F469474
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 615 | 330 | 610 | 208 |
Family's Representative Sequence
| Representative Sequence | 3300047469|Ga0495673_0126810|Ga0495673_0126810_219_929 |
| Length | 236 |
| Sequence | MKRVDKTVRMKLASAKVSHEKPKETHMTRYTLPDLPYDYGALEPHLAGAIMQLHHDKHHRAYVDGANKTIEKLAELRRDDKFESVAALEHALAFNVSGHVLHSIFWQNLTPKGGGTPGGELASAIERDFGGFEKFKKQLIQTAATVTGSGWAALVWEPVGQRLATTQIHDHQSQVTQGSVPLLVLDVWEHAYYLQYKNEKLKYFESVWNLWNWEDVGKRYAKARAVDLGIVGTARS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221632 | Leifsonia sp. Root112D2 | Isolate | Unclassified |
| 2 | 2946033335 | Microbacterium sp. W4I4 | Isolate | Rhizosphere |
| 3 | 2984576629 | Nocardioides zeae SORGH_AS913 | Isolate | Aerial Root |
| 4 | 2990256926 | Nocardioides zeae SORGH_AS885 | Isolate | Aerial Root |
| 5 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 6 | 3300003308 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 7 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 8 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 9 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 10 | 3300003559 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 11 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 12 | 3300003735 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 13 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 14 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 30 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 32 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 34 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 36 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 37 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 38 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 39 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 40 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 41 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 42 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 43 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 44 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 45 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 46 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 47 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 49 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 50 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 51 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 52 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 53 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 54 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 55 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 56 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 57 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 58 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 59 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 60 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 61 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 62 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 63 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 64 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 65 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 67 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 68 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009987 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG | Metagenome | Rhizosphere |
| 80 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 92 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 97 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 98 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 99 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 100 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 101 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 102 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 103 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 104 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 105 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 106 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 107 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 148 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 152 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 153 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 154 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 155 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 156 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 157 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 158 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 159 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 160 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 161 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 162 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 163 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 164 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 165 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 166 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 167 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 168 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 169 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 170 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 171 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 172 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 173 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 174 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 175 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 176 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 177 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 178 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 179 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 180 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 181 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 182 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 183 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 184 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 185 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 186 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 187 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 188 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 189 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 190 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 191 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 192 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 193 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 194 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 195 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 196 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 197 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 198 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 199 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 200 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 201 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 202 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 203 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 204 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 205 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 206 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 207 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 