteria 899
138 Ga0105242_11116067 3300009176 Bacteria 803
139 Ga0105237_10005032 3300009545 Bacteria 15049
140 Ga0105237_10256395 3300009545 Unclassified 1751
141 Ga0105238_10105106 3300009551 Bacteria 2805
142 Ga0105238_10212671 3300009551 Bacteria 1910
143 Ga0105249_10006755 3300009553 Bacteria 9997
144 Ga0105030_107289 3300009987 Bacteria 940
145 Ga0105239_10064574 3300010375 Bacteria 4018
146 Ga0105239_10076094 3300010375 Bacteria 3691
147 Ga0105239_10413774 3300010375 Bacteria 1527
148 Ga0105239_10691325 3300010375 Bacteria 1166
149 Ga0105246_10207809 3300011119 Bacteria 1526
150 Ga0105246_10337432 3300011119 Bacteria 1230
151 Ga0157371_10118799 3300013102 Bacteria 1879
152 Ga0157370_10907487 3300013104 Bacteria 799
153 Ga0157369_10314346 3300013105 Bacteria 1629
154 Ga0157374_10449161 3300013296 Bacteria 1290
155 Ga0163162_10087813 3300013306 Bacteria 3189
156 Ga0163162_10934773 3300013306 Bacteria 979
157 Ga0163162_11019529 3300013306 Bacteria 936
158 Ga0157372_11048172 3300013307 Bacteria 944
159 Ga0157375_10366935 3300013308 Bacteria 1606
160 Ga0157375_11281557 3300013308 Bacteria 861
161 Ga0163163_10149209 3300014325 Bacteria 2382
162 Ga0163163_10330838 3300014325 Bacteria 1578
163 Ga0163163_10335083 3300014325 Bacteria 1568
164 Ga0163163_11275127 3300014325 Bacteria 797
165 Ga0157380_10114603 3300014326 Bacteria 2272
166 Ga0157380_10715681 3300014326 Bacteria 1008
167 Ga0157380_11736769 3300014326 Bacteria 682
168 Ga0182008_10190802 3300014497 Bacteria 1040
169 Ga0157377_10572154 3300014745 Bacteria 801
170 Ga0157379_10071844 3300014968 Bacteria 3096
171 Ga0157379_10543268 3300014968 Bacteria 1081
172 Ga0157376_10131513 3300014969 Bacteria 2233
173 Ga0163161_10121492 3300017792 Bacteria 1963
174 Ga0163161_10358734 3300017792 Bacteria 1160
175 Ga0163161_10812098 3300017792 Bacteria 787
176 Ga0206356_10655547 3300020070 Bacteria 738
177 Ga0206351_10218445 3300020077 Bacteria 894
178 Ga0206352_11142661 3300020078 Bacteria 1464
179 Ga0206350_10065044 3300020080 Bacteria 749
180 Ga0206350_11464367 3300020080 Bacteria 1760
181 Ga0206353_11882339 3300020082 Bacteria 746
182 Ga0154015_1584249 3300020610 Bacteria 1990
183 Ga0213873_10000040 3300021358 Bacteria 32068
184 Ga0213876_10006253 3300021384 Bacteria 6494
185 Ga0213875_10132135 3300021388 Bacteria 1167
186 Ga0213875_10299607 3300021388 Bacteria 760
187 Ga0224712_10011100 3300022467 Bacteria 2780
188 Ga0224712_10289174 3300022467 Bacteria 764
189 Ga0209673_1032276 3300025273 Bacteria 1615
190 Ga0209051_1000014 3300025303 Bacteria 552732
191 Ga0209051_1000374 3300025303 Bacteria 64311
192 Ga0209051_1002709 3300025303 Bacteria 12325
193 Ga0209051_1014602 3300025303 Bacteria 3654
194 Ga0207696_1065610 3300025711 Bacteria 1015
195 Ga0207692_10461580 3300025898 Bacteria 801
196 Ga0207710_10003112 3300025900 Bacteria 7434
197 Ga0207688_10084319 3300025901 Bacteria 1819
198 Ga0207647_10023748 3300025904 Bacteria 4051
199 Ga0207647_10050650 3300025904 Bacteria 2570
200 Ga0207695_10131869 3300025913 Bacteria 2456
201 Ga0207695_10177631 3300025913 Bacteria 2051
202 Ga0207671_10005149 3300025914 Bacteria 12170
203 Ga0207671_10296864 3300025914 Unclassified 1276
204 Ga0207694_10024622 3300025924 Bacteria 4572
205 Ga0207694_10459915 3300025924 Bacteria 1063
206 Ga0207687_10202602 3300025927 Bacteria 1552
207 Ga0207700_10678459 3300025928 Bacteria 919
208 Ga0207664_10048736 3300025929 Bacteria 3333
209 Ga0207644_10412224 3300025931 Bacteria 1106
210 Ga0207690_10140246 3300025932 Bacteria 1780
211 Ga0207706_10149490 3300025933 Bacteria 2054
212 Ga0207706_10448380 3300025933 Bacteria 1116
213 Ga0207709_10012557 3300025935 Bacteria 4666
214 Ga0207670_10042649 3300025936 Bacteria 2991
215 Ga0207670_10529493 3300025936 Bacteria 960
216 Ga0207704_10347750 3300025938 Bacteria 1153
217 Ga0207691_10197216 3300025940 Bacteria 1753
218 Ga0207711_10067069 3300025941 Bacteria 3105
219 Ga0207661_10089038 3300025944 Bacteria 2567
220 Ga0207679_10777802 3300025945 Bacteria 872
221 Ga0207651_10019580 3300025960 Bacteria 4060
222 Ga0207712_10025993 3300025961 Bacteria 3895
223 Ga0207712_10112976 3300025961 Bacteria 2041
224 Ga0207668_10030967 3300025972 Bacteria 3520
225 Ga0207668_10281216 3300025972 Bacteria 1364
226 Ga0207658_10001419 3300025986 Bacteria 18686
227 Ga0207658_10123596 3300025986 Bacteria 2067
228 Ga0207658_11052320 3300025986 Bacteria 743
229 Ga0207677_10959291 3300026023 Bacteria 774
230 Ga0207703_10000807 3300026035 Bacteria 30856
231 Ga0207703_10031525 3300026035 Bacteria 4192
232 Ga0207639_10146750 3300026041 Bacteria 1971
233 Ga0207639_10356521 3300026041 Bacteria 1308
234 Ga0207678_10000934 3300026067 Bacteria 26626
235 Ga0207678_10025987 3300026067 Bacteria 5108
236 Ga0207678_10048715 3300026067 Bacteria 3662
237 Ga0207678_10411387 3300026067 Bacteria 1172
238 Ga0207702_10101417 3300026078 Bacteria 2541
239 Ga0207641_10001391 3300026088 Bacteria 23825
240 Ga0207641_10009686 3300026088 Bacteria 7938
241 Ga0207641_10347365 3300026088 Bacteria 1413
242 Ga0207641_11220657 3300026088 Bacteria 752
243 Ga0207648_10121817 3300026089 Bacteria 2293
244 Ga0207676_10247741 3300026095 Bacteria 1602
245 Ga0207676_10306952 3300026095 Bacteria 1451
246 Ga0207676_11073265 3300026095 Unclassified 795
247 Ga0207674_10465344 3300026116 Bacteria 1222
248 Ga0207674_11213387 3300026116 Bacteria 724
249 Ga0207675_100154406 3300026118 Bacteria 2187
250 Ga0207683_10324271 3300026121 Bacteria 1411
251 Ga0207683_10399725 3300026121 Bacteria 1264
252 Ga0207683_10862305 3300026121 Bacteria 841
253 Ga0207698_10977800 3300026142 Bacteria 856
254 Ga0209588_1005630 3300027671 Bacteria 3599
255 Ga0209588_1005692 3300027671 Bacteria 3582
256 Ga0209813_10016090 3300027866 Bacteria 2037
257 Ga0209813_10017468 3300027866 Bacteria 1969
258 Ga0207428_10000964 3300027907 Bacteria 31921
259 Ga0207428_10003341 3300027907 Bacteria 15600
260 Ga0268266_10002456 3300028379 Bacteria 19855
261 Ga0268266_10080032 3300028379 Bacteria 2846
262 Ga0268266_10674758 3300028379 Bacteria 995
263 Ga0268265_10012252 3300028380 Bacteria 5810
264 Ga0268264_10000085 3300028381 Bacteria 240739
265 Ga0268264_10090174 3300028381 Bacteria 2641
266 Ga0268264_10310987 3300028381 Bacteria 1486
267 Ga0268264_10433327 3300028381 Bacteria 1270
268 Ga0307517_10277239 3300028786 Bacteria 959
269 Ga0307515_10054821 3300028794 Bacteria 5843
270 Ga0307511_10001015 3300030521 Bacteria 29803
271 Ga0307511_10284115 3300030521 Bacteria 762
272 Ga0307512_10277320 3300030522 Bacteria 805
273 Ga0316183_1173540 3300030742 Bacteria 1677
274 Ga0316181_1159012 3300030744 Bacteria 2823
275 Ga0316182_1260240 3300030745 Bacteria 4329
276 Ga0265327_10000363 3300031251 Bacteria 86525
277 Ga0265327_10000718 3300031251 Bacteria 52146
278 Ga0265327_10005827 3300031251 Bacteria 10113
279 Ga0265327_10035317 3300031251 Bacteria 2765
280 Ga0307509_10231320 3300031507 Bacteria 1651
281 Ga0307508_10221891 3300031616 Bacteria 1490
282 Ga0307405_10030192 3300031731 Bacteria 3177
283 Ga0307405_10088021 3300031731 Bacteria 2048
284 Ga0307405_10578407 3300031731 Bacteria 913
285 Ga0307413_10125169 3300031824 Bacteria 1749
286 Ga0307413_10477033 3300031824 Bacteria 996
287 Ga0307518_10000537 3300031838 Bacteria 28756
288 Ga0307410_10141637 3300031852 Bacteria 1779
289 Ga0307406_10000821 3300031901 Bacteria 17418
290 Ga0307406_10002452 3300031901 Bacteria 10105
291 Ga0307406_10523530 3300031901 Bacteria 965
292 Ga0307407_10219850 3300031903 Bacteria 1284
293 Ga0307412_10858547 3300031911 Bacteria 792
294 Ga0307415_100321637 3300032126 Bacteria 1290