208 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 209 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 210 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 211 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 212 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 213 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 214 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 215 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 216 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 217 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 230 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 231 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 232 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 233 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 234 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 235 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 236 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 237 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 238 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 239 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 240 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 241 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 242 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 243 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 244 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 245 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 246 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 247 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 248 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 249 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 250 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 251 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 252 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 253 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 254 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 280 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 281 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 282 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 283 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 284 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 285 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 286 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 287 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 292 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 295 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 296 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 297 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 298 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 299 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 300 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 301 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 302 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 303 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 304 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 305 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 306 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 307 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 308 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 309 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 310 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 311 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 312 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 313 | 3300059603 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 62R_AD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 314 | 3300059607 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 315 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 316 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 317 | 3300059625 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 318 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 319 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 320 | 3300059628 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 321 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 322 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 323 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 324 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 325 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 326 | 3300059648 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 327 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 328 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 329 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 330 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.2 |
| Metatranscriptomes | 7.15 |
| Isolates | 0.65 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.33 |
| Bulb | 0 |
| Endosphere | 14.31 |
| Nodule | 0 |
| Rhizoplane | 7.32 |
| Rhizosphere | 66.5 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.54 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10005429 | 3300001979 | Bacteria | 5389 |
| 2 | Ga0006777J48905_1075518 | 3300003308 | Bacteria | 657 |
| 3 | rootH1_10021975 | 3300003316 | Bacteria | 4381 |
| 4 | rootH2_10115003 | 3300003320 | Bacteria | 2642 |
| 5 | JGI25407J50210_10005288 | 3300003373 | Bacteria | 3168 |
| 6 | Ga0007427J51700_105926 | 3300003559 | Bacteria | 2148 |
| 7 | Ga0032354_1110763 | 3300003693 | Bacteria | 648 |
| 8 | Ga0006780_1008331 | 3300003735 | Bacteria | 3645 |
| 9 | Ga0055540_1000038 | 3300003792 | Bacteria | 161988 |
| 10 | Ga0055540_1003784 | 3300003792 | Bacteria | 7132 |
| 11 | Ga0070683_100157648 | 3300005329 | Bacteria | 2153 |
| 12 | Ga0068869_100147204 | 3300005334 | Bacteria | 1824 |
| 13 | Ga0070666_10025598 | 3300005335 | Bacteria | 3848 |
| 14 | Ga0070666_10148061 | 3300005335 | Bacteria | 1637 |
| 15 | Ga0070682_100148263 | 3300005337 | Bacteria | 1607 |
| 16 | Ga0070682_100155270 | 3300005337 | Bacteria | 1575 |
| 17 | Ga0070682_100322331 | 3300005337 | Bacteria | 1142 |
| 18 | Ga0070668_100042491 | 3300005347 | Bacteria | 3485 |
| 19 | Ga0070668_100159624 | 3300005347 | Bacteria | 1829 |
| 20 | Ga0070671_100161721 | 3300005355 | Bacteria | 1893 |
| 21 | Ga0070659_100052957 | 3300005366 | Bacteria | 3194 |
| 22 | Ga0070667_100000883 | 3300005367 | Bacteria | 27691 |
| 23 | Ga0070667_100034375 | 3300005367 | Bacteria | 4240 |
| 24 | Ga0070667_100217744 | 3300005367 | Bacteria | 1699 |
| 25 | Ga0070714_100594129 | 3300005435 | Bacteria | 1063 |
| 26 | Ga0070713_100692151 | 3300005436 | Bacteria | 973 |
| 27 | Ga0070694_100840447 | 3300005444 | Bacteria | 755 |
| 28 | Ga0070663_100004514 | 3300005455 | Bacteria | 8197 |
| 29 | Ga0070663_100033919 | 3300005455 | Bacteria | 3530 |
| 30 | Ga0070678_100280349 | 3300005456 | Bacteria | 1409 |
| 31 | Ga0070678_100829076 | 3300005456 | Bacteria | 841 |
| 32 | Ga0070662_100019711 | 3300005457 | Bacteria | 4583 |
| 33 | Ga0070662_100640234 | 3300005457 | Bacteria | 896 |
| 34 | Ga0070684_100209224 | 3300005535 | Bacteria | 1778 |
| 35 | Ga0070684_100341013 | 3300005535 | Bacteria | 1378 |
| 36 | Ga0070684_100637972 | 3300005535 | Bacteria | 991 |
| 37 | Ga0068853_100588154 | 3300005539 | Bacteria | 1056 |
| 38 | Ga0070665_100019267 | 3300005548 | Bacteria | 6846 |
| 39 | Ga0070665_100030195 | 3300005548 | Bacteria | 5455 |
| 40 | Ga0070665_100063466 | 3300005548 | Bacteria | 3704 |
| 41 | Ga0070665_101633095 | 3300005548 | Bacteria | 652 |