295 Ga0307415_100635628 3300032126 Bacteria 955
296 Ga0307507_10010108 3300033179 Bacteria 12323
297 Ga0307510_10000004 3300033180 Bacteria 654130
298 Ga0307510_10055559 3300033180 Bacteria 4134
299 Ga0373949_0028873 3300035090 Bacteria 1311
300 Ga0373949_0133861 3300035090 Bacteria 705
301 Ga0373935_0498783 3300035692 Bacteria 884
302 Ga0395898_0098556 3300037466 Bacteria 2807
303 Ga0436364_1009445 3300037853 Bacteria 41017
304 Ga0436364_1332711 3300037853 Bacteria 9840
305 Ga0436364_1469378 3300037853 Bacteria 4144
306 Ga0395901_0099814 3300038443 Bacteria 3044
307 Ga0400488_34785 3300038741 Bacteria 6935
308 Ga0436365_0812603 3300039437 Bacteria 22024
309 Ga0436365_1635789 3300039437 Bacteria 4260
310 Ga0436363_1213162 3300039450 Bacteria 4626
311 Ga0436362_0604286 3300039453 Bacteria 27368
312 Ga0439466_0004549 3300041411 Bacteria 5328
313 Ga0439465_0014624 3300041413 Bacteria 2447
314 Ga0439465_0058820 3300041413 Bacteria 1271
315 Ga0451789_0651037 3300041443 Bacteria 1305
316 Ga0451791_0061301 3300041451 Bacteria 1732
317 Ga0451793_0166662 3300041452 Bacteria 2954
318 Ga0451793_1384911 3300041452 Bacteria 1885
319 Ga0451797_0468809 3300041453 Bacteria 2421
320 Ga0451795_0568771 3300041456 Bacteria 1545
321 Ga0451795_0943970 3300041456 Bacteria 921
322 Ga0451800_1453589 3300041459 Bacteria 1799
323 Ga0451802_1877652 3300041460 Bacteria 1220
324 Ga0451807_0080565 3300041486 Bacteria 1190
325 Ga0451807_2367206 3300041486 Bacteria 1098
326 Ga0451837_0003726 3300041494 Bacteria 5607
327 Ga0451839_1156414 3300041496 Bacteria 858
328 Ga0451839_1205715 3300041496 Bacteria 1022
329 Ga0451839_1219122 3300041496 Bacteria 5247
330 Ga0451841_0503750 3300041498 Bacteria 1764
331 Ga0451847_0262175 3300041503 Bacteria 865
332 Ga0451843_0729029 3300041509 Bacteria 2841
333 Ga0439431_0000284 3300041997 Bacteria 10420
334 Ga0439445_0010564 3300042004 Bacteria 2187
335 Ga0439445_0019410 3300042004 Bacteria 1694
336 Ga0439432_086246 3300042006 Bacteria 947
337 Ga0439463_015653 3300042016 Bacteria 1876
338 Ga0450900_025738 3300042136 Bacteria 838
339 Ga0439446_0133855 3300042156 Bacteria 806
340 Ga0439434_0014629 3300042435 Bacteria 2335
341 Ga0439435_0103587 3300042436 Bacteria 877
342 Ga0439464_0002492 3300042439 Bacteria 4537
343 Ga0451577_0976459 3300042876 Bacteria 761
344 Ga0466972_0002342 3300044658 Bacteria 9334
345 Ga0466972_0004109 3300044658 Bacteria 7266
346 Ga0466972_0050109 3300044658 Bacteria 2016
347 Ga0466972_0246042 3300044658 Bacteria 836
348 Ga0466965_0036779 3300044683 Bacteria 2402
349 Ga0466965_0179684 3300044683 Bacteria 1116
350 Ga0466965_0319488 3300044683 Bacteria 845
351 Ga0466966_0561341 3300044684 Bacteria 687
352 Ga0466961_0437341 3300044693 Bacteria 792
353 Ga0466963_0062607 3300044694 Bacteria 2488
354 Ga0466963_0101767 3300044694 Bacteria 1967
355 Ga0466963_0321054 3300044694 Bacteria 1090
356 Ga0466963_0504683 3300044694 Bacteria 854
357 Ga0466971_0002362 3300044719 Bacteria 7967
358 Ga0466971_0300103 3300044719 Bacteria 771
359 Ga0466968_0010727 3300044735 Bacteria 3559
360 Ga0466968_0031758 3300044735 Bacteria 2192
361 Ga0466970_0000004 3300044765 Bacteria 108620
362 Ga0466970_0000304 3300044765 Bacteria 23970
363 Ga0466970_0011371 3300044765 Bacteria 4536
364 Ga0466970_0250350 3300044765 Bacteria 992
365 Ga0466957_0054983 3300044842 Bacteria 2431
366 Ga0466957_0074070 3300044842 Bacteria 2111
367 Ga0466960_0000501 3300044901 Bacteria 13397
368 Ga0466960_0000607 3300044901 Bacteria 12375
369 Ga0466960_0001790 3300044901 Bacteria 7889
370 Ga0466960_0042153 3300044901 Bacteria 2166
371 Ga0466958_0032928 3300045836 Bacteria 3086
372 Ga0466958_0655382 3300045836 Bacteria 683
373 Ga0466958_0661483 3300045836 Bacteria 680
374 Ga0466958_0671914 3300045836 Bacteria 674
375 Ga0466967_0004822 3300045976 Bacteria 9195
376 Ga0466967_0068759 3300045976 Bacteria 3163
377 Ga0466967_0128660 3300045976 Bacteria 2348
378 Ga0466967_0246404 3300045976 Bacteria 1705
379 Ga0466967_0281547 3300045976 Bacteria 1595
380 Ga0466967_1282063 3300045976 Bacteria 730
381 Ga0495627_000393 3300046453 Bacteria 39677
382 Ga0495641_0125160 3300046461 Bacteria 1147
383 Ga0495582_0262013 3300046473 Bacteria 992
384 Ga0495606_0059796 3300046507 Bacteria 2443
385 Ga0495606_0399448 3300046507 Bacteria 716
386 Ga0495648_0006724 3300046524 Bacteria 9302
387 Ga0495648_0325750 3300046524 Bacteria 710
388 Ga0495668_0011512 3300046616 Bacteria 5296
389 Ga0495611_0053461 3300046648 Bacteria 1823
390 Ga0495611_0139278 3300046648 Bacteria 1133
391 Ga0495649_0035963 3300046694 Bacteria 2723
392 Ga0495649_0132142 3300046694 Bacteria 1317
393 Ga0495581_0443533 3300047315 Bacteria 756
394 Ga0495672_0009376 3300047320 Bacteria 7098
395 Ga0495683_0001308 3300047323 Bacteria 16712
396 Ga0495673_0002913 3300047469 Bacteria 11603
397 Ga0495673_0126810 3300047469 Bacteria 1006
398 Ga0496100_0000087 3300048903 Bacteria 52650
399 Ga0496100_0001674 3300048903 Bacteria 11000
400 Ga0496100_0671962 3300048903 Unclassified 807
401 Ga0496101_0000034 3300048904 Bacteria 178045
402 Ga0496101_0000110 3300048904 Bacteria 85776
403 Ga0496102_0000006 3300048905 Bacteria 471494
404 Ga0496102_0004718 3300048905 Bacteria 11539
405 Ga0496102_0007220 3300048905 Bacteria 9481
406 Ga0496102_0241949 3300048905 Bacteria 1701
407 Ga0496102_0792706 3300048905 Bacteria 870
408 Ga0496103_0000006 3300048906 Bacteria 470539
409 Ga0496103_0005953 3300048906 Bacteria 7291
410 Ga0496103_0021452 3300048906 Bacteria 3886
411 Ga0496103_0458772 3300048906 Bacteria 817
412 Ga0496104_0444854 3300048907 Bacteria 1208
413 Ga0496106_0043502 3300048909 Bacteria 3370
414 Ga0496106_0056467 3300048909 Bacteria 2968
415 Ga0496107_0000108 3300048910 Bacteria 40403
416 Ga0496107_0026082 3300048910 Bacteria 4142
417 Ga0496108_0007784 3300048911 Bacteria 8679
418 Ga0496108_0277126 3300048911 Bacteria 1460
419 Ga0496108_0620931 3300048911 Bacteria 941
420 Ga0496109_0000127 3300048912 Bacteria 77905
421 Ga0496109_0701784 3300048912 Bacteria 949
422 Ga0496110_0000632 3300048913 Bacteria 24071
423 Ga0496111_0063969 3300048914 Bacteria 2668
424 Ga0496111_0115788 3300048914 Bacteria 1976
425 Ga0496111_0576243 3300048914 Bacteria 825
426 Ga0496114_0000277 3300048917 Bacteria 37457
427 Ga0496114_0008890 3300048917 Bacteria 7964
428 Ga0496114_0018770 3300048917 Bacteria 5598
429 Ga0496114_0170692 3300048917 Bacteria 1895
430 Ga0496114_0221967 3300048917 Bacteria 1659
431 Ga0496115_0330248 3300048918 Bacteria 1246
432 Ga0496116_0000025 3300048919 Bacteria 470539
433 Ga0496116_0004610 3300048919 Bacteria 13067
434 Ga0496116_0009881 3300048919 Bacteria 8070
435 Ga0496117_0000006 3300048920 Bacteria 758420
436 Ga0496117_0000627 3300048920 Bacteria 57244
437 Ga0496117_0003089 3300048920 Bacteria 19931
438 Ga0496117_0022600 3300048920 Bacteria 5040
439 Ga0496118_0000004 3300048921 Bacteria 758420
440 Ga0496118_0000026 3300048921 Bacteria 375725
441 Ga0496118_0005105 3300048921 Bacteria 15090
442 Ga0496118_0012406 3300048921 Bacteria 8184
443 Ga0496118_0163857 3300048921 Bacteria 1370
444 Ga0496119_0000035 3300048922 Bacteria 217007
445 Ga0496119_0001354 3300048922 Bacteria 29958
446 Ga0496119_0007860 3300048922 Bacteria 9498
447 Ga0496119_0031821 3300048922 Bacteria 3527
448 Ga0496119_0327567 3300048922 Bacteria 748
449 Ga0496120_0000706 3300048923 Bacteria 48969
450 Ga0496120_0000993 3300048923 Bacteria 38355
451 Ga0496120_0068725 3300048923 Bacteria 1953
452 Ga0496120_0170119 3300048923 Unclassified 1078
453 Ga0496121_0000040 3300048924 Bacteria 348494
454 Ga0496121_0000048 3300048924 Bacteria 330242
455 Ga0496121_0000090 3300048924 Bacteria 217920
456 Ga0496121_0003120 3300048924 Bacteria 23932
457 Ga0496122_0002047 3300048925 Bacteria 29932
458 Ga0496122_0203205 3300048925 Bacteria 1156
459 Ga0496122_0326539 3300048925 Bacteria 813
460 Ga0496123_0005077 3300048926 Bacteria 13448
461 Ga0496124_0000044 3300048927 Bacteria 289064
462 Ga0496124_0004491 3300048927 Bacteria 16281
463 Ga0496125_0000037 3300048928 Bacteria 330242
464 Ga0496125_0000797 3300048928 Bacteria 51430
465 Ga0496125_0006515 3300048928 Bacteria 12596
466 Ga0496125_0021790 3300048928 Bacteria 5962
467 Ga0496125_0051220 3300048928 Bacteria 3407
468 Ga0496126_0000046 3300048929 Bacteria 330242
469 Ga0496126_0001450 3300048929 Bacteria 37186
470 Ga0496126_0081083 3300048929 Bacteria 2869
471 Ga0496126_0140060 3300048929 Bacteria 2083
472 Ga0501311_036131 3300049527 Bacteria 734
473 Ga0501031_0174319 3300049568 Bacteria 1405
474 Ga0501032_0002384 3300049569 Bacteria 14666
475 Ga0501034_0011550 3300049571 Bacteria 9147
476 Ga0501034_0031705 3300049571 Bacteria 5368
477 Ga0501034_0584789 3300049571 Bacteria 1023
478 Ga0501036_0000459 3300049572 Bacteria 29154
479 Ga0501036_0024273 3300049572 Bacteria 5111
480 Ga0501037_0001507 3300049573 Bacteria 17018
481 Ga0501037_0010756 3300049573 Bacteria 6723
482 Ga0501038_0089186 3300049574 Bacteria 2587
483 Ga0501039_0000312 3300049575 Bacteria 34396
484 Ga0501039_0083026 3300049575 Bacteria 2495
485 Ga0501040_0026327 3300049576 Bacteria 3912
486 Ga0501042_0308864 3300049578 Bacteria 1142
487 Ga0501043_0003966 3300049579 Bacteria 12125
488 Ga0501043_0280794 3300049579 Bacteria 1276
489 Ga0501043_0476007 3300049579 Bacteria 936
490 Ga0501046_0000211 3300049580 Bacteria 60684
491 Ga0501046_0002714 3300049580 Bacteria 16475
492 Ga0501046_0234887 3300049580 Bacteria 1354
493 Ga0501047_0004432 3300049581 Bacteria 13217
494 Ga0501048_0000185 3300049582 Bacteria 39725
495 Ga0501048_0008617 3300049582 Bacteria 7701
496 Ga0501048_0208565 3300049582 Bacteria 1386
497 Ga0501067_0002625 3300049583 Bacteria 9951
498 Ga0501068_0077838 3300049584 Bacteria 2031
499 Ga0501068_0646423 3300049584 Bacteria 690
500 Ga0501069_0002840 3300049585 Bacteria 8866
501 Ga0501070_0000555 3300049586 Bacteria 34029
502 Ga0501070_0008107 3300049586 Bacteria 8891
503 Ga0501071_0015252 3300049587 Bacteria 5273
504 Ga0501071_0314702 3300049587 Bacteria 1188
505 Ga0501071_0464338 3300049587 Bacteria 969
506 Ga0501073_0027373 3300049589 Bacteria 4077
507 Ga0501074_0000871 3300049590 Bacteria 19250
508 Ga0501074_0131983 3300049590 Bacteria 1787
509 Ga0501075_0139526 3300049591 Bacteria 1847
510 Ga0501075_0258073 3300049591 Bacteria 1328
511 Ga0501080_0003956 3300049742 Bacteria 13115
512 Ga0501083_0030985 3300049744 Bacteria 3671
513 Ga0501035_0001560 3300049822 Bacteria 23346
514 Ga0501044_0003330 3300049823 Bacteria 18108
515 Ga0501044_0012905 3300049823 Bacteria 9043
516 nmdc:mga03683_13119_c1 3300050489 Bacteria 3043
517 nmdc:mga03683_292364_c1 3300050489 Bacteria 763
518 nmdc:mga03n38_104633_c1 3300050490 Bacteria 1370
519 nmdc:mga03n38_10873_c1 3300050490 Bacteria 3369
520 nmdc:mga03n38_13994_c1 3300050490 Bacteria 3064
521 nmdc:mga03n38_1445_c1 3300050490 Bacteria 6807
522 nmdc:mga03n38_24439_c1 3300050490 Bacteria 2471
523 nmdc:mga00v17_119386_c1 3300050491 Bacteria 1678
524 nmdc:mga00v17_1500_c1 3300050491 Bacteria 12189
525 nmdc:mga00v17_206142_c1 3300050491 Bacteria 1272
526 nmdc:mga00v17_2304_c1 3300050491 Bacteria 9793
527 nmdc:mga00v17_284749_c1 3300050491 Bacteria 1073
528 nmdc:mga00v17_2941_c1 3300050491 Bacteria 8741
529 nmdc:mga00v17_3307_c1 3300050491 Bacteria 3698
530 nmdc:mga00v17_3432_c1 3300050491 Bacteria 8189
531 nmdc:mga00v17_95465_c1 3300050491 Bacteria 1872
532 nmdc:mga0yw44_11204_c1 3300050492 Bacteria 4616
533 nmdc:mga0yw44_12390_c1 3300050492 Bacteria 4442
534 nmdc:mga0yw44_303579_c1 3300050492 Bacteria 1070
535 nmdc:mga0yw44_350591_c1 3300050492 Bacteria 993
536 nmdc:mga0yw44_85307_c1 3300050492 Bacteria 1987
537 nmdc:mga0k408_101285_c1 3300050493 Bacteria 1698
538 nmdc:mga06z11_189233_c1 3300050494 Bacteria 1191
539 nmdc:mga06z11_4627_c1 3300050494 Bacteria 5429
540 nmdc:mga06z11_7615_c1 3300050494 Bacteria 4469
541 nmdc:mga04h51_30398_c1 3300050495 Bacteria 1699
542 nmdc:mga04h51_71360_c1 3300050495 Bacteria 1213
543 nmdc:mga07m45_104000_c1 3300050496 Bacteria 1632
544 nmdc:mga07m45_183641_c1 3300050496 Bacteria 1216
545 nmdc:mga07m45_2158_c1 3300050496 Bacteria 9163
546 nmdc:mga07m45_3558_c1 3300050496 Bacteria 7524
547 nmdc:mga07m45_4451_c1 3300050496 Bacteria 6857
548 nmdc:mga07m45_74577_c1 3300050496 Bacteria 1933
549 nmdc:mga05p37_1020221_c1 3300050507 Bacteria 876
550 nmdc:mga05p37_10589_c1 3300050507 Bacteria 10937
551 nmdc:mga05p37_34311_c1 3300050507 Bacteria 6214
552 nmdc:mga09592_18311_c1 3300050508 Bacteria 5743
553 nmdc:mga06r32_24238_c1 3300050510 Bacteria 5628
554 nmdc:mga08y16_1043553_c1 3300050511 Bacteria 795
555 nmdc:mga08y16_278553_c1 3300050511 Bacteria 1726
556 nmdc:mga08y16_394039_c1 3300050511 Bacteria 1418
557 nmdc:mga08y16_72775_c1 3300050511 Bacteria 3582
558 nmdc:mga0n895_11598_c1 3300050512 Bacteria 7873
559 nmdc:mga0n895_132334_c1 3300050512 Bacteria 2520
560 nmdc:mga0rr50_21063_c1 3300050513 Bacteria 4443
561 nmdc:mga0rr50_7007_c1 3300050513 Bacteria 6917
562 nmdc:mga08x19_325399_c1 3300050514 Bacteria 1070
563 nmdc:mga08x19_4005_c1 3300050514 Bacteria 8768
564 nmdc:mga0a205_137500_c1 3300050515 Bacteria 2344
565 nmdc:mga0a205_208177_c1 3300050515 Bacteria 1845
566 nmdc:mga0a205_28133_c1 3300050515 Bacteria 5373
567 nmdc:mga0sz30_11381_c1 3300050516 Bacteria 3433
568 nmdc:mga0sz30_25827_c1 3300050516 Bacteria 2404
569 nmdc:mga0sz30_35294_c1 3300050516 Bacteria 2086
570 nmdc:mga0sz30_6651_c1 3300050516 Bacteria 4305
571 Ga0500644_0102943 3300053088 Bacteria 1088
572 Ga0500644_0183216 3300053088 Bacteria 858
573 Ga0500650_0316548 3300053098 Bacteria 688
574 Ga0500654_132538 3300053099 Bacteria 938
575 Ga0500642_0143918 3300053130 Bacteria 1119
576 Ga0500616_0014815 3300053153 Bacteria 4471
577 Ga0500639_254563 3300053163 Bacteria 700
578 Ga0500637_0004373 3300053178 Bacteria 6698
579 Ga0587084_003261 3300059477 Bacteria 1769
580 Ga0587066_011070 3300059490 Bacteria 1316
581 Ga0587070_001134 3300059491 Bacteria 2645
582 Ga0587073_0056959 3300059492 Bacteria 904
583 Ga0587077_060062 3300059493 Bacteria 821
584 Ga0587082_039780 3300059504 Bacteria 857
585 Ga0587083_0044997 3300059505 Bacteria 940
586 Ga0587088_002719 3300059508 Bacteria 2055
587 Ga0587092_000504 3300059512 Bacteria 3164
588 Ga0587094_004894 3300059513 Bacteria 1542
589 Ga0587097_00209 3300059603 Bacteria 1490
590 Ga0587125_000589 3300059607 Bacteria 2222
591 Ga0587101_000151 3300059623 Bacteria 3787
592 Ga0587109_027977 3300059624 Bacteria 1052
593 Ga0587113_015439 3300059625 Bacteria 757
594 Ga0587115_006793 3300059626 Bacteria 1332
595 Ga0587117_002855 3300059627 Bacteria 1663
596 Ga0587122_004021 3300059628 Bacteria 1167
597 Ga0587122_014792 3300059628 Bacteria 791
598 Ga0587128_006070 3300059630 Bacteria 1473
599 Ga0587069_004114 3300059642 Bacteria 1620
600 Ga0587075_015692 3300059644 Bacteria 1069
601 Ga0587075_033034 3300059644 Bacteria 833
602 Ga0587076_027062 3300059645 Bacteria 991
603 Ga0587079_090783 3300059647 Bacteria 714
604 Ga0587100_000082 3300059648 Bacteria 3477
605 Ga0587107_003205 3300059652 Bacteria 1565
606 Ga0587107_033495 3300059652 Bacteria 795
607 Ga0587114_009537 3300059655 Bacteria 1166
608 Ga0587111_0086014 3300060346 Bacteria 760
609 Ga0501082_0115320 3300060353 Bacteria 2327
610 Ga0501082_0238169 3300060353 Bacteria 1584