| 42 | Ga0068855_100206407 | 3300005563 | Bacteria | 2210 |
| 43 | Ga0068855_100328541 | 3300005563 | Bacteria | 1689 |
| 44 | Ga0070664_100186793 | 3300005564 | Bacteria | 1845 |
| 45 | Ga0068857_100212955 | 3300005577 | Bacteria | 1763 |
| 46 | Ga0070702_100391043 | 3300005615 | Bacteria | 992 |
| 47 | Ga0068852_100269682 | 3300005616 | Bacteria | 1637 |
| 48 | Ga0068852_100320633 | 3300005616 | Bacteria | 1505 |
| 49 | Ga0068852_100516158 | 3300005616 | Bacteria | 1192 |
| 50 | Ga0068859_100335786 | 3300005617 | Bacteria | 1605 |
| 51 | Ga0068864_100513670 | 3300005618 | Bacteria | 1154 |
| 52 | Ga0068864_100559063 | 3300005618 | Bacteria | 1107 |
| 53 | Ga0068866_10453684 | 3300005718 | Bacteria | 839 |
| 54 | Ga0068861_100033383 | 3300005719 | Bacteria | 3795 |
| 55 | Ga0068863_100006671 | 3300005841 | Bacteria | 11330 |
| 56 | Ga0068863_100339613 | 3300005841 | Bacteria | 1461 |
| 57 | Ga0068863_100856370 | 3300005841 | Bacteria | 908 |
| 58 | Ga0068858_100009215 | 3300005842 | Bacteria | 9428 |
| 59 | Ga0068858_100425812 | 3300005842 | Bacteria | 1277 |
| 60 | Ga0068860_100001398 | 3300005843 | Bacteria | 26152 |
| 61 | Ga0068860_100108047 | 3300005843 | Bacteria | 2659 |
| 62 | Ga0068860_101159170 | 3300005843 | Bacteria | 793 |
| 63 | Ga0068862_100323257 | 3300005844 | Bacteria | 1425 |
| 64 | Ga0081455_10000207 | 3300005937 | Bacteria | 74809 |
| 65 | Ga0081455_10013608 | 3300005937 | Bacteria | 8016 |
| 66 | Ga0081455_10064417 | 3300005937 | Bacteria | 3069 |
| 67 | Ga0081538_10000264 | 3300005981 | Bacteria | 59881 |
| 68 | Ga0081539_10000238 | 3300005985 | Bacteria | 129119 |
| 69 | Ga0070717_10286919 | 3300006028 | Bacteria | 1461 |
| 70 | Ga0075365_10003782 | 3300006038 | Bacteria | 7887 |
| 71 | Ga0075365_10058912 | 3300006038 | Bacteria | 2558 |
| 72 | Ga0075365_10077292 | 3300006038 | Bacteria | 2249 |
| 73 | Ga0075365_10321481 | 3300006038 | Bacteria | 1090 |
| 74 | Ga0075368_10011756 | 3300006042 | Bacteria | 3191 |
| 75 | Ga0075363_100001042 | 3300006048 | Bacteria | 9980 |
| 76 | Ga0075363_100001275 | 3300006048 | Bacteria | 9367 |
| 77 | Ga0075363_100147015 | 3300006048 | Bacteria | 1329 |
| 78 | Ga0075363_100164763 | 3300006048 | Bacteria | 1256 |
| 79 | Ga0075364_10001524 | 3300006051 | Bacteria | 12621 |
| 80 | Ga0075364_10024010 | 3300006051 | Bacteria | 3866 |
| 81 | Ga0075364_10026964 | 3300006051 | Bacteria | 3668 |
| 82 | Ga0075364_10039469 | 3300006051 | Bacteria | 3060 |
| 83 | Ga0075364_10044222 | 3300006051 | Bacteria | 2896 |
| 84 | Ga0075364_10061223 | 3300006051 | Bacteria | 2468 |
| 85 | Ga0075432_10000510 | 3300006058 | Bacteria | 11647 |
| 86 | Ga0075432_10004766 | 3300006058 | Bacteria | 4617 |
| 87 | Ga0075362_10013146 | 3300006177 | Bacteria | 3306 |
| 88 | Ga0075362_10158376 | 3300006177 | Bacteria | 1089 |
| 89 | Ga0075362_10161873 | 3300006177 | Bacteria | 1078 |
| 90 | Ga0075367_10034537 | 3300006178 | Bacteria | 2922 |
| 91 | Ga0075367_10197659 | 3300006178 | Bacteria | 1256 |
| 92 | Ga0075367_10240779 | 3300006178 | Bacteria | 1134 |
| 93 | Ga0075369_10009203 | 3300006186 | Bacteria | 3829 |
| 94 | Ga0075369_10011183 | 3300006186 | Bacteria | 3525 |
| 95 | Ga0075369_10031646 | 3300006186 | Bacteria | 2235 |
| 96 | Ga0075369_10044045 | 3300006186 | Bacteria | 1917 |
| 97 | Ga0075369_10084148 | 3300006186 | Bacteria | 1413 |
| 98 | Ga0075366_10112553 | 3300006195 | Bacteria | 1638 |
| 99 | Ga0075370_10000679 | 3300006353 | Bacteria | 13324 |
| 100 | Ga0075370_10000831 | 3300006353 | Bacteria | 12465 |
| 101 | Ga0075370_10019884 | 3300006353 | Bacteria | 3660 |
| 102 | Ga0075370_10057888 | 3300006353 | Bacteria | 2204 |
| 103 | Ga0075370_10078689 | 3300006353 | Bacteria | 1894 |
| 104 | Ga0075370_10350692 | 3300006353 | Bacteria | 882 |
| 105 | Ga0068871_100140176 | 3300006358 | Bacteria | 2056 |
| 106 | Ga0075428_100027233 | 3300006844 | Bacteria | 6328 |
| 107 | Ga0075428_100706748 | 3300006844 | Bacteria | 1074 |
| 108 | Ga0075431_100021145 | 3300006847 | Bacteria | 6649 |
| 109 | Ga0075433_10001532 | 3300006852 | Bacteria | 17068 |
| 110 | Ga0075433_10079522 | 3300006852 | Bacteria | 2889 |
| 111 | Ga0075433_10110140 | 3300006852 | Bacteria | 2443 |
| 112 | Ga0075434_100015448 | 3300006871 | Bacteria | 7321 |
| 113 | Ga0075434_100016447 | 3300006871 | Bacteria | 7111 |
| 114 | Ga0075429_100004156 | 3300006880 | Bacteria | 12385 |
| 115 | Ga0075436_100003245 | 3300006914 | Bacteria | 11142 |
| 116 | Ga0075436_100236204 | 3300006914 | Bacteria | 1299 |
| 117 | Ga0097620_100335805 | 3300006931 | Bacteria | 1605 |
| 118 | Ga0075435_100010972 | 3300007076 | Bacteria | 6642 |
| 119 | Ga0075435_100029647 | 3300007076 | Bacteria | 4296 |
| 120 | Ga0075435_100135837 | 3300007076 | Bacteria | 2060 |
| 121 | Ga0099794_10000738 | 3300007265 | Bacteria | 11010 |
| 122 | Ga0099794_10005735 | 3300007265 | Bacteria | 5004 |
| 123 | Ga0105240_10104170 | 3300009093 | Bacteria | 3445 |
| 124 | Ga0105240_10132289 | 3300009093 | Bacteria | 2991 |
| 125 | Ga0105240_10366424 | 3300009093 | Bacteria | 1631 |
| 126 | Ga0111539_10003621 | 3300009094 | Bacteria | 20353 |
| 127 | Ga0111539_10070087 | 3300009094 | Bacteria | 4138 |
| 128 | Ga0105245_10164386 | 3300009098 | Bacteria | 2108 |
| 129 | Ga0105245_10252616 | 3300009098 | Bacteria | 1713 |
| 130 | Ga0105245_10612284 | 3300009098 | Bacteria | 1116 |
| 131 | Ga0105247_10144497 | 3300009101 | Bacteria | 1562 |
| 132 | Ga0114129_10001176 | 3300009147 | Bacteria | 34702 |
| 133 | Ga0114129_10001788 | 3300009147 | Bacteria | 29288 |
| 134 | Ga0114129_10361425 | 3300009147 | Bacteria | 1921 |
| 135 | Ga0105243_10155893 | 3300009148 | Bacteria | 1964 |
| 136 | Ga0105241_10032975 | 3300009174 | Unclassified | 3885 |
| 137 | Ga0105242_10868133 | 3300009176 | Bacteria | 899 |
| 138 | Ga0105242_11116067 | 3300009176 | Bacteria | 803 |
| 139 | Ga0105237_10005032 | 3300009545 | Bacteria | 15049 |
| 140 | Ga0105237_10256395 | 3300009545 | Unclassified | 1751 |
| 141 | Ga0105238_10105106 | 3300009551 | Bacteria | 2805 |
| 142 | Ga0105238_10212671 | 3300009551 | Bacteria | 1910 |
| 143 | Ga0105249_10006755 | 3300009553 | Bacteria | 9997 |
| 144 | Ga0105030_107289 | 3300009987 | Bacteria | 940 |
| 145 | Ga0105239_10064574 | 3300010375 | Bacteria | 4018 |
| 146 | Ga0105239_10076094 | 3300010375 | Bacteria | 3691 |
| 147 | Ga0105239_10413774 | 3300010375 | Bacteria | 1527 |
| 148 | Ga0105239_10691325 | 3300010375 | Bacteria | 1166 |
| 149 | Ga0105246_10207809 | 3300011119 | Bacteria | 1526 |
| 150 | Ga0105246_10337432 | 3300011119 | Bacteria | 1230 |
| 151 | Ga0157371_10118799 | 3300013102 | Bacteria | 1879 |
| 152 | Ga0157370_10907487 | 3300013104 | Bacteria | 799 |
| 153 | Ga0157369_10314346 | 3300013105 | Bacteria | 1629 |
| 154 | Ga0157374_10449161 | 3300013296 | Bacteria | 1290 |
| 155 | Ga0163162_10087813 | 3300013306 | Bacteria | 3189 |
| 156 | Ga0163162_10934773 | 3300013306 | Bacteria | 979 |
| 157 | Ga0163162_11019529 | 3300013306 | Bacteria | 936 |
| 158 | Ga0157372_11048172 | 3300013307 | Bacteria | 944 |
| 159 | Ga0157375_10366935 | 3300013308 | Bacteria | 1606 |
| 160 | Ga0157375_11281557 | 3300013308 | Bacteria | 861 |
| 161 | Ga0163163_10149209 | 3300014325 | Bacteria | 2382 |
| 162 | Ga0163163_10330838 | 3300014325 | Bacteria | 1578 |
| 163 | Ga0163163_10335083 | 3300014325 | Bacteria | 1568 |
| 164 | Ga0163163_11275127 | 3300014325 | Bacteria | 797 |
| 165 | Ga0157380_10114603 | 3300014326 | Bacteria | 2272 |
| 166 | Ga0157380_10715681 | 3300014326 | Bacteria | 1008 |
| 167 | Ga0157380_11736769 | 3300014326 | Bacteria | 682 |
| 168 | Ga0182008_10190802 | 3300014497 | Bacteria | 1040 |
| 169 | Ga0157377_10572154 | 3300014745 | Bacteria | 801 |
| 170 | Ga0157379_10071844 | 3300014968 | Bacteria | 3096 |
| 171 | Ga0157379_10543268 | 3300014968 | Bacteria | 1081 |
| 172 | Ga0157376_10131513 | 3300014969 | Bacteria | 2233 |
| 173 | Ga0163161_10121492 | 3300017792 | Bacteria | 1963 |
| 174 | Ga0163161_10358734 | 3300017792 | Bacteria | 1160 |
| 175 | Ga0163161_10812098 | 3300017792 | Bacteria | 787 |
| 176 | Ga0206356_10655547 | 3300020070 | Bacteria | 738 |
| 177 | Ga0206351_10218445 | 3300020077 | Bacteria | 894 |
| 178 | Ga0206352_11142661 | 3300020078 | Bacteria | 1464 |
| 179 | Ga0206350_10065044 | 3300020080 | Bacteria | 749 |
| 180 | Ga0206350_11464367 | 3300020080 | Bacteria | 1760 |
| 181 | Ga0206353_11882339 | 3300020082 | Bacteria | 746 |
| 182 | Ga0154015_1584249 | 3300020610 | Bacteria | 1990 |
| 183 | Ga0213873_10000040 | 3300021358 | Bacteria | 32068 |
| 184 | Ga0213876_10006253 | 3300021384 | Bacteria | 6494 |
| 185 | Ga0213875_10132135 | 3300021388 | Bacteria | 1167 |
| 186 | Ga0213875_10299607 | 3300021388 | Bacteria | 760 |
| 187 | Ga0224712_10011100 | 3300022467 | Bacteria | 2780 |
| 188 | Ga0224712_10289174 | 3300022467 | Bacteria | 764 |
| 189 | Ga0209673_1032276 | 3300025273 | Bacteria | 1615 |
| 190 | Ga0209051_1000014 | 3300025303 | Bacteria | 552732 |
| 191 | Ga0209051_1000374 | 3300025303 | Bacteria | 64311 |
| 192 | Ga0209051_1002709 | 3300025303 | Bacteria | 12325 |
| 193 | Ga0209051_1014602 | 3300025303 | Bacteria | 3654 |
| 194 | Ga0207696_1065610 | 3300025711 | Bacteria | 1015 |
| 195 | Ga0207692_10461580 | 3300025898 | Bacteria | 801 |
| 196 | Ga0207710_10003112 | 3300025900 | Bacteria | 7434 |
| 197 | Ga0207688_10084319 | 3300025901 | Bacteria | 1819 |
| 198 | Ga0207647_10023748 | 3300025904 | Bacteria | 4051 |
| 199 | Ga0207647_10050650 | 3300025904 | Bacteria | 2570 |
| 200 | Ga0207695_10131869 | 3300025913 | Bacteria | 2456 |
| 201 | Ga0207695_10177631 | 3300025913 | Bacteria | 2051 |
| 202 | Ga0207671_10005149 | 3300025914 | Bacteria | 12170 |
| 203 | Ga0207671_10296864 | 3300025914 | Unclassified | 1276 |
| 204 | Ga0207694_10024622 | 3300025924 | Bacteria | 4572 |
| 205 | Ga0207694_10459915 | 3300025924 | Bacteria | 1063 |
| 206 | Ga0207687_10202602 | 3300025927 | Bacteria | 1552 |
| 207 | Ga0207700_10678459 | 3300025928 | Bacteria | 919 |
| 208 | Ga0207664_10048736 | 3300025929 | Bacteria | 3333 |
| 209 | Ga0207644_10412224 | 3300025931 | Bacteria | 1106 |
| 210 | Ga0207690_10140246 | 3300025932 | Bacteria | 1780 |
| 211 | Ga0207706_10149490 | 3300025933 | Bacteria | 2054 |
| 212 | Ga0207706_10448380 | 3300025933 | Bacteria | 1116 |
| 213 | Ga0207709_10012557 | 3300025935 | Bacteria | 4666 |
| 214 | Ga0207670_10042649 | 3300025936 | Bacteria | 2991 |
| 215 | Ga0207670_10529493 | 3300025936 | Bacteria | 960 |
| 216 | Ga0207704_10347750 | 3300025938 | Bacteria | 1153 |
| 217 | Ga0207691_10197216 | 3300025940 | Bacteria | 1753 |
| 218 | Ga0207711_10067069 | 3300025941 | Bacteria | 3105 |
| 219 | Ga0207661_10089038 | 3300025944 | Bacteria | 2567 |
| 220 | Ga0207679_10777802 | 3300025945 | Bacteria | 872 |
| 221 | Ga0207651_10019580 | 3300025960 | Bacteria | 4060 |
| 222 | Ga0207712_10025993 | 3300025961 | Bacteria | 3895 |
| 223 | Ga0207712_10112976 | 3300025961 | Bacteria | 2041 |
| 224 | Ga0207668_10030967 | 3300025972 | Bacteria | 3520 |
| 225 | Ga0207668_10281216 | 3300025972 | Bacteria | 1364 |
| 226 | Ga0207658_10001419 | 3300025986 | Bacteria | 18686 |
| 227 | Ga0207658_10123596 | 3300025986 | Bacteria | 2067 |
| 228 | Ga0207658_11052320 | 3300025986 | Bacteria | 743 |
| 229 | Ga0207677_10959291 | 3300026023 | Bacteria | 774 |
| 230 | Ga0207703_10000807 | 3300026035 | Bacteria | 30856 |
| 231 | Ga0207703_10031525 | 3300026035 | Bacteria | 4192 |
| 232 | Ga0207639_10146750 | 3300026041 | Bacteria | 1971 |
| 233 | Ga0207639_10356521 | 3300026041 | Bacteria | 1308 |
| 234 | Ga0207678_10000934 | 3300026067 | Bacteria | 26626 |
| 235 | Ga0207678_10025987 | 3300026067 | Bacteria | 5108 |
| 236 | Ga0207678_10048715 | 3300026067 | Bacteria | 3662 |
| 237 | Ga0207678_10411387 | 3300026067 | Bacteria | 1172 |
| 238 | Ga0207702_10101417 | 3300026078 | Bacteria | 2541 |
| 239 | Ga0207641_10001391 | 3300026088 | Bacteria | 23825 |
| 240 | Ga0207641_10009686 | 3300026088 | Bacteria | 7938 |
| 241 | Ga0207641_10347365 | 3300026088 | Bacteria | 1413 |
| 242 | Ga0207641_11220657 | 3300026088 | Bacteria | 752 |
| 243 | Ga0207648_10121817 | 3300026089 | Bacteria | 2293 |
| 244 | Ga0207676_10247741 | 3300026095 | Bacteria | 1602 |
| 245 | Ga0207676_10306952 | 3300026095 | Bacteria | 1451 |
| 246 | Ga0207676_11073265 | 3300026095 | Unclassified | 795 |
| 247 | Ga0207674_10465344 | 3300026116 | Bacteria | 1222 |
| 248 | Ga0207674_11213387 | 3300026116 | Bacteria | 724 |
| 249 | Ga0207675_100154406 | 3300026118 | Bacteria | 2187 |
| 250 | Ga0207683_10324271 | 3300026121 | Bacteria | 1411 |
| 251 | Ga0207683_10399725 | 3300026121 | Bacteria | 1264 |
| 252 | Ga0207683_10862305 | 3300026121 | Bacteria | 841 |
| 253 | Ga0207698_10977800 | 3300026142 | Bacteria | 856 |
| 254 | Ga0209588_1005630 | 3300027671 | Bacteria | 3599 |
| 255 | Ga0209588_1005692 | 3300027671 | Bacteria | 3582 |
| 256 | Ga0209813_10016090 | 3300027866 | Bacteria | 2037 |
| 257 | Ga0209813_10017468 | 3300027866 | Bacteria | 1969 |
| 258 | Ga0207428_10000964 | 3300027907 | Bacteria | 31921 |
| 259 | Ga0207428_10003341 | 3300027907 | Bacteria | 15600 |
| 260 | Ga0268266_10002456 | 3300028379 | Bacteria | 19855 |
| 261 | Ga0268266_10080032 | 3300028379 | Bacteria | 2846 |
| 262 | Ga0268266_10674758 | 3300028379 | Bacteria | 995 |
| 263 | Ga0268265_10012252 | 3300028380 | Bacteria | 5810 |
| 264 | Ga0268264_10000085 | 3300028381 | Bacteria | 240739 |
| 265 | Ga0268264_10090174 | 3300028381 | Bacteria | 2641 |
| 266 | Ga0268264_10310987 | 3300028381 | Bacteria | 1486 |
| 267 | Ga0268264_10433327 | 3300028381 | Bacteria | 1270 |
| 268 | Ga0307517_10277239 | 3300028786 | Bacteria | 959 |
| 269 | Ga0307515_10054821 | 3300028794 | Bacteria | 5843 |
| 270 | Ga0307511_10001015 | 3300030521 | Bacteria | 29803 |
| 271 | Ga0307511_10284115 | 3300030521 | Bacteria | 762 |
| 272 | Ga0307512_10277320 | 3300030522 | Bacteria | 805 |
| 273 | Ga0316183_1173540 | 3300030742 | Bacteria | 1677 |
| 274 | Ga0316181_1159012 | 3300030744 | Bacteria | 2823 |
| 275 | Ga0316182_1260240 | 3300030745 | Bacteria | 4329 |
| 276 | Ga0265327_10000363 | 3300031251 | Bacteria | 86525 |
| 277 | Ga0265327_10000718 | 3300031251 | Bacteria | 52146 |
| 278 | Ga0265327_10005827 | 3300031251 | Bacteria | 10113 |
| 279 | Ga0265327_10035317 | 3300031251 | Bacteria | 2765 |
| 280 | Ga0307509_10231320 | 3300031507 | Bacteria | 1651 |
| 281 | Ga0307508_10221891 | 3300031616 | Bacteria | 1490 |
| 282 | Ga0307405_10030192 | 3300031731 | Bacteria | 3177 |
| 283 | Ga0307405_10088021 | 3300031731 | Bacteria | 2048 |
| 284 | Ga0307405_10578407 | 3300031731 | Bacteria | 913 |
| 285 | Ga0307413_10125169 | 3300031824 | Bacteria | 1749 |
| 286 | Ga0307413_10477033 | 3300031824 | Bacteria | 996 |
| 287 | Ga0307518_10000537 | 3300031838 | Bacteria | 28756 |
| 288 | Ga0307410_10141637 | 3300031852 | Bacteria | 1779 |
| 289 | Ga0307406_10000821 | 3300031901 | Bacteria | 17418 |
| 290 | Ga0307406_10002452 | 3300031901 | Bacteria | 10105 |
| 291 | Ga0307406_10523530 | 3300031901 | Bacteria | 965 |