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049571 Ga0501034_0584789 Ga0501034_0584789_238_855 200
2 iso_pu_bacteria 2984576629 2984580351 202
3 iso_pu_bacteria 2990256926 2990258044 202
4 3300003316 rootH1_10021975 rootH1_100219752 203
5 3300003320 rootH2_10115003 rootH2_101150032 203
6 3300006048 Ga0075363_100164763 Ga0075363_1001647631 203
7 3300021358 Ga0213873_10000040 Ga0213873_1000004029 203
8 3300039453 Ga0436362_0604286 Ga0436362_0604286_5928_6560 203
9 3300042876 Ga0451577_0976459 Ga0451577_0976459_52_675 203
10 3300005335 Ga0070666_10148061 Ga0070666_101480612 204
11 3300005337 Ga0070682_100148263 Ga0070682_1001482631 204
12 3300005355 Ga0070671_100161721 Ga0070671_1001617212 204
13 3300005367 Ga0070667_100034375 Ga0070667_1000343751 204
14 3300005455 Ga0070663_100033919 Ga0070663_1000339195 204
15 3300005457 Ga0070662_100640234 Ga0070662_1006402341 204
16 3300005535 Ga0070684_100341013 Ga0070684_1003410131 204
17 3300005548 Ga0070665_100019267 Ga0070665_1000192676 204
18 3300005548 Ga0070665_100030195 Ga0070665_1000301952 204
19 3300005563 Ga0068855_100328541 Ga0068855_1003285412 204
20 3300005564 Ga0070664_100186793 Ga0070664_1001867934 204
21 3300005616 Ga0068852_100269682 Ga0068852_1002696824 204
22 3300005617 Ga0068859_100335786 Ga0068859_1003357862 204
23 3300005618 Ga0068864_100559063 Ga0068864_1005590632 204
24 3300005841 Ga0068863_100006671 Ga0068863_1000066714 204
25 3300005842 Ga0068858_100009215 Ga0068858_1000092159 204
26 3300005843 Ga0068860_100001398 Ga0068860_10000139818 204
27 3300006038 Ga0075365_10003782 Ga0075365_100037827 204
28 3300006042 Ga0075368_10011756 Ga0075368_100117563 204
29 3300006048 Ga0075363_100001275 Ga0075363_1000012756 204
30 3300006051 Ga0075364_10044222 Ga0075364_100442223 204
31 3300006177 Ga0075362_10013146 Ga0075362_100131464 204
32 3300006178 Ga0075367_10034537 Ga0075367_100345374 204
33 3300006195 Ga0075366_10112553 Ga0075366_101125532 204
34 3300006353 Ga0075370_10000831 Ga0075370_1000083112 204
35 3300006358 Ga0068871_100140176 Ga0068871_1001401762 204
36 3300006931 Ga0097620_100335805 Ga0097620_1003358052 204
37 3300009093 Ga0105240_10104170 Ga0105240_101041702 204
38 3300009093 Ga0105240_10132289 Ga0105240_101322893 204
39 3300009093 Ga0105240_10366424 Ga0105240_103664242 204
40 3300009101 Ga0105247_10144497 Ga0105247_101444972 204
41 3300010375 Ga0105239_10691325 Ga0105239_106913252 204
42 3300013296 Ga0157374_10449161 Ga0157374_104491612 204
43 3300013306 Ga0163162_10087813 Ga0163162_100878133 204
44 3300013306 Ga0163162_10934773 Ga0163162_109347731 204
45 3300014325 Ga0163163_10149209 Ga0163163_101492092 204
46 3300014325 Ga0163163_10335083 Ga0163163_103350831 204
47 3300014745 Ga0157377_10572154 Ga0157377_105721542 204
48 3300014968 Ga0157379_10071844 Ga0157379_100718442 204
49 3300014969 Ga0157376_10131513 Ga0157376_101315132 204
50 3300025904 Ga0207647_10050650 Ga0207647_100506502 204
51 3300025913 Ga0207695_10131869 Ga0207695_101318693 204
52 3300025913 Ga0207695_10177631 Ga0207695_101776313 204
53 3300025931 Ga0207644_10412224 Ga0207644_104122242 204
54 3300025933 Ga0207706_10448380 Ga0207706_104483802 204
55 3300025941 Ga0207711_10067069 Ga0207711_100670694 204
56 3300026023 Ga0207677_10959291 Ga0207677_109592912 204
57 3300026035 Ga0207703_10000807 Ga0207703_100008076 204
58 3300026041 Ga0207639_10146750 Ga0207639_101467502 204
59 3300026067 Ga0207678_10048715 Ga0207678_100487154 204
60 3300026078 Ga0207702_10101417 Ga0207702_101014174 204
61 3300026088 Ga0207641_10001391 Ga0207641_1000139116 204
62 3300026095 Ga0207676_10247741 Ga0207676_102477412 204
63 3300026116 Ga0207674_10465344 Ga0207674_104653441 204
64 3300027866 Ga0209813_10016090 Ga0209813_100160904 204
65 3300028379 Ga0268266_10002456 Ga0268266_100024564 204
66 3300028379 Ga0268266_10080032 Ga0268266_100800322 204
67 3300028380 Ga0268265_10012252 Ga0268265_100122521 204
68 3300028381 Ga0268264_10000085 Ga0268264_10000085120 204
69 3300031251 Ga0265327_10005827 Ga0265327_100058275 204
70 3300033180 Ga0307510_10000004 Ga0307510_10000004151 204
71 3300035692 Ga0373935_0498783 Ga0373935_0498783_150_764 204
72 3300038741 Ga0400488_34785 Ga0400488_34785_2942_3556 204
73 3300044694 Ga0466963_0321054 Ga0466963_0321054_311_925 204
74 3300046507 Ga0495606_0399448 Ga0495606_0399448_17_631 204
75 3300046524 Ga0495648_0325750 Ga0495648_0325750_14_628 204
76 3300046694 Ga0495649_0035963 Ga0495649_0035963_1923_2537 204
77 3300048903 Ga0496100_0671962 Ga0496100_0671962_40_654 204
78 3300048905 Ga0496102_0004718 Ga0496102_0004718_10847_11461 204
79 3300048906 Ga0496103_0021452 Ga0496103_0021452_1274_1888 204
80 3300048911 Ga0496108_0620931 Ga0496108_0620931_25_639 204
81 3300048917 Ga0496114_0018770 Ga0496114_0018770_4111_4725 204
82 3300048918 Ga0496115_0330248 Ga0496115_0330248_432_1046 204
83 3300048919 Ga0496116_0004610 Ga0496116_0004610_1315_1929 204
84 3300048920 Ga0496117_0000627 Ga0496117_0000627_32_646 204
85 3300048921 Ga0496118_0000026 Ga0496118_0000026_332111_332725 204
86 3300048921 Ga0496118_0163857 Ga0496118_0163857_240_854 204
87 3300048922 Ga0496119_0001354 Ga0496119_0001354_13213_13827 204
88 3300048922 Ga0496119_0031821 Ga0496119_0031821_2220_2834 204
89 3300048923 Ga0496120_0000993 Ga0496120_0000993_29644_30258 204
90 3300048923 Ga0496120_0170119 Ga0496120_0170119_53_667 204
91 3300048927 Ga0496124_0004491 Ga0496124_0004491_10883_11497 204
92 3300048928 Ga0496125_0000797 Ga0496125_0000797_35368_35982 204
93 3300048928 Ga0496125_0051220 Ga0496125_0051220_2644_3258 204
94 3300049568 Ga0501031_0174319 Ga0501031_0174319_189_803 204
95 3300049580 Ga0501046_0234887 Ga0501046_0234887_587_1201 204
96 3300049582 Ga0501048_0208565 Ga0501048_0208565_733_1347 204
97 3300049587 Ga0501071_0314702 Ga0501071_0314702_295_909 204
98 3300049590 Ga0501074_0131983 Ga0501074_0131983_1158_1772 204
99 3300049591 Ga0501075_0139526 Ga0501075_0139526_330_944 204
100 3300050489 nmdc:mga03683_13119_c1 nmdc:mga03683_13119_c1_1742_2356 204
101 3300050490 nmdc:mga03n38_10873_c1 nmdc:mga03n38_10873_c1_878_1492 204
102 3300050491 nmdc:mga00v17_2941_c1 nmdc:mga00v17_2941_c1_4603_5217 204
103 3300050492 nmdc:mga0yw44_12390_c1 nmdc:mga0yw44_12390_c1_3478_4092 204
104 3300050493 nmdc:mga0k408_101285_c1 nmdc:mga0k408_101285_c1_977_1591 204
105 3300050494 nmdc:mga06z11_4627_c1 nmdc:mga06z11_4627_c1_3938_4552 204
106 3300050494 nmdc:mga06z11_4627_c1 nmdc:mga06z11_4627_c1_927_1541 204
107 3300050495 nmdc:mga04h51_30398_c1 nmdc:mga04h51_30398_c1_461_1075 204
108 3300050496 nmdc:mga07m45_3558_c1 nmdc:mga07m45_3558_c1_4290_4904 204
109 3300050507 nmdc:mga05p37_1020221_c1 nmdc:mga05p37_1020221_c1_157_771 204
110 3300050511 nmdc:mga08y16_394039_c1 nmdc:mga08y16_394039_c1_613_1227 204
111 3300053088 Ga0500644_0183216 Ga0500644_0183216_130_744 204
112 3300053163 Ga0500639_254563 Ga0500639_254563_66_680 204
113 3300059645 Ga0587076_027062 Ga0587076_027062_361_975 204
114 3300060353 Ga0501082_0115320 Ga0501082_0115320_1684_2298 204
115 iso_pu_bacteria 2643221632 2644183529 204
116 3300003308 Ga0006777J48905_1075518 Ga0006777J48905_10755181 205
117 3300003693 Ga0032354_1110763 Ga0032354_11107631 205
118 3300005367 Ga0070667_100217744 Ga0070667_1002177441 205
119 3300005563 Ga0068855_100206407 Ga0068855_1002064072 205
120 3300005843 Ga0068860_101159170 Ga0068860_1011591701 205
121 3300005937 Ga0081455_10013608 Ga0081455_100136084 205
122 3300006051 Ga0075364_10026964 Ga0075364_100269645 205
123 3300006353 Ga0075370_10057888 Ga0075370_100578882 205
124 3300006353 Ga0075370_10350692 Ga0075370_103506921 205
125 3300007265 Ga0099794_10005735 Ga0099794_100057355 205
126 3300009987 Ga0105030_107289 Ga0105030_1072892 205
127 3300010375 Ga0105239_10076094 Ga0105239_100760943 205
128 3300025986 Ga0207658_11052320 Ga0207658_110523201 205
129 3300027671 Ga0209588_1005692 Ga0209588_10056924 205
130 3300028381 Ga0268264_10310987 Ga0268264_103109873 205
131 3300030744 Ga0316181_1159012 Ga0316181_11590122 205
132 3300030745 Ga0316182_1260240 Ga0316182_12602401 205
133 3300041413 Ga0439465_0014624 Ga0439465_0014624_1674_2294 205
134 3300041413 Ga0439465_0058820 Ga0439465_0058820_402_1022 205
135 3300041456 Ga0451795_0943970 Ga0451795_0943970_216_833 205
136 3300041494 Ga0451837_0003726 Ga0451837_0003726_637_1254 205
137 3300041496 Ga0451839_1219122 Ga0451839_1219122_2954_3571 205
138 3300042004 Ga0439445_0019410 Ga0439445_0019410_426_1046 205
139 3300042006 Ga0439432_086246 Ga0439432_086246_135_755 205
140 3300042156 Ga0439446_0133855 Ga0439446_0133855_32_652 205
141 3300046507 Ga0495606_0059796 Ga0495606_0059796_519_1136 205
142 3300046524 Ga0495648_0006724 Ga0495648_0006724_3532_4149 205
143 3300046616 Ga0495668_0011512 Ga0495668_0011512_2695_3312 205
144 3300046648 Ga0495611_0053461 Ga0495611_0053461_412_1029 205
145 3300047320 Ga0495672_0009376 Ga0495672_0009376_5619_6236 205
146 3300047469 Ga0495673_0002913 Ga0495673_0002913_200_817 205
147 3300048903 Ga0496100_0001674 Ga0496100_0001674_7037_7654 205
148 3300048904 Ga0496101_0000110 Ga0496101_0000110_81610_82227 205
149 3300048905 Ga0496102_0000006 Ga0496102_0000006_258093_258710 205
150 3300048906 Ga0496103_0000006 Ga0496103_0000006_257891_258508 205
151 3300048910 Ga0496107_0026082 Ga0496107_0026082_3013_3630 205
152 3300048914 Ga0496111_0576243 Ga0496111_0576243_11_628 205
153 3300048919 Ga0496116_0000025 Ga0496116_0000025_212032_212649 205
154 3300048920 Ga0496117_0000006 Ga0496117_0000006_212032_212649 205
155 3300048921 Ga0496118_0000004 Ga0496118_0000004_212032_212649 205
156 3300048922 Ga0496119_0000035 Ga0496119_0000035_3627_4244 205