| 292 | Ga0307407_10219850 | 3300031903 | Bacteria | 1284 |
| 293 | Ga0307412_10858547 | 3300031911 | Bacteria | 792 |
| 294 | Ga0307415_100321637 | 3300032126 | Bacteria | 1290 |
| 295 | Ga0307415_100635628 | 3300032126 | Bacteria | 955 |
| 296 | Ga0307507_10010108 | 3300033179 | Bacteria | 12323 |
| 297 | Ga0307510_10000004 | 3300033180 | Bacteria | 654130 |
| 298 | Ga0307510_10055559 | 3300033180 | Bacteria | 4134 |
| 299 | Ga0373949_0028873 | 3300035090 | Bacteria | 1311 |
| 300 | Ga0373949_0133861 | 3300035090 | Bacteria | 705 |
| 301 | Ga0373935_0498783 | 3300035692 | Bacteria | 884 |
| 302 | Ga0395898_0098556 | 3300037466 | Bacteria | 2807 |
| 303 | Ga0436364_1009445 | 3300037853 | Bacteria | 41017 |
| 304 | Ga0436364_1332711 | 3300037853 | Bacteria | 9840 |
| 305 | Ga0436364_1469378 | 3300037853 | Bacteria | 4144 |
| 306 | Ga0395901_0099814 | 3300038443 | Bacteria | 3044 |
| 307 | Ga0400488_34785 | 3300038741 | Bacteria | 6935 |
| 308 | Ga0436365_0812603 | 3300039437 | Bacteria | 22024 |
| 309 | Ga0436365_1635789 | 3300039437 | Bacteria | 4260 |
| 310 | Ga0436363_1213162 | 3300039450 | Bacteria | 4626 |
| 311 | Ga0436362_0604286 | 3300039453 | Bacteria | 27368 |
| 312 | Ga0439466_0004549 | 3300041411 | Bacteria | 5328 |
| 313 | Ga0439465_0014624 | 3300041413 | Bacteria | 2447 |
| 314 | Ga0439465_0058820 | 3300041413 | Bacteria | 1271 |
| 315 | Ga0451789_0651037 | 3300041443 | Bacteria | 1305 |
| 316 | Ga0451791_0061301 | 3300041451 | Bacteria | 1732 |
| 317 | Ga0451793_0166662 | 3300041452 | Bacteria | 2954 |
| 318 | Ga0451793_1384911 | 3300041452 | Bacteria | 1885 |
| 319 | Ga0451797_0468809 | 3300041453 | Bacteria | 2421 |
| 320 | Ga0451795_0568771 | 3300041456 | Bacteria | 1545 |
| 321 | Ga0451795_0943970 | 3300041456 | Bacteria | 921 |
| 322 | Ga0451800_1453589 | 3300041459 | Bacteria | 1799 |
| 323 | Ga0451802_1877652 | 3300041460 | Bacteria | 1220 |
| 324 | Ga0451807_0080565 | 3300041486 | Bacteria | 1190 |
| 325 | Ga0451807_2367206 | 3300041486 | Bacteria | 1098 |
| 326 | Ga0451837_0003726 | 3300041494 | Bacteria | 5607 |
| 327 | Ga0451839_1156414 | 3300041496 | Bacteria | 858 |
| 328 | Ga0451839_1205715 | 3300041496 | Bacteria | 1022 |
| 329 | Ga0451839_1219122 | 3300041496 | Bacteria | 5247 |
| 330 | Ga0451841_0503750 | 3300041498 | Bacteria | 1764 |
| 331 | Ga0451847_0262175 | 3300041503 | Bacteria | 865 |
| 332 | Ga0451843_0729029 | 3300041509 | Bacteria | 2841 |
| 333 | Ga0439431_0000284 | 3300041997 | Bacteria | 10420 |
| 334 | Ga0439445_0010564 | 3300042004 | Bacteria | 2187 |
| 335 | Ga0439445_0019410 | 3300042004 | Bacteria | 1694 |
| 336 | Ga0439432_086246 | 3300042006 | Bacteria | 947 |
| 337 | Ga0439463_015653 | 3300042016 | Bacteria | 1876 |
| 338 | Ga0450900_025738 | 3300042136 | Bacteria | 838 |
| 339 | Ga0439446_0133855 | 3300042156 | Bacteria | 806 |
| 340 | Ga0439434_0014629 | 3300042435 | Bacteria | 2335 |
| 341 | Ga0439435_0103587 | 3300042436 | Bacteria | 877 |
| 342 | Ga0439464_0002492 | 3300042439 | Bacteria | 4537 |
| 343 | Ga0451577_0976459 | 3300042876 | Bacteria | 761 |
| 344 | Ga0466972_0002342 | 3300044658 | Bacteria | 9334 |
| 345 | Ga0466972_0004109 | 3300044658 | Bacteria | 7266 |
| 346 | Ga0466972_0050109 | 3300044658 | Bacteria | 2016 |
| 347 | Ga0466972_0246042 | 3300044658 | Bacteria | 836 |
| 348 | Ga0466965_0036779 | 3300044683 | Bacteria | 2402 |
| 349 | Ga0466965_0179684 | 3300044683 | Bacteria | 1116 |
| 350 | Ga0466965_0319488 | 3300044683 | Bacteria | 845 |
| 351 | Ga0466966_0561341 | 3300044684 | Bacteria | 687 |
| 352 | Ga0466961_0437341 | 3300044693 | Bacteria | 792 |
| 353 | Ga0466963_0062607 | 3300044694 | Bacteria | 2488 |
| 354 | Ga0466963_0101767 | 3300044694 | Bacteria | 1967 |
| 355 | Ga0466963_0321054 | 3300044694 | Bacteria | 1090 |
| 356 | Ga0466963_0504683 | 3300044694 | Bacteria | 854 |
| 357 | Ga0466971_0002362 | 3300044719 | Bacteria | 7967 |
| 358 | Ga0466971_0300103 | 3300044719 | Bacteria | 771 |
| 359 | Ga0466968_0010727 | 3300044735 | Bacteria | 3559 |
| 360 | Ga0466968_0031758 | 3300044735 | Bacteria | 2192 |
| 361 | Ga0466970_0000004 | 3300044765 | Bacteria | 108620 |
| 362 | Ga0466970_0000304 | 3300044765 | Bacteria | 23970 |
| 363 | Ga0466970_0011371 | 3300044765 | Bacteria | 4536 |
| 364 | Ga0466970_0250350 | 3300044765 | Bacteria | 992 |
| 365 | Ga0466957_0054983 | 3300044842 | Bacteria | 2431 |
| 366 | Ga0466957_0074070 | 3300044842 | Bacteria | 2111 |
| 367 | Ga0466960_0000501 | 3300044901 | Bacteria | 13397 |
| 368 | Ga0466960_0000607 | 3300044901 | Bacteria | 12375 |
| 369 | Ga0466960_0001790 | 3300044901 | Bacteria | 7889 |
| 370 | Ga0466960_0042153 | 3300044901 | Bacteria | 2166 |
| 371 | Ga0466958_0032928 | 3300045836 | Bacteria | 3086 |
| 372 | Ga0466958_0655382 | 3300045836 | Bacteria | 683 |
| 373 | Ga0466958_0661483 | 3300045836 | Bacteria | 680 |
| 374 | Ga0466958_0671914 | 3300045836 | Bacteria | 674 |
| 375 | Ga0466967_0004822 | 3300045976 | Bacteria | 9195 |
| 376 | Ga0466967_0068759 | 3300045976 | Bacteria | 3163 |
| 377 | Ga0466967_0128660 | 3300045976 | Bacteria | 2348 |
| 378 | Ga0466967_0246404 | 3300045976 | Bacteria | 1705 |
| 379 | Ga0466967_0281547 | 3300045976 | Bacteria | 1595 |
| 380 | Ga0466967_1282063 | 3300045976 | Bacteria | 730 |
| 381 | Ga0495627_000393 | 3300046453 | Bacteria | 39677 |
| 382 | Ga0495641_0125160 | 3300046461 | Bacteria | 1147 |
| 383 | Ga0495582_0262013 | 3300046473 | Bacteria | 992 |
| 384 | Ga0495606_0059796 | 3300046507 | Bacteria | 2443 |
| 385 | Ga0495606_0399448 | 3300046507 | Bacteria | 716 |
| 386 | Ga0495648_0006724 | 3300046524 | Bacteria | 9302 |
| 387 | Ga0495648_0325750 | 3300046524 | Bacteria | 710 |
| 388 | Ga0495668_0011512 | 3300046616 | Bacteria | 5296 |
| 389 | Ga0495611_0053461 | 3300046648 | Bacteria | 1823 |
| 390 | Ga0495611_0139278 | 3300046648 | Bacteria | 1133 |
| 391 | Ga0495649_0035963 | 3300046694 | Bacteria | 2723 |
| 392 | Ga0495649_0132142 | 3300046694 | Bacteria | 1317 |
| 393 | Ga0495581_0443533 | 3300047315 | Bacteria | 756 |
| 394 | Ga0495672_0009376 | 3300047320 | Bacteria | 7098 |
| 395 | Ga0495683_0001308 | 3300047323 | Bacteria | 16712 |
| 396 | Ga0495673_0002913 | 3300047469 | Bacteria | 11603 |
| 397 | Ga0495673_0126810 | 3300047469 | Bacteria | 1006 |
| 398 | Ga0496100_0000087 | 3300048903 | Bacteria | 52650 |
| 399 | Ga0496100_0001674 | 3300048903 | Bacteria | 11000 |
| 400 | Ga0496100_0671962 | 3300048903 | Unclassified | 807 |
| 401 | Ga0496101_0000034 | 3300048904 | Bacteria | 178045 |
| 402 | Ga0496101_0000110 | 3300048904 | Bacteria | 85776 |
| 403 | Ga0496102_0000006 | 3300048905 | Bacteria | 471494 |
| 404 | Ga0496102_0004718 | 3300048905 | Bacteria | 11539 |
| 405 | Ga0496102_0007220 | 3300048905 | Bacteria | 9481 |
| 406 | Ga0496102_0241949 | 3300048905 | Bacteria | 1701 |
| 407 | Ga0496102_0792706 | 3300048905 | Bacteria | 870 |
| 408 | Ga0496103_0000006 | 3300048906 | Bacteria | 470539 |
| 409 | Ga0496103_0005953 | 3300048906 | Bacteria | 7291 |
| 410 | Ga0496103_0021452 | 3300048906 | Bacteria | 3886 |
| 411 | Ga0496103_0458772 | 3300048906 | Bacteria | 817 |
| 412 | Ga0496104_0444854 | 3300048907 | Bacteria | 1208 |
| 413 | Ga0496106_0043502 | 3300048909 | Bacteria | 3370 |
| 414 | Ga0496106_0056467 | 3300048909 | Bacteria | 2968 |
| 415 | Ga0496107_0000108 | 3300048910 | Bacteria | 40403 |
| 416 | Ga0496107_0026082 | 3300048910 | Bacteria | 4142 |
| 417 | Ga0496108_0007784 | 3300048911 | Bacteria | 8679 |
| 418 | Ga0496108_0277126 | 3300048911 | Bacteria | 1460 |
| 419 | Ga0496108_0620931 | 3300048911 | Bacteria | 941 |
| 420 | Ga0496109_0000127 | 3300048912 | Bacteria | 77905 |
| 421 | Ga0496109_0701784 | 3300048912 | Bacteria | 949 |
| 422 | Ga0496110_0000632 | 3300048913 | Bacteria | 24071 |
| 423 | Ga0496111_0063969 | 3300048914 | Bacteria | 2668 |
| 424 | Ga0496111_0115788 | 3300048914 | Bacteria | 1976 |
| 425 | Ga0496111_0576243 | 3300048914 | Bacteria | 825 |
| 426 | Ga0496114_0000277 | 3300048917 | Bacteria | 37457 |
| 427 | Ga0496114_0008890 | 3300048917 | Bacteria | 7964 |
| 428 | Ga0496114_0018770 | 3300048917 | Bacteria | 5598 |
| 429 | Ga0496114_0170692 | 3300048917 | Bacteria | 1895 |
| 430 | Ga0496114_0221967 | 3300048917 | Bacteria | 1659 |
| 431 | Ga0496115_0330248 | 3300048918 | Bacteria | 1246 |
| 432 | Ga0496116_0000025 | 3300048919 | Bacteria | 470539 |
| 433 | Ga0496116_0004610 | 3300048919 | Bacteria | 13067 |
| 434 | Ga0496116_0009881 | 3300048919 | Bacteria | 8070 |
| 435 | Ga0496117_0000006 | 3300048920 | Bacteria | 758420 |
| 436 | Ga0496117_0000627 | 3300048920 | Bacteria | 57244 |
| 437 | Ga0496117_0003089 | 3300048920 | Bacteria | 19931 |
| 438 | Ga0496117_0022600 | 3300048920 | Bacteria | 5040 |
| 439 | Ga0496118_0000004 | 3300048921 | Bacteria | 758420 |
| 440 | Ga0496118_0000026 | 3300048921 | Bacteria | 375725 |
| 441 | Ga0496118_0005105 | 3300048921 | Bacteria | 15090 |
| 442 | Ga0496118_0012406 | 3300048921 | Bacteria | 8184 |
| 443 | Ga0496118_0163857 | 3300048921 | Bacteria | 1370 |
| 444 | Ga0496119_0000035 | 3300048922 | Bacteria | 217007 |
| 445 | Ga0496119_0001354 | 3300048922 | Bacteria | 29958 |
| 446 | Ga0496119_0007860 | 3300048922 | Bacteria | 9498 |
| 447 | Ga0496119_0031821 | 3300048922 | Bacteria | 3527 |
| 448 | Ga0496119_0327567 | 3300048922 | Bacteria | 748 |
| 449 | Ga0496120_0000706 | 3300048923 | Bacteria | 48969 |
| 450 | Ga0496120_0000993 | 3300048923 | Bacteria | 38355 |
| 451 | Ga0496120_0068725 | 3300048923 | Bacteria | 1953 |
| 452 | Ga0496120_0170119 | 3300048923 | Unclassified | 1078 |
| 453 | Ga0496121_0000040 | 3300048924 | Bacteria | 348494 |
| 454 | Ga0496121_0000048 | 3300048924 | Bacteria | 330242 |
| 455 | Ga0496121_0000090 | 3300048924 | Bacteria | 217920 |
| 456 | Ga0496121_0003120 | 3300048924 | Bacteria | 23932 |
| 457 | Ga0496122_0002047 | 3300048925 | Bacteria | 29932 |
| 458 | Ga0496122_0203205 | 3300048925 | Bacteria | 1156 |
| 459 | Ga0496122_0326539 | 3300048925 | Bacteria | 813 |
| 460 | Ga0496123_0005077 | 3300048926 | Bacteria | 13448 |
| 461 | Ga0496124_0000044 | 3300048927 | Bacteria | 289064 |
| 462 | Ga0496124_0004491 | 3300048927 | Bacteria | 16281 |
| 463 | Ga0496125_0000037 | 3300048928 | Bacteria | 330242 |
| 464 | Ga0496125_0000797 | 3300048928 | Bacteria | 51430 |
| 465 | Ga0496125_0006515 | 3300048928 | Bacteria | 12596 |
| 466 | Ga0496125_0021790 | 3300048928 | Bacteria | 5962 |
| 467 | Ga0496125_0051220 | 3300048928 | Bacteria | 3407 |
| 468 | Ga0496126_0000046 | 3300048929 | Bacteria | 330242 |
| 469 | Ga0496126_0001450 | 3300048929 | Bacteria | 37186 |
| 470 | Ga0496126_0081083 | 3300048929 | Bacteria | 2869 |
| 471 | Ga0496126_0140060 | 3300048929 | Bacteria | 2083 |
| 472 | Ga0501311_036131 | 3300049527 | Bacteria | 734 |
| 473 | Ga0501031_0174319 | 3300049568 | Bacteria | 1405 |
| 474 | Ga0501032_0002384 | 3300049569 | Bacteria | 14666 |
| 475 | Ga0501034_0011550 | 3300049571 | Bacteria | 9147 |
| 476 | Ga0501034_0031705 | 3300049571 | Bacteria | 5368 |
| 477 | Ga0501034_0584789 | 3300049571 | Bacteria | 1023 |
| 478 | Ga0501036_0000459 | 3300049572 | Bacteria | 29154 |
| 479 | Ga0501036_0024273 | 3300049572 | Bacteria | 5111 |
| 480 | Ga0501037_0001507 | 3300049573 | Bacteria | 17018 |
| 481 | Ga0501037_0010756 | 3300049573 | Bacteria | 6723 |
| 482 | Ga0501038_0089186 | 3300049574 | Bacteria | 2587 |
| 483 | Ga0501039_0000312 | 3300049575 | Bacteria | 34396 |
| 484 | Ga0501039_0083026 | 3300049575 | Bacteria | 2495 |
| 485 | Ga0501040_0026327 | 3300049576 | Bacteria | 3912 |
| 486 | Ga0501042_0308864 | 3300049578 | Bacteria | 1142 |
| 487 | Ga0501043_0003966 | 3300049579 | Bacteria | 12125 |
| 488 | Ga0501043_0280794 | 3300049579 | Bacteria | 1276 |
| 489 | Ga0501043_0476007 | 3300049579 | Bacteria | 936 |
| 490 | Ga0501046_0000211 | 3300049580 | Bacteria | 60684 |
| 491 | Ga0501046_0002714 | 3300049580 | Bacteria | 16475 |
| 492 | Ga0501046_0234887 | 3300049580 | Bacteria | 1354 |
| 493 | Ga0501047_0004432 | 3300049581 | Bacteria | 13217 |
| 494 | Ga0501048_0000185 | 3300049582 | Bacteria | 39725 |
| 495 | Ga0501048_0008617 | 3300049582 | Bacteria | 7701 |
| 496 | Ga0501048_0208565 | 3300049582 | Bacteria | 1386 |
| 497 | Ga0501067_0002625 | 3300049583 | Bacteria | 9951 |
| 498 | Ga0501068_0077838 | 3300049584 | Bacteria | 2031 |
| 499 | Ga0501068_0646423 | 3300049584 | Bacteria | 690 |
| 500 | Ga0501069_0002840 | 3300049585 | Bacteria | 8866 |
| 501 | Ga0501070_0000555 | 3300049586 | Bacteria | 34029 |
| 502 | Ga0501070_0008107 | 3300049586 | Bacteria | 8891 |
| 503 | Ga0501071_0015252 | 3300049587 | Bacteria | 5273 |
| 504 | Ga0501071_0314702 | 3300049587 | Bacteria | 1188 |
| 505 | Ga0501071_0464338 | 3300049587 | Bacteria | 969 |
| 506 | Ga0501073_0027373 | 3300049589 | Bacteria | 4077 |
| 507 | Ga0501074_0000871 | 3300049590 | Bacteria | 19250 |
| 508 | Ga0501074_0131983 | 3300049590 | Bacteria | 1787 |
| 509 | Ga0501075_0139526 | 3300049591 | Bacteria | 1847 |
| 510 | Ga0501075_0258073 | 3300049591 | Bacteria | 1328 |
| 511 | Ga0501080_0003956 | 3300049742 | Bacteria | 13115 |
| 512 | Ga0501083_0030985 | 3300049744 | Bacteria | 3671 |
| 513 | Ga0501035_0001560 | 3300049822 | Bacteria | 23346 |
| 514 | Ga0501044_0003330 | 3300049823 | Bacteria | 18108 |
| 515 | Ga0501044_0012905 | 3300049823 | Bacteria | 9043 |
| 516 | nmdc:mga03683_13119_c1 | 3300050489 | Bacteria | 3043 |
| 517 | nmdc:mga03683_292364_c1 | 3300050489 | Bacteria | 763 |
| 518 | nmdc:mga03n38_104633_c1 | 3300050490 | Bacteria | 1370 |
| 519 | nmdc:mga03n38_10873_c1 | 3300050490 | Bacteria | 3369 |
| 520 | nmdc:mga03n38_13994_c1 | 3300050490 | Bacteria | 3064 |
| 521 | nmdc:mga03n38_1445_c1 | 3300050490 | Bacteria | 6807 |
| 522 | nmdc:mga03n38_24439_c1 | 3300050490 | Bacteria | 2471 |
| 523 | nmdc:mga00v17_119386_c1 | 3300050491 | Bacteria | 1678 |
| 524 | nmdc:mga00v17_1500_c1 | 3300050491 | Bacteria | 12189 |
| 525 | nmdc:mga00v17_206142_c1 | 3300050491 | Bacteria | 1272 |
| 526 | nmdc:mga00v17_2304_c1 | 3300050491 | Bacteria | 9793 |
| 527 | nmdc:mga00v17_284749_c1 | 3300050491 | Bacteria | 1073 |
| 528 | nmdc:mga00v17_2941_c1 | 3300050491 | Bacteria | 8741 |
| 529 | nmdc:mga00v17_3307_c1 | 3300050491 | Bacteria | 3698 |
| 530 | nmdc:mga00v17_3432_c1 | 3300050491 | Bacteria | 8189 |
| 531 | nmdc:mga00v17_95465_c1 | 3300050491 | Bacteria | 1872 |
| 532 | nmdc:mga0yw44_11204_c1 | 3300050492 | Bacteria | 4616 |
| 533 | nmdc:mga0yw44_12390_c1 | 3300050492 | Bacteria | 4442 |
| 534 | nmdc:mga0yw44_303579_c1 | 3300050492 | Bacteria | 1070 |
| 535 | nmdc:mga0yw44_350591_c1 | 3300050492 | Bacteria | 993 |
| 536 | nmdc:mga0yw44_85307_c1 | 3300050492 | Bacteria | 1987 |
| 537 | nmdc:mga0k408_101285_c1 | 3300050493 | Bacteria | 1698 |
| 538 | nmdc:mga06z11_189233_c1 | 3300050494 | Bacteria | 1191 |
| 539 | nmdc:mga06z11_4627_c1 | 3300050494 | Bacteria | 5429 |
| 540 | nmdc:mga06z11_7615_c1 | 3300050494 | Bacteria | 4469 |
| 541 | nmdc:mga04h51_30398_c1 | 3300050495 | Bacteria | 1699 |
| 542 | nmdc:mga04h51_71360_c1 | 3300050495 | Bacteria | 1213 |