157 3300048923 Ga0496120_0000706 Ga0496120_0000706_25547_26164 205
158 3300048924 Ga0496121_0000090 Ga0496121_0000090_163933_164550 205
159 3300048929 Ga0496126_0001450 Ga0496126_0001450_15749_16366 205
160 3300049584 Ga0501068_0646423 Ga0501068_0646423_57_674 205
161 3300049591 Ga0501075_0258073 Ga0501075_0258073_34_651 205
162 3300050491 nmdc:mga00v17_3307_c1 nmdc:mga00v17_3307_c1_1079_1840 205
163 3300050496 nmdc:mga07m45_183641_c1 nmdc:mga07m45_183641_c1_428_1048 205
164 3300003792 Ga0055540_1003784 Ga0055540_10037846 206
165 3300005937 Ga0081455_10000207 Ga0081455_1000020755 206
166 3300006038 Ga0075365_10058912 Ga0075365_100589122 206
167 3300006038 Ga0075365_10077292 Ga0075365_100772922 206
168 3300006038 Ga0075365_10321481 Ga0075365_103214812 206
169 3300006048 Ga0075363_100001042 Ga0075363_1000010425 206
170 3300006048 Ga0075363_100147015 Ga0075363_1001470152 206
171 3300006051 Ga0075364_10001524 Ga0075364_1000152412 206
172 3300006177 Ga0075362_10161873 Ga0075362_101618732 206
173 3300006178 Ga0075367_10197659 Ga0075367_101976592 206
174 3300006186 Ga0075369_10009203 Ga0075369_100092033 206
175 3300006186 Ga0075369_10011183 Ga0075369_100111833 206
176 3300006186 Ga0075369_10031646 Ga0075369_100316463 206
177 3300006186 Ga0075369_10044045 Ga0075369_100440453 206
178 3300006186 Ga0075369_10084148 Ga0075369_100841482 206
179 3300006353 Ga0075370_10000679 Ga0075370_100006798 206
180 3300006353 Ga0075370_10019884 Ga0075370_100198843 206
181 3300025273 Ga0209673_1032276 Ga0209673_10322763 206
182 3300025303 Ga0209051_1000374 Ga0209051_100037449 206
183 3300025303 Ga0209051_1002709 Ga0209051_100270910 206
184 3300025303 Ga0209051_1014602 Ga0209051_10146022 206
185 3300026067 Ga0207678_10025987 Ga0207678_100259873 206
186 3300027866 Ga0209813_10017468 Ga0209813_100174682 206
187 3300031852 Ga0307410_10141637 Ga0307410_101416372 206
188 3300031903 Ga0307407_10219850 Ga0307407_102198502 206
189 3300032126 Ga0307415_100635628 Ga0307415_1006356282 206
190 3300041452 Ga0451793_1384911 Ga0451793_1384911_659_1279 206
191 3300041456 Ga0451795_0568771 Ga0451795_0568771_69_689 206
192 3300044684 Ga0466966_0561341 Ga0466966_0561341_56_676 206
193 3300045976 Ga0466967_0068759 Ga0466967_0068759_1937_2557 206
194 3300049580 Ga0501046_0000211 Ga0501046_0000211_19726_20346 206
195 3300050489 nmdc:mga03683_292364_c1 nmdc:mga03683_292364_c1_91_711 206
196 3300050490 nmdc:mga03n38_104633_c1 nmdc:mga03n38_104633_c1_32_652 206
197 3300050490 nmdc:mga03n38_1445_c1 nmdc:mga03n38_1445_c1_1697_2317 206
198 3300050490 nmdc:mga03n38_24439_c1 nmdc:mga03n38_24439_c1_1735_2355 206
199 3300050491 nmdc:mga00v17_119386_c1 nmdc:mga00v17_119386_c1_306_926 206
200 3300050491 nmdc:mga00v17_284749_c1 nmdc:mga00v17_284749_c1_263_883 206
201 3300050491 nmdc:mga00v17_3432_c1 nmdc:mga00v17_3432_c1_245_865 206
202 3300050492 nmdc:mga0yw44_11204_c1 nmdc:mga0yw44_11204_c1_174_794 206
203 3300050492 nmdc:mga0yw44_303579_c1 nmdc:mga0yw44_303579_c1_435_1055 206
204 3300050492 nmdc:mga0yw44_85307_c1 nmdc:mga0yw44_85307_c1_343_963 206
205 3300050494 nmdc:mga06z11_189233_c1 nmdc:mga06z11_189233_c1_394_1014 206
206 3300050494 nmdc:mga06z11_7615_c1 nmdc:mga06z11_7615_c1_3593_4213 206
207 3300050495 nmdc:mga04h51_71360_c1 nmdc:mga04h51_71360_c1_315_935 206
208 3300050496 nmdc:mga07m45_2158_c1 nmdc:mga07m45_2158_c1_7747_8367 206
209 3300050496 nmdc:mga07m45_4451_c1 nmdc:mga07m45_4451_c1_2777_3397 206
210 3300050516 nmdc:mga0sz30_11381_c1 nmdc:mga0sz30_11381_c1_859_1479 206
211 3300050516 nmdc:mga0sz30_25827_c1 nmdc:mga0sz30_25827_c1_1313_1933 206
212 3300050516 nmdc:mga0sz30_35294_c1 nmdc:mga0sz30_35294_c1_537_1157 206
213 3300050516 nmdc:mga0sz30_6651_c1 nmdc:mga0sz30_6651_c1_2742_3362 206
214 3300053130 Ga0500642_0143918 Ga0500642_0143918_274_894 206
215 3300053153 Ga0500616_0014815 Ga0500616_0014815_1724_2344 206
216 3300059625 Ga0587113_015439 Ga0587113_015439_109_729 206
217 3300059628 Ga0587122_014792 Ga0587122_014792_149_769 206
218 3300059647 Ga0587079_090783 Ga0587079_090783_80_700 206
219 3300059652 Ga0587107_033495 Ga0587107_033495_151_771 206
220 3300060346 Ga0587111_0086014 Ga0587111_0086014_44_664 206
221 3300003792 Ga0055540_1000038 Ga0055540_1000038136 207
222 3300005329 Ga0070683_100157648 Ga0070683_1001576481 207
223 3300005335 Ga0070666_10025598 Ga0070666_100255983 207
224 3300005337 Ga0070682_100155270 Ga0070682_1001552702 207
225 3300005367 Ga0070667_100000883 Ga0070667_10000088311 207
226 3300005435 Ga0070714_100594129 Ga0070714_1005941292 207
227 3300005436 Ga0070713_100692151 Ga0070713_1006921511 207
228 3300005455 Ga0070663_100004514 Ga0070663_1000045146 207
229 3300005456 Ga0070678_100280349 Ga0070678_1002803492 207
230 3300005456 Ga0070678_100829076 Ga0070678_1008290761 207
231 3300005535 Ga0070684_100209224 Ga0070684_1002092243 207
232 3300005535 Ga0070684_100637972 Ga0070684_1006379722 207
233 3300005548 Ga0070665_101633095 Ga0070665_1016330951 207
234 3300005615 Ga0070702_100391043 Ga0070702_1003910431 207
235 3300005616 Ga0068852_100516158 Ga0068852_1005161583 207
236 3300005718 Ga0068866_10453684 Ga0068866_104536841 207
237 3300005841 Ga0068863_100856370 Ga0068863_1008563701 207
238 3300005842 Ga0068858_100425812 Ga0068858_1004258121 207
239 3300006028 Ga0070717_10286919 Ga0070717_102869193 207
240 3300006051 Ga0075364_10024010 Ga0075364_100240105 207
241 3300006051 Ga0075364_10039469 Ga0075364_100394693 207
242 3300006177 Ga0075362_10158376 Ga0075362_101583762 207
243 3300006178 Ga0075367_10240779 Ga0075367_102407792 207
244 3300006353 Ga0075370_10078689 Ga0075370_100786891 207
245 3300009098 Ga0105245_10252616 Ga0105245_102526162 207
246 3300009098 Ga0105245_10612284 Ga0105245_106122841 207
247 3300009176 Ga0105242_11116067 Ga0105242_111160671 207
248 3300009545 Ga0105237_10005032 Ga0105237_1000503212 207
249 3300010375 Ga0105239_10064574 Ga0105239_100645741 207
250 3300011119 Ga0105246_10207809 Ga0105246_102078092 207
251 3300011119 Ga0105246_10337432 Ga0105246_103374321 207
252 3300013104 Ga0157370_10907487 Ga0157370_109074871 207
253 3300013105 Ga0157369_10314346 Ga0157369_103143461 207
254 3300013306 Ga0163162_11019529 Ga0163162_110195291 207
255 3300013308 Ga0157375_11281557 Ga0157375_112815572 207
256 3300014325 Ga0163163_11275127 Ga0163163_112751271 207
257 3300014326 Ga0157380_11736769 Ga0157380_117367691 207
258 3300017792 Ga0163161_10358734 Ga0163161_103587342 207
259 3300020080 Ga0206350_10065044 Ga0206350_100650441 207
260 3300020610 Ga0154015_1584249 Ga0154015_15842492 207
261 3300021384 Ga0213876_10006253 Ga0213876_100062536 207
262 3300021388 Ga0213875_10132135 Ga0213875_101321351 207
263 3300021388 Ga0213875_10299607 Ga0213875_102996071 207
264 3300025303 Ga0209051_1000014 Ga0209051_1000014206 207
265 3300025898 Ga0207692_10461580 Ga0207692_104615801 207
266 3300025914 Ga0207671_10005149 Ga0207671_1000514915 207
267 3300025928 Ga0207700_10678459 Ga0207700_106784591 207
268 3300025929 Ga0207664_10048736 Ga0207664_100487365 207
269 3300025938 Ga0207704_10347750 Ga0207704_103477502 207
270 3300025944 Ga0207661_10089038 Ga0207661_100890382 207
271 3300025972 Ga0207668_10281216 Ga0207668_102812161 207
272 3300025986 Ga0207658_10001419 Ga0207658_1000141915 207
273 3300026067 Ga0207678_10000934 Ga0207678_100009344 207
274 3300026067 Ga0207678_10411387 Ga0207678_104113872 207
275 3300026088 Ga0207641_11220657 Ga0207641_112206572 207
276 3300026116 Ga0207674_11213387 Ga0207674_112133871 207
277 3300026121 Ga0207683_10324271 Ga0207683_103242712 207
278 3300026121 Ga0207683_10862305 Ga0207683_108623052 207
279 3300028786 Ga0307517_10277239 Ga0307517_102772391 207
280 3300028794 Ga0307515_10054821 Ga0307515_100548213 207
281 3300030521 Ga0307511_10284115 Ga0307511_102841151 207
282 3300030522 Ga0307512_10277320 Ga0307512_102773201 207
283 3300030742 Ga0316183_1173540 Ga0316183_11735401 207
284 3300031251 Ga0265327_10000363 Ga0265327_1000036315 207
285 3300031251 Ga0265327_10000718 Ga0265327_1000071813 207
286 3300031251 Ga0265327_10035317 Ga0265327_100353173 207
287 3300031507 Ga0307509_10231320 Ga0307509_102313202 207
288 3300031731 Ga0307405_10088021 Ga0307405_100880213 207
289 3300031824 Ga0307413_10125169 Ga0307413_101251691 207
290 3300031838 Ga0307518_10000537 Ga0307518_1000053714 207
291 3300033179 Ga0307507_10010108 Ga0307507_1001010810 207
292 3300033180 Ga0307510_10055559 Ga0307510_100555592 207
293 3300035090 Ga0373949_0133861 Ga0373949_0133861_58_681 207
294 3300037853 Ga0436364_1009445 Ga0436364_1009445_21876_22499 207
295 3300037853 Ga0436364_1332711 Ga0436364_1332711_4304_4927 207
296 3300037853 Ga0436364_1469378 Ga0436364_1469378_3485_4108 207
297 3300039437 Ga0436365_0812603 Ga0436365_0812603_3372_3995 207
298 3300039437 Ga0436365_1635789 Ga0436365_1635789_1790_2413 207
299 3300039450 Ga0436363_1213162 Ga0436363_1213162_3229_3852 207
300 3300041411 Ga0439466_0004549 Ga0439466_0004549_4089_4712 207
301 3300041443 Ga0451789_0651037 Ga0451789_0651037_37_660 207
302 3300041451 Ga0451791_0061301 Ga0451791_0061301_999_1622 207
303 3300041452 Ga0451793_0166662 Ga0451793_0166662_70_693 207
304 3300041453 Ga0451797_0468809 Ga0451797_0468809_81_704 207
305 3300041459 Ga0451800_1453589 Ga0451800_1453589_62_685 207
306 3300041460 Ga0451802_1877652 Ga0451802_1877652_549_1172 207
307 3300041486 Ga0451807_0080565 Ga0451807_0080565_206_829 207
308 3300041496 Ga0451839_1156414 Ga0451839_1156414_190_813 207
309 3300041496 Ga0451839_1205715 Ga0451839_1205715_286_909 207
310 3300041498 Ga0451841_0503750 Ga0451841_0503750_433_1056 207
311 3300041503 Ga0451847_0262175 Ga0451847_0262175_83_706 207
312 3300041509 Ga0451843_0729029 Ga0451843_0729029_1958_2581 207
313 3300041997 Ga0439431_0000284 Ga0439431_0000284_7830_8453 207
314 3300042004 Ga0439445_0010564 Ga0439445_0010564_706_1329 207
315 3300042435 Ga0439434_0014629 Ga0439434_0014629_761_1384 207
316 3300042436 Ga0439435_0103587 Ga0439435_0103587_40_663 207
317 3300044658 Ga0466972_0002342 Ga0466972_0002342_4647_5270 207
318 3300044658 Ga0466972_0004109 Ga0466972_0004109_6367_6990 207
319 3300044658 Ga0466972_0050109 Ga0466972_0050109_79_702 207
320 3300044658 Ga0466972_0246042 Ga0466972_0246042_49_672 207
321 3300044683 Ga0466965_0036779 Ga0466965_0036779_717_1340 207
322 3300044683 Ga0466965_0179684 Ga0466965_0179684_232_855 207
323 3300044683 Ga0466965_0319488 Ga0466965_0319488_188_811 207
324 3300044693 Ga0466961_0437341 Ga0466961_0437341_121_744 207
325 3300044694 Ga0466963_0062607 Ga0466963_0062607_1779_2402 207
326 3300044694 Ga0466963_0101767 Ga0466963_0101767_1053_1676 207
327 3300044694 Ga0466963_0504683 Ga0466963_0504683_174_797 207
328 3300044719 Ga0466971_0002362 Ga0466971_0002362_3693_4316 207
329 3300044719 Ga0466971_0300103 Ga0466971_0300103_125_748 207
330 3300044735 Ga0466968_0031758 Ga0466968_0031758_755_1378 207
331 3300044765 Ga0466970_0011371 Ga0466970_0011371_1063_1686 207
332 3300044842 Ga0466957_0054983 Ga0466957_0054983_1288_1911 207
333 3300044901 Ga0466960_0000501 Ga0466960_0000501_3138_3761 207
334 3300044901 Ga0466960_0000607 Ga0466960_0000607_6821_7444 207
335 3300044901 Ga0466960_0001790 Ga0466960_0001790_2645_3268 207
336 3300044901 Ga0466960_0042153 Ga0466960_0042153_1199_1822 207
337 3300045836 Ga0466958_0032928 Ga0466958_0032928_1800_2423 207
338 3300045836 Ga0466958_0655382 Ga0466958_0655382_39_662 207
339 3300045836 Ga0466958_0661483 Ga0466958_0661483_42_665 207
340 3300045976 Ga0466967_0004822 Ga0466967_0004822_3115_3738 207
341 3300045976 Ga0466967_0128660 Ga0466967_0128660_1080_1703 207
342 3300045976 Ga0466967_0281547 Ga0466967_0281547_81_704 207
343 3300046461 Ga0495641_0125160 Ga0495641_0125160_467_1090 207
344 3300046473 Ga0495582_0262013 Ga0495582_0262013_166_789 207
345 3300047323 Ga0495683_0001308 Ga0495683_0001308_8911_9534 207
346 3300048903 Ga0496100_0000087 Ga0496100_0000087_13807_14430 207
347 3300048904 Ga0496101_0000034 Ga0496101_0000034_131856_132479 207
348 3300048905 Ga0496102_0007220 Ga0496102_0007220_2270_2893 207
349 3300048905 Ga0496102_0241949 Ga0496102_0241949_84_707 207
350 3300048905 Ga0496102_0792706 Ga0496102_0792706_186_809 207
351 3300048906 Ga0496103_0005953 Ga0496103_0005953_2626_3249 207
352 3300048907 Ga0496104_0444854 Ga0496104_0444854_326_949 207
353 3300048909 Ga0496106_0043502 Ga0496106_0043502_1340_1963 207
354 3300048909 Ga0496106_0056467 Ga0496106_0056467_1423_2046 207
355 3300048910 Ga0496107_0000108 Ga0496107_0000108_14066_14689 207
356 3300048911 Ga0496108_0007784 Ga0496108_0007784_7834_8457 207
357 3300048911 Ga0496108_0277126 Ga0496108_0277126_500_1123 207
358 3300048912 Ga0496109_0000127 Ga0496109_0000127_31864_32487 207
359 3300048913 Ga0496110_0000632 Ga0496110_0000632_10204_10827 207
360 3300048914 Ga0496111_0063969 Ga0496111_0063969_557_1180 207
361 3300048917 Ga0496114_0000277 Ga0496114_0000277_1288_1911 207
362 3300048917 Ga0496114_0170692 Ga0496114_0170692_954_1577 207
363 3300048919 Ga0496116_0009881 Ga0496116_0009881_2056_2679 207
364 3300048920 Ga0496117_0022600 Ga0496117_0022600_198_821 207
365 3300048921 Ga0496118_0012406 Ga0496118_0012406_3678_4301 207
366 3300048922 Ga0496119_0007860 Ga0496119_0007860_4529_5152 207
367 3300048924 Ga0496121_0000048 Ga0496121_0000048_135746_136369 207
368 3300048925 Ga0496122_0002047 Ga0496122_0002047_6870_7493 207
369 3300048926 Ga0496123_0005077 Ga0496123_0005077_11408_12031 207
370 3300048927 Ga0496124_0000044 Ga0496124_0000044_193874_194497 207
371 3300048928 Ga0496125_0000037 Ga0496125_0000037_135746_136369 207
372 3300048929 Ga0496126_0000046 Ga0496126_0000046_135746_136369 207
373 3300049569 Ga0501032_0002384 Ga0501032_0002384_13768_14391 207
374 3300049571 Ga0501034_0011550 Ga0501034_0011550_8491_9114 207
375 3300049571 Ga0501034_0031705 Ga0501034_0031705_4343_4966 207
376 3300049572 Ga0501036_0024273 Ga0501036_0024273_3498_4121 207
377 3300049573 Ga0501037_0001507 Ga0501037_0001507_10809_11432 207
378 3300049573 Ga0501037_0010756 Ga0501037_0010756_186_809 207
379 3300049575 Ga0501039_0000312 Ga0501039_0000312_30797_31420 207
380 3300049579 Ga0501043_0003966 Ga0501043_0003966_5784_6407 207
381 3300049579 Ga0501043_0280794 Ga0501043_0280794_588_1211 207
382 3300049580 Ga0501046_0002714 Ga0501046_0002714_3924_4547 207
383 3300049581 Ga0501047_0004432 Ga0501047_0004432_11978_12601 207
384 3300049582 Ga0501048_0008617 Ga0501048_0008617_3856_4479 207
385 3300049586 Ga0501070_0000555 Ga0501070_0000555_15173_15796 207
386 3300049586 Ga0501070_0008107 Ga0501070_0008107_4413_5036 207
387 3300049587 Ga0501071_0464338 Ga0501071_0464338_30_653 207
388 3300049589 Ga0501073_0027373 Ga0501073_0027373_2272_2895 207
389 3300049822 Ga0501035_0001560 Ga0501035_0001560_3876_4499 207
390 3300049823 Ga0501044_0003330 Ga0501044_0003330_12663_13286 207
391 3300049823 Ga0501044_0012905 Ga0501044_0012905_5352_5975 207
392 3300050490 nmdc:mga03n38_13994_c1 nmdc:mga03n38_13994_c1_1120_1743 207
393 3300050491 nmdc:mga00v17_1500_c1 nmdc:mga00v17_1500_c1_359_982 207
394 3300050491 nmdc:mga00v17_206142_c1 nmdc:mga00v17_206142_c1_633_1256 207
395 3300050491 nmdc:mga00v17_2304_c1 nmdc:mga00v17_2304_c1_951_1574 207
396 3300050491 nmdc:mga00v17_95465_c1 nmdc:mga00v17_95465_c1_801_1424 207
397 3300050496 nmdc:mga07m45_104000_c1 nmdc:mga07m45_104000_c1_135_758 207
398 3300050496 nmdc:mga07m45_74577_c1 nmdc:mga07m45_74577_c1_424_1047 207
399 3300050511 nmdc:mga08y16_1043553_c1 nmdc:mga08y16_1043553_c1_139_762 207
400 3300053088 Ga0500644_0102943 Ga0500644_0102943_385_1008 207
401 3300053098 Ga0500650_0316548 Ga0500650_0316548_33_656 207
402 3300053099 Ga0500654_132538 Ga0500654_132538_171_794 207
403 3300059492 Ga0587073_0056959 Ga0587073_0056959_109_732 207
404 3300059644 Ga0587075_033034 Ga0587075_033034_125_748 207
405 3300001979 JGI24740J21852_10005429 JGI24740J21852_100054297 208
406 3300003373 JGI25407J50210_10005288 JGI25407J50210_100052881 208
407 3300003559 Ga0007427J51700_105926 Ga0007427J51700_1059261 208
408 3300003735 Ga0006780_1008331 Ga0006780_10083311 208
409 3300005334 Ga0068869_100147204 Ga0068869_1001472041 208
410 3300005337 Ga0070682_100322331 Ga0070682_1003223312 208
411 3300005347 Ga0070668_100042491 Ga0070668_1000424913 208
412 3300005347 Ga0070668_100159624 Ga0070668_1001596241 208
413 3300005366 Ga0070659_100052957 Ga0070659_1000529572 208
414 3300005444 Ga0070694_100840447 Ga0070694_1008404471 208
415 3300005457 Ga0070662_100019711 Ga0070662_1000197113 208
416 3300005539 Ga0068853_100588154 Ga0068853_1005881542 208
417 3300005548 Ga0070665_100063466 Ga0070665_1000634663 208
418 3300005577 Ga0068857_100212955 Ga0068857_1002129552 208
419 3300005616 Ga0068852_100320633 Ga0068852_1003206332 208
420 3300005618 Ga0068864_100513670 Ga0068864_1005136702 208
421 3300005719 Ga0068861_100033383 Ga0068861_1000333834 208
422 3300005841 Ga0068863_100339613 Ga0068863_1003396132 208
423 3300005843 Ga0068860_100108047 Ga0068860_1001080473 208
424 3300005844 Ga0068862_100323257 Ga0068862_1003232571 208
425 3300005937 Ga0081455_10064417 Ga0081455_100644173 208
426 3300005981 Ga0081538_10000264 Ga0081538_1000026452 208
427 3300005985 Ga0081539_10000238 Ga0081539_10000238100 208
428 3300006051 Ga0075364_10061223 Ga0075364_100612231 208
429 3300006058 Ga0075432_10000510 Ga0075432_100005103 208
430 3300006058 Ga0075432_10004766 Ga0075432_100047663 208
431 3300006844 Ga0075428_100027233 Ga0075428_1000272335 208
432 3300006844 Ga0075428_100706748 Ga0075428_1007067482 208
433 3300006847 Ga0075431_100021145 Ga0075431_1000211454 208
434 3300006852 Ga0075433_10001532 Ga0075433_1000153215 208
435 3300006852 Ga0075433_10079522 Ga0075433_100795224 208
436 3300006852 Ga0075433_10110140 Ga0075433_101101402 208
437 3300006871 Ga0075434_100015448 Ga0075434_1000154485 208
438 3300006871 Ga0075434_100016447 Ga0075434_1000164474 208
439 3300006880 Ga0075429_100004156 Ga0075429_1000041567 208
440 3300006914 Ga0075436_100003245 Ga0075436_1000032459 208
441 3300006914 Ga0075436_100236204 Ga0075436_1002362041 208
442 3300007076 Ga0075435_100010972 Ga0075435_1000109728 208
443 3300007076 Ga0075435_100029647 Ga0075435_1000296474 208
444 3300007076 Ga0075435_100135837 Ga0075435_1001358373 208
445 3300007265 Ga0099794_10000738 Ga0099794_100007386 208
446 3300009094 Ga0111539_10003621 Ga0111539_1000362114 208
447 3300009094 Ga0111539_10070087 Ga0111539_100700872 208
448 3300009098 Ga0105245_10164386 Ga0105245_101643863 208
449 3300009147 Ga0114129_10001176 Ga0114129_1000117613 208
450 3300009147 Ga0114129_10001788 Ga0114129_100017887 208
451 3300009147 Ga0114129_10361425 Ga0114129_103614252 208
452 3300009148 Ga0105243_10155893 Ga0105243_101558932 208
453 3300009174 Ga0105241_10032975 Ga0105241_100329751 208
454 3300009176 Ga0105242_10868133 Ga0105242_108681331 208
455 3300009545 Ga0105237_10256395 Ga0105237_102563952 208
456 3300009551 Ga0105238_10105106 Ga0105238_101051061 208
457 3300009551 Ga0105238_10212671 Ga0105238_102126712 208
458 3300009553 Ga0105249_10006755 Ga0105249_100067551 208
459 3300010375 Ga0105239_10413774 Ga0105239_104137742 208
460 3300013102 Ga0157371_10118799 Ga0157371_101187992 208
461 3300013307 Ga0157372_11048172 Ga0157372_110481721 208
462 3300013308 Ga0157375_10366935 Ga0157375_103669352 208