| 543 | nmdc:mga07m45_104000_c1 | 3300050496 | Bacteria | 1632 |
| 544 | nmdc:mga07m45_183641_c1 | 3300050496 | Bacteria | 1216 |
| 545 | nmdc:mga07m45_2158_c1 | 3300050496 | Bacteria | 9163 |
| 546 | nmdc:mga07m45_3558_c1 | 3300050496 | Bacteria | 7524 |
| 547 | nmdc:mga07m45_4451_c1 | 3300050496 | Bacteria | 6857 |
| 548 | nmdc:mga07m45_74577_c1 | 3300050496 | Bacteria | 1933 |
| 549 | nmdc:mga05p37_1020221_c1 | 3300050507 | Bacteria | 876 |
| 550 | nmdc:mga05p37_10589_c1 | 3300050507 | Bacteria | 10937 |
| 551 | nmdc:mga05p37_34311_c1 | 3300050507 | Bacteria | 6214 |
| 552 | nmdc:mga09592_18311_c1 | 3300050508 | Bacteria | 5743 |
| 553 | nmdc:mga06r32_24238_c1 | 3300050510 | Bacteria | 5628 |
| 554 | nmdc:mga08y16_1043553_c1 | 3300050511 | Bacteria | 795 |
| 555 | nmdc:mga08y16_278553_c1 | 3300050511 | Bacteria | 1726 |
| 556 | nmdc:mga08y16_394039_c1 | 3300050511 | Bacteria | 1418 |
| 557 | nmdc:mga08y16_72775_c1 | 3300050511 | Bacteria | 3582 |
| 558 | nmdc:mga0n895_11598_c1 | 3300050512 | Bacteria | 7873 |
| 559 | nmdc:mga0n895_132334_c1 | 3300050512 | Bacteria | 2520 |
| 560 | nmdc:mga0rr50_21063_c1 | 3300050513 | Bacteria | 4443 |
| 561 | nmdc:mga0rr50_7007_c1 | 3300050513 | Bacteria | 6917 |
| 562 | nmdc:mga08x19_325399_c1 | 3300050514 | Bacteria | 1070 |
| 563 | nmdc:mga08x19_4005_c1 | 3300050514 | Bacteria | 8768 |
| 564 | nmdc:mga0a205_137500_c1 | 3300050515 | Bacteria | 2344 |
| 565 | nmdc:mga0a205_208177_c1 | 3300050515 | Bacteria | 1845 |
| 566 | nmdc:mga0a205_28133_c1 | 3300050515 | Bacteria | 5373 |
| 567 | nmdc:mga0sz30_11381_c1 | 3300050516 | Bacteria | 3433 |
| 568 | nmdc:mga0sz30_25827_c1 | 3300050516 | Bacteria | 2404 |
| 569 | nmdc:mga0sz30_35294_c1 | 3300050516 | Bacteria | 2086 |
| 570 | nmdc:mga0sz30_6651_c1 | 3300050516 | Bacteria | 4305 |
| 571 | Ga0500644_0102943 | 3300053088 | Bacteria | 1088 |
| 572 | Ga0500644_0183216 | 3300053088 | Bacteria | 858 |
| 573 | Ga0500650_0316548 | 3300053098 | Bacteria | 688 |
| 574 | Ga0500654_132538 | 3300053099 | Bacteria | 938 |
| 575 | Ga0500642_0143918 | 3300053130 | Bacteria | 1119 |
| 576 | Ga0500616_0014815 | 3300053153 | Bacteria | 4471 |
| 577 | Ga0500639_254563 | 3300053163 | Bacteria | 700 |
| 578 | Ga0500637_0004373 | 3300053178 | Bacteria | 6698 |
| 579 | Ga0587084_003261 | 3300059477 | Bacteria | 1769 |
| 580 | Ga0587066_011070 | 3300059490 | Bacteria | 1316 |
| 581 | Ga0587070_001134 | 3300059491 | Bacteria | 2645 |
| 582 | Ga0587073_0056959 | 3300059492 | Bacteria | 904 |
| 583 | Ga0587077_060062 | 3300059493 | Bacteria | 821 |
| 584 | Ga0587082_039780 | 3300059504 | Bacteria | 857 |
| 585 | Ga0587083_0044997 | 3300059505 | Bacteria | 940 |
| 586 | Ga0587088_002719 | 3300059508 | Bacteria | 2055 |
| 587 | Ga0587092_000504 | 3300059512 | Bacteria | 3164 |
| 588 | Ga0587094_004894 | 3300059513 | Bacteria | 1542 |
| 589 | Ga0587097_00209 | 3300059603 | Bacteria | 1490 |
| 590 | Ga0587125_000589 | 3300059607 | Bacteria | 2222 |
| 591 | Ga0587101_000151 | 3300059623 | Bacteria | 3787 |
| 592 | Ga0587109_027977 | 3300059624 | Bacteria | 1052 |
| 593 | Ga0587113_015439 | 3300059625 | Bacteria | 757 |
| 594 | Ga0587115_006793 | 3300059626 | Bacteria | 1332 |
| 595 | Ga0587117_002855 | 3300059627 | Bacteria | 1663 |
| 596 | Ga0587122_004021 | 3300059628 | Bacteria | 1167 |
| 597 | Ga0587122_014792 | 3300059628 | Bacteria | 791 |
| 598 | Ga0587128_006070 | 3300059630 | Bacteria | 1473 |
| 599 | Ga0587069_004114 | 3300059642 | Bacteria | 1620 |
| 600 | Ga0587075_015692 | 3300059644 | Bacteria | 1069 |
| 601 | Ga0587075_033034 | 3300059644 | Bacteria | 833 |
| 602 | Ga0587076_027062 | 3300059645 | Bacteria | 991 |
| 603 | Ga0587079_090783 | 3300059647 | Bacteria | 714 |
| 604 | Ga0587100_000082 | 3300059648 | Bacteria | 3477 |
| 605 | Ga0587107_003205 | 3300059652 | Bacteria | 1565 |
| 606 | Ga0587107_033495 | 3300059652 | Bacteria | 795 |
| 607 | Ga0587114_009537 | 3300059655 | Bacteria | 1166 |
| 608 | Ga0587111_0086014 | 3300060346 | Bacteria | 760 |
| 609 | Ga0501082_0115320 | 3300060353 | Bacteria | 2327 |
| 610 | Ga0501082_0238169 | 3300060353 | Bacteria | 1584 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049571 | Ga0501034_0584789 | Ga0501034_0584789_238_855 | 200 |
| 2 | iso_pu_bacteria | 2984576629 | 2984580351 | 202 |
| 3 | iso_pu_bacteria | 2990256926 | 2990258044 | 202 |
| 4 | 3300003316 | rootH1_10021975 | rootH1_100219752 | 203 |
| 5 | 3300003320 | rootH2_10115003 | rootH2_101150032 | 203 |
| 6 | 3300006048 | Ga0075363_100164763 | Ga0075363_1001647631 | 203 |
| 7 | 3300021358 | Ga0213873_10000040 | Ga0213873_1000004029 | 203 |
| 8 | 3300039453 | Ga0436362_0604286 | Ga0436362_0604286_5928_6560 | 203 |
| 9 | 3300042876 | Ga0451577_0976459 | Ga0451577_0976459_52_675 | 203 |
| 10 | 3300005335 | Ga0070666_10148061 | Ga0070666_101480612 | 204 |
| 11 | 3300005337 | Ga0070682_100148263 | Ga0070682_1001482631 | 204 |
| 12 | 3300005355 | Ga0070671_100161721 | Ga0070671_1001617212 | 204 |
| 13 | 3300005367 | Ga0070667_100034375 | Ga0070667_1000343751 | 204 |
| 14 | 3300005455 | Ga0070663_100033919 | Ga0070663_1000339195 | 204 |
| 15 | 3300005457 | Ga0070662_100640234 | Ga0070662_1006402341 | 204 |
| 16 | 3300005535 | Ga0070684_100341013 | Ga0070684_1003410131 | 204 |
| 17 | 3300005548 | Ga0070665_100019267 | Ga0070665_1000192676 | 204 |
| 18 | 3300005548 | Ga0070665_100030195 | Ga0070665_1000301952 | 204 |
| 19 | 3300005563 | Ga0068855_100328541 | Ga0068855_1003285412 | 204 |
| 20 | 3300005564 | Ga0070664_100186793 | Ga0070664_1001867934 | 204 |
| 21 | 3300005616 | Ga0068852_100269682 | Ga0068852_1002696824 | 204 |
| 22 | 3300005617 | Ga0068859_100335786 | Ga0068859_1003357862 | 204 |
| 23 | 3300005618 | Ga0068864_100559063 | Ga0068864_1005590632 | 204 |
| 24 | 3300005841 | Ga0068863_100006671 | Ga0068863_1000066714 | 204 |
| 25 | 3300005842 | Ga0068858_100009215 | Ga0068858_1000092159 | 204 |
| 26 | 3300005843 | Ga0068860_100001398 | Ga0068860_10000139818 | 204 |
| 27 | 3300006038 | Ga0075365_10003782 | Ga0075365_100037827 | 204 |
| 28 | 3300006042 | Ga0075368_10011756 | Ga0075368_100117563 | 204 |
| 29 | 3300006048 | Ga0075363_100001275 | Ga0075363_1000012756 | 204 |
| 30 | 3300006051 | Ga0075364_10044222 | Ga0075364_100442223 | 204 |
| 31 | 3300006177 | Ga0075362_10013146 | Ga0075362_100131464 | 204 |
| 32 | 3300006178 | Ga0075367_10034537 | Ga0075367_100345374 | 204 |
| 33 | 3300006195 | Ga0075366_10112553 | Ga0075366_101125532 | 204 |
| 34 | 3300006353 | Ga0075370_10000831 | Ga0075370_1000083112 | 204 |
| 35 | 3300006358 | Ga0068871_100140176 | Ga0068871_1001401762 | 204 |
| 36 | 3300006931 | Ga0097620_100335805 | Ga0097620_1003358052 | 204 |
| 37 | 3300009093 | Ga0105240_10104170 | Ga0105240_101041702 | 204 |
| 38 | 3300009093 | Ga0105240_10132289 | Ga0105240_101322893 | 204 |
| 39 | 3300009093 | Ga0105240_10366424 | Ga0105240_103664242 | 204 |
| 40 | 3300009101 | Ga0105247_10144497 | Ga0105247_101444972 | 204 |
| 41 | 3300010375 | Ga0105239_10691325 | Ga0105239_106913252 | 204 |
| 42 | 3300013296 | Ga0157374_10449161 | Ga0157374_104491612 | 204 |
| 43 | 3300013306 | Ga0163162_10087813 | Ga0163162_100878133 | 204 |
| 44 | 3300013306 | Ga0163162_10934773 | Ga0163162_109347731 | 204 |
| 45 | 3300014325 | Ga0163163_10149209 | Ga0163163_101492092 | 204 |
| 46 | 3300014325 | Ga0163163_10335083 | Ga0163163_103350831 | 204 |
| 47 | 3300014745 | Ga0157377_10572154 | Ga0157377_105721542 | 204 |
| 48 | 3300014968 | Ga0157379_10071844 | Ga0157379_100718442 | 204 |