463 3300014325 Ga0163163_10330838 Ga0163163_103308382 208
464 3300014326 Ga0157380_10114603 Ga0157380_101146033 208
465 3300014326 Ga0157380_10715681 Ga0157380_107156811 208
466 3300014497 Ga0182008_10190802 Ga0182008_101908021 208
467 3300014968 Ga0157379_10543268 Ga0157379_105432682 208
468 3300017792 Ga0163161_10121492 Ga0163161_101214921 208
469 3300017792 Ga0163161_10812098 Ga0163161_108120981 208
470 3300020070 Ga0206356_10655547 Ga0206356_106555471 208
471 3300020077 Ga0206351_10218445 Ga0206351_102184452 208
472 3300020078 Ga0206352_11142661 Ga0206352_111426611 208
473 3300020080 Ga0206350_11464367 Ga0206350_114643672 208
474 3300020082 Ga0206353_11882339 Ga0206353_118823391 208
475 3300022467 Ga0224712_10011100 Ga0224712_100111003 208
476 3300022467 Ga0224712_10289174 Ga0224712_102891741 208
477 3300025711 Ga0207696_1065610 Ga0207696_10656102 208
478 3300025900 Ga0207710_10003112 Ga0207710_100031126 208
479 3300025901 Ga0207688_10084319 Ga0207688_100843192 208
480 3300025904 Ga0207647_10023748 Ga0207647_100237482 208
481 3300025914 Ga0207671_10296864 Ga0207671_102968642 208
482 3300025924 Ga0207694_10024622 Ga0207694_100246221 208
483 3300025924 Ga0207694_10459915 Ga0207694_104599152 208
484 3300025927 Ga0207687_10202602 Ga0207687_102026022 208
485 3300025932 Ga0207690_10140246 Ga0207690_101402462 208
486 3300025933 Ga0207706_10149490 Ga0207706_101494902 208
487 3300025935 Ga0207709_10012557 Ga0207709_100125572 208
488 3300025936 Ga0207670_10042649 Ga0207670_100426491 208
489 3300025936 Ga0207670_10529493 Ga0207670_105294931 208
490 3300025940 Ga0207691_10197216 Ga0207691_101972162 208
491 3300025945 Ga0207679_10777802 Ga0207679_107778021 208
492 3300025960 Ga0207651_10019580 Ga0207651_100195802 208
493 3300025961 Ga0207712_10025993 Ga0207712_100259934 208
494 3300025961 Ga0207712_10112976 Ga0207712_101129762 208
495 3300025972 Ga0207668_10030967 Ga0207668_100309673 208
496 3300025986 Ga0207658_10123596 Ga0207658_101235962 208
497 3300026035 Ga0207703_10031525 Ga0207703_100315255 208
498 3300026041 Ga0207639_10356521 Ga0207639_103565212 208
499 3300026088 Ga0207641_10009686 Ga0207641_100096863 208
500 3300026088 Ga0207641_10347365 Ga0207641_103473652 208
501 3300026089 Ga0207648_10121817 Ga0207648_101218173 208
502 3300026095 Ga0207676_10306952 Ga0207676_103069522 208
503 3300026095 Ga0207676_11073265 Ga0207676_110732652 208
504 3300026118 Ga0207675_100154406 Ga0207675_1001544063 208
505 3300026121 Ga0207683_10399725 Ga0207683_103997252 208
506 3300026142 Ga0207698_10977800 Ga0207698_109778001 208
507 3300027671 Ga0209588_1005630 Ga0209588_10056304 208
508 3300027907 Ga0207428_10000964 Ga0207428_100009644 208
509 3300027907 Ga0207428_10003341 Ga0207428_100033412 208
510 3300028379 Ga0268266_10674758 Ga0268266_106747582 208
511 3300028381 Ga0268264_10090174 Ga0268264_100901742 208
512 3300028381 Ga0268264_10433327 Ga0268264_104333271 208
513 3300030521 Ga0307511_10001015 Ga0307511_1000101521 208
514 3300031616 Ga0307508_10221891 Ga0307508_102218912 208
515 3300031731 Ga0307405_10030192 Ga0307405_100301922 208
516 3300031731 Ga0307405_10578407 Ga0307405_105784072 208
517 3300031824 Ga0307413_10477033 Ga0307413_104770331 208
518 3300031901 Ga0307406_10000821 Ga0307406_1000082115 208
519 3300031901 Ga0307406_10002452 Ga0307406_100024523 208
520 3300031901 Ga0307406_10523530 Ga0307406_105235301 208
521 3300031911 Ga0307412_10858547 Ga0307412_108585471 208
522 3300032126 Ga0307415_100321637 Ga0307415_1003216372 208
523 3300035090 Ga0373949_0028873 Ga0373949_0028873_23_664 208
524 3300037466 Ga0395898_0098556 Ga0395898_0098556_115_741 208
525 3300038443 Ga0395901_0099814 Ga0395901_0099814_1232_1936 208
526 3300041486 Ga0451807_2367206 Ga0451807_2367206_260_886 208
527 3300042016 Ga0439463_015653 Ga0439463_015653_78_704 208
528 3300042136 Ga0450900_025738 Ga0450900_025738_143_769 208
529 3300042439 Ga0439464_0002492 Ga0439464_0002492_1136_1762 208
530 3300044735 Ga0466968_0010727 Ga0466968_0010727_531_1157 208
531 3300044765 Ga0466970_0000004 Ga0466970_0000004_107946_108587 208
532 3300044765 Ga0466970_0000304 Ga0466970_0000304_16894_17538 208
533 3300044765 Ga0466970_0250350 Ga0466970_0250350_311_940 208
534 3300044842 Ga0466957_0074070 Ga0466957_0074070_1295_1924 208
535 3300045836 Ga0466958_0671914 Ga0466958_0671914_19_645 208
536 3300045976 Ga0466967_0246404 Ga0466967_0246404_439_1068 208
537 3300045976 Ga0466967_1282063 Ga0466967_1282063_23_664 208
538 3300046453 Ga0495627_000393 Ga0495627_000393_4466_5092 208
539 3300046648 Ga0495611_0139278 Ga0495611_0139278_54_683 208
540 3300046694 Ga0495649_0132142 Ga0495649_0132142_580_1269 208
541 3300047315 Ga0495581_0443533 Ga0495581_0443533_15_656 208
542 3300047469 Ga0495673_0126810 Ga0495673_0126810_219_929 208
543 3300048906 Ga0496103_0458772 Ga0496103_0458772_93_725 208
544 3300048912 Ga0496109_0701784 Ga0496109_0701784_272_898 208
545 3300048914 Ga0496111_0115788 Ga0496111_0115788_652_1281 208
546 3300048917 Ga0496114_0008890 Ga0496114_0008890_3618_4247 208
547 3300048917 Ga0496114_0221967 Ga0496114_0221967_621_1247 208
548 3300048920 Ga0496117_0003089 Ga0496117_0003089_1820_2461 208
549 3300048921 Ga0496118_0005105 Ga0496118_0005105_7589_8230 208
550 3300048922 Ga0496119_0327567 Ga0496119_0327567_59_691 208
551 3300048923 Ga0496120_0068725 Ga0496120_0068725_96_722 208
552 3300048924 Ga0496121_0000040 Ga0496121_0000040_166549_167175 208
553 3300048924 Ga0496121_0003120 Ga0496121_0003120_12058_12690 208
554 3300048925 Ga0496122_0203205 Ga0496122_0203205_268_894 208
555 3300048925 Ga0496122_0326539 Ga0496122_0326539_87_728 208
556 3300048928 Ga0496125_0006515 Ga0496125_0006515_1979_2611 208
557 3300048928 Ga0496125_0021790 Ga0496125_0021790_2935_3576 208
558 3300048929 Ga0496126_0081083 Ga0496126_0081083_212_838 208
559 3300048929 Ga0496126_0140060 Ga0496126_0140060_1250_1891 208
560 3300049527 Ga0501311_036131 Ga0501311_036131_49_675 208
561 3300049572 Ga0501036_0000459 Ga0501036_0000459_13447_14073 208
562 3300049574 Ga0501038_0089186 Ga0501038_0089186_1652_2293 208
563 3300049575 Ga0501039_0083026 Ga0501039_0083026_668_1294 208
564 3300049576 Ga0501040_0026327 Ga0501040_0026327_802_1428 208
565 3300049578 Ga0501042_0308864 Ga0501042_0308864_494_1120 208
566 3300049579 Ga0501043_0476007 Ga0501043_0476007_134_760 208
567 3300049582 Ga0501048_0000185 Ga0501048_0000185_35168_35794 208
568 3300049583 Ga0501067_0002625 Ga0501067_0002625_6298_6924 208
569 3300049584 Ga0501068_0077838 Ga0501068_0077838_14_640 208
570 3300049585 Ga0501069_0002840 Ga0501069_0002840_3964_4590 208
571 3300049587 Ga0501071_0015252 Ga0501071_0015252_2954_3580 208
572 3300049590 Ga0501074_0000871 Ga0501074_0000871_4441_5067 208
573 3300049742 Ga0501080_0003956 Ga0501080_0003956_8598_9224 208
574 3300049744 Ga0501083_0030985 Ga0501083_0030985_389_1015 208
575 3300050492 nmdc:mga0yw44_350591_c1 nmdc:mga0yw44_350591_c1_262_903 208
576 3300050507 nmdc:mga05p37_10589_c1 nmdc:mga05p37_10589_c1_8517_9143 208
577 3300050507 nmdc:mga05p37_34311_c1 nmdc:mga05p37_34311_c1_45_707 208
578 3300050508 nmdc:mga09592_18311_c1 nmdc:mga09592_18311_c1_4907_5533 208
579 3300050510 nmdc:mga06r32_24238_c1 nmdc:mga06r32_24238_c1_2696_3322 208
580 3300050511 nmdc:mga08y16_278553_c1 nmdc:mga08y16_278553_c1_991_1617 208
581 3300050511 nmdc:mga08y16_72775_c1 nmdc:mga08y16_72775_c1_2698_3324 208
582 3300050512 nmdc:mga0n895_11598_c1 nmdc:mga0n895_11598_c1_3050_3676 208
583 3300050512 nmdc:mga0n895_132334_c1 nmdc:mga0n895_132334_c1_1664_2290 208
584 3300050513 nmdc:mga0rr50_21063_c1 nmdc:mga0rr50_21063_c1_1724_2350 208
585 3300050513 nmdc:mga0rr50_7007_c1 nmdc:mga0rr50_7007_c1_2038_2664 208
586 3300050514 nmdc:mga08x19_325399_c1 nmdc:mga08x19_325399_c1_428_1057 208
587 3300050514 nmdc:mga08x19_4005_c1 nmdc:mga08x19_4005_c1_932_1558 208
588 3300050515 nmdc:mga0a205_137500_c1 nmdc:mga0a205_137500_c1_97_723 208
589 3300050515 nmdc:mga0a205_208177_c1 nmdc:mga0a205_208177_c1_95_799 208
590 3300050515 nmdc:mga0a205_28133_c1 nmdc:mga0a205_28133_c1_3189_3815 208
591 3300053178 Ga0500637_0004373 Ga0500637_0004373_2758_3390 208
592 3300059477 Ga0587084_003261 Ga0587084_003261_380_1021 208
593 3300059490 Ga0587066_011070 Ga0587066_011070_586_1218 208
594 3300059491 Ga0587070_001134 Ga0587070_001134_1862_2503 208
595 3300059493 Ga0587077_060062 Ga0587077_060062_96_728 208
596 3300059504 Ga0587082_039780 Ga0587082_039780_34_660 208
597 3300059505 Ga0587083_0044997 Ga0587083_0044997_244_876 208
598 3300059508 Ga0587088_002719 Ga0587088_002719_162_803 208
599 3300059512 Ga0587092_000504 Ga0587092_000504_402_1043 208
600 3300059513 Ga0587094_004894 Ga0587094_004894_179_820 208
601 3300059603 Ga0587097_00209 Ga0587097_00209_169_810 208
602 3300059607 Ga0587125_000589 Ga0587125_000589_1327_1968 208
603 3300059623 Ga0587101_000151 Ga0587101_000151_299_940 208
604 3300059624 Ga0587109_027977 Ga0587109_027977_251_892 208
605 3300059626 Ga0587115_006793 Ga0587115_006793_370_1011 208
606 3300059627 Ga0587117_002855 Ga0587117_002855_727_1368 208
607 3300059628 Ga0587122_004021 Ga0587122_004021_131_772 208
608 3300059630 Ga0587128_006070 Ga0587128_006070_100_741 208
609 3300059642 Ga0587069_004114 Ga0587069_004114_810_1451 208
610 3300059644 Ga0587075_015692 Ga0587075_015692_417_1049 208
611 3300059648 Ga0587100_000082 Ga0587100_000082_186_827 208
612 3300059652 Ga0587107_003205 Ga0587107_003205_108_749 208
613 3300059655 Ga0587114_009537 Ga0587114_009537_481_1113 208
614 3300060353 Ga0501082_0238169 Ga0501082_0238169_363_989 208
615 iso_pu_bacteria 2946033335 2946033503 208

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00081

Sod_Fe_N

Iron/manganese superoxide dismutases, alpha-hairpin domain

29

110

0.98

PF02777

Sod_Fe_C

Iron/manganese superoxide dismutases, C-terminal domain

117

219

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1gn4-assembly1.cif.gz_D h145e mutant of mycobacterium tuberculosis iron-superoxide dismutase. 0.9712 2 197
1gn2-assembly1.cif.gz_A s123c mutant of the iron-superoxide dismutase from mycobacterium tuberculosis. 0.9708 2 197
1gn6-assembly1.cif.gz_A g152a mutant of mycobacterium tuberculosis iron-superoxide dismutase. 0.9704 2 197
1ids-assembly1.cif.gz_C x-ray structure analysis of the iron-dependent superoxide dismutase from mycobacterium tuberculosis at 2.0 angstroms resolutions reveals novel dimer-dimer interactions 0.9703 2 197
1gn3-assembly1.cif.gz_A h145q mutant of mycobacterium tuberculosis iron-superoxide dismutase. 0.9686 2 197
ID Description Score Start End Superfamily
af_P9WGE7_21_84_1.10.287.990 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Fe,Mn superoxide dismutase (SOD) domain 0.9979 21 84 1.10.287.990
1idsB01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Fe,Mn superoxide dismutase (SOD) domain 0.997 21 84 1.10.287.990
1idsC01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Fe,Mn superoxide dismutase (SOD) domain 0.9967 21 84 1.10.287.990
1ar4B01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Fe,Mn superoxide dismutase (SOD) domain 0.9967 21 84 1.10.287.990
1ar4A01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Fe,Mn superoxide dismutase (SOD) domain 0.9965 21 84 1.10.287.990
ID Description Score Start End GO Terms
AF-A0A2V6SUL7-F1-model_v4 Superoxide dismutase (EC 1.15.1.1) 0.9913 1 139 GO:0004784
GO:0046872
AF-A0A0C2W735-F1-model_v4 superoxide dismutase (EC 1.15.1.1) 0.991 4 113 GO:0004784
GO:0046872
AF-A0A6N7ZP99-F1-model_v4 Superoxide dismutase (EC 1.15.1.1) 0.9905 7 123 GO:0004784
GO:0046872
AF-A0A2P0ZG51-F1-model_v4 Superoxide dismutase (EC 1.15.1.1) 0.9904 27 162 GO:0004784
GO:0046872
AF-A0A1I2QXU2-F1-model_v4 superoxide dismutase (EC 1.15.1.1) 0.9904 2 115 GO:0004784
GO:0046872

Feature Viewer

pLDDT pTM Quality
93.1 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map