| 49 | 3300014969 | Ga0157376_10131513 | Ga0157376_101315132 | 204 |
| 50 | 3300025904 | Ga0207647_10050650 | Ga0207647_100506502 | 204 |
| 51 | 3300025913 | Ga0207695_10131869 | Ga0207695_101318693 | 204 |
| 52 | 3300025913 | Ga0207695_10177631 | Ga0207695_101776313 | 204 |
| 53 | 3300025931 | Ga0207644_10412224 | Ga0207644_104122242 | 204 |
| 54 | 3300025933 | Ga0207706_10448380 | Ga0207706_104483802 | 204 |
| 55 | 3300025941 | Ga0207711_10067069 | Ga0207711_100670694 | 204 |
| 56 | 3300026023 | Ga0207677_10959291 | Ga0207677_109592912 | 204 |
| 57 | 3300026035 | Ga0207703_10000807 | Ga0207703_100008076 | 204 |
| 58 | 3300026041 | Ga0207639_10146750 | Ga0207639_101467502 | 204 |
| 59 | 3300026067 | Ga0207678_10048715 | Ga0207678_100487154 | 204 |
| 60 | 3300026078 | Ga0207702_10101417 | Ga0207702_101014174 | 204 |
| 61 | 3300026088 | Ga0207641_10001391 | Ga0207641_1000139116 | 204 |
| 62 | 3300026095 | Ga0207676_10247741 | Ga0207676_102477412 | 204 |
| 63 | 3300026116 | Ga0207674_10465344 | Ga0207674_104653441 | 204 |
| 64 | 3300027866 | Ga0209813_10016090 | Ga0209813_100160904 | 204 |
| 65 | 3300028379 | Ga0268266_10002456 | Ga0268266_100024564 | 204 |
| 66 | 3300028379 | Ga0268266_10080032 | Ga0268266_100800322 | 204 |
| 67 | 3300028380 | Ga0268265_10012252 | Ga0268265_100122521 | 204 |
| 68 | 3300028381 | Ga0268264_10000085 | Ga0268264_10000085120 | 204 |
| 69 | 3300031251 | Ga0265327_10005827 | Ga0265327_100058275 | 204 |
| 70 | 3300033180 | Ga0307510_10000004 | Ga0307510_10000004151 | 204 |
| 71 | 3300035692 | Ga0373935_0498783 | Ga0373935_0498783_150_764 | 204 |
| 72 | 3300038741 | Ga0400488_34785 | Ga0400488_34785_2942_3556 | 204 |
| 73 | 3300044694 | Ga0466963_0321054 | Ga0466963_0321054_311_925 | 204 |
| 74 | 3300046507 | Ga0495606_0399448 | Ga0495606_0399448_17_631 | 204 |
| 75 | 3300046524 | Ga0495648_0325750 | Ga0495648_0325750_14_628 | 204 |
| 76 | 3300046694 | Ga0495649_0035963 | Ga0495649_0035963_1923_2537 | 204 |
| 77 | 3300048903 | Ga0496100_0671962 | Ga0496100_0671962_40_654 | 204 |
| 78 | 3300048905 | Ga0496102_0004718 | Ga0496102_0004718_10847_11461 | 204 |
| 79 | 3300048906 | Ga0496103_0021452 | Ga0496103_0021452_1274_1888 | 204 |
| 80 | 3300048911 | Ga0496108_0620931 | Ga0496108_0620931_25_639 | 204 |
| 81 | 3300048917 | Ga0496114_0018770 | Ga0496114_0018770_4111_4725 | 204 |
| 82 | 3300048918 | Ga0496115_0330248 | Ga0496115_0330248_432_1046 | 204 |
| 83 | 3300048919 | Ga0496116_0004610 | Ga0496116_0004610_1315_1929 | 204 |
| 84 | 3300048920 | Ga0496117_0000627 | Ga0496117_0000627_32_646 | 204 |
| 85 | 3300048921 | Ga0496118_0000026 | Ga0496118_0000026_332111_332725 | 204 |
| 86 | 3300048921 | Ga0496118_0163857 | Ga0496118_0163857_240_854 | 204 |
| 87 | 3300048922 | Ga0496119_0001354 | Ga0496119_0001354_13213_13827 | 204 |
| 88 | 3300048922 | Ga0496119_0031821 | Ga0496119_0031821_2220_2834 | 204 |
| 89 | 3300048923 | Ga0496120_0000993 | Ga0496120_0000993_29644_30258 | 204 |
| 90 | 3300048923 | Ga0496120_0170119 | Ga0496120_0170119_53_667 | 204 |
| 91 | 3300048927 | Ga0496124_0004491 | Ga0496124_0004491_10883_11497 | 204 |
| 92 | 3300048928 | Ga0496125_0000797 | Ga0496125_0000797_35368_35982 | 204 |
| 93 | 3300048928 | Ga0496125_0051220 | Ga0496125_0051220_2644_3258 | 204 |
| 94 | 3300049568 | Ga0501031_0174319 | Ga0501031_0174319_189_803 | 204 |
| 95 | 3300049580 | Ga0501046_0234887 | Ga0501046_0234887_587_1201 | 204 |
| 96 | 3300049582 | Ga0501048_0208565 | Ga0501048_0208565_733_1347 | 204 |
| 97 | 3300049587 | Ga0501071_0314702 | Ga0501071_0314702_295_909 | 204 |
| 98 | 3300049590 | Ga0501074_0131983 | Ga0501074_0131983_1158_1772 | 204 |
| 99 | 3300049591 | Ga0501075_0139526 | Ga0501075_0139526_330_944 | 204 |
| 100 | 3300050489 | nmdc:mga03683_13119_c1 | nmdc:mga03683_13119_c1_1742_2356 | 204 |
| 101 | 3300050490 | nmdc:mga03n38_10873_c1 | nmdc:mga03n38_10873_c1_878_1492 | 204 |
| 102 | 3300050491 | nmdc:mga00v17_2941_c1 | nmdc:mga00v17_2941_c1_4603_5217 | 204 |
| 103 | 3300050492 | nmdc:mga0yw44_12390_c1 | nmdc:mga0yw44_12390_c1_3478_4092 | 204 |
| 104 | 3300050493 | nmdc:mga0k408_101285_c1 | nmdc:mga0k408_101285_c1_977_1591 | 204 |
| 105 | 3300050494 | nmdc:mga06z11_4627_c1 | nmdc:mga06z11_4627_c1_3938_4552 | 204 |
| 106 | 3300050494 | nmdc:mga06z11_4627_c1 | nmdc:mga06z11_4627_c1_927_1541 | 204 |
| 107 | 3300050495 | nmdc:mga04h51_30398_c1 | nmdc:mga04h51_30398_c1_461_1075 | 204 |
| 108 | 3300050496 | nmdc:mga07m45_3558_c1 | nmdc:mga07m45_3558_c1_4290_4904 | 204 |
| 109 | 3300050507 | nmdc:mga05p37_1020221_c1 | nmdc:mga05p37_1020221_c1_157_771 | 204 |
| 110 | 3300050511 | nmdc:mga08y16_394039_c1 | nmdc:mga08y16_394039_c1_613_1227 | 204 |
| 111 | 3300053088 | Ga0500644_0183216 | Ga0500644_0183216_130_744 | 204 |
| 112 | 3300053163 | Ga0500639_254563 | Ga0500639_254563_66_680 | 204 |
| 113 | 3300059645 | Ga0587076_027062 | Ga0587076_027062_361_975 | 204 |
| 114 | 3300060353 | Ga0501082_0115320 | Ga0501082_0115320_1684_2298 | 204 |
| 115 | iso_pu_bacteria | 2643221632 | 2644183529 | 204 |
| 116 | 3300003308 | Ga0006777J48905_1075518 | Ga0006777J48905_10755181 | 205 |
| 117 | 3300003693 | Ga0032354_1110763 | Ga0032354_11107631 | 205 |
| 118 | 3300005367 | Ga0070667_100217744 | Ga0070667_1002177441 | 205 |
| 119 | 3300005563 | Ga0068855_100206407 | Ga0068855_1002064072 | 205 |
| 120 | 3300005843 | Ga0068860_101159170 | Ga0068860_1011591701 | 205 |
| 121 | 3300005937 | Ga0081455_10013608 | Ga0081455_100136084 | 205 |
| 122 | 3300006051 | Ga0075364_10026964 | Ga0075364_100269645 | 205 |
| 123 | 3300006353 | Ga0075370_10057888 | Ga0075370_100578882 | 205 |
| 124 | 3300006353 | Ga0075370_10350692 | Ga0075370_103506921 | 205 |
| 125 | 3300007265 | Ga0099794_10005735 | Ga0099794_100057355 | 205 |
| 126 | 3300009987 | Ga0105030_107289 | Ga0105030_1072892 | 205 |
| 127 | 3300010375 | Ga0105239_10076094 | Ga0105239_100760943 | 205 |
| 128 | 3300025986 | Ga0207658_11052320 | Ga0207658_110523201 | 205 |
| 129 | 3300027671 | Ga0209588_1005692 | Ga0209588_10056924 | 205 |
| 130 | 3300028381 | Ga0268264_10310987 | Ga0268264_103109873 | 205 |
| 131 | 3300030744 | Ga0316181_1159012 | Ga0316181_11590122 | 205 |
| 132 | 3300030745 | Ga0316182_1260240 | Ga0316182_12602401 | 205 |
| 133 | 3300041413 | Ga0439465_0014624 | Ga0439465_0014624_1674_2294 | 205 |
| 134 | 3300041413 | Ga0439465_0058820 | Ga0439465_0058820_402_1022 | 205 |
| 135 | 3300041456 | Ga0451795_0943970 | Ga0451795_0943970_216_833 | 205 |
| 136 | 3300041494 | Ga0451837_0003726 | Ga0451837_0003726_637_1254 | 205 |
| 137 | 3300041496 | Ga0451839_1219122 | Ga0451839_1219122_2954_3571 | 205 |
| 138 | 3300042004 | Ga0439445_0019410 | Ga0439445_0019410_426_1046 | 205 |
| 139 | 3300042006 | Ga0439432_086246 | Ga0439432_086246_135_755 | 205 |
| 140 | 3300042156 | Ga0439446_0133855 | Ga0439446_0133855_32_652 | 205 |
| 141 | 3300046507 | Ga0495606_0059796 | Ga0495606_0059796_519_1136 | 205 |
| 142 | 3300046524 | Ga0495648_0006724 | Ga0495648_0006724_3532_4149 | 205 |
| 143 | 3300046616 | Ga0495668_0011512 | Ga0495668_0011512_2695_3312 | 205 |
| 144 | 3300046648 | Ga0495611_0053461 | Ga0495611_0053461_412_1029 | 205 |
| 145 | 3300047320 | Ga0495672_0009376 | Ga0495672_0009376_5619_6236 | 205 |
| 146 | 3300047469 | Ga0495673_0002913 | Ga0495673_0002913_200_817 | 205 |
| 147 | 3300048903 | Ga0496100_0001674 | Ga0496100_0001674_7037_7654 | 205 |
| 148 | 3300048904 | Ga0496101_0000110 | Ga0496101_0000110_81610_82227 | 205 |
| 149 | 3300048905 | Ga0496102_0000006 | Ga0496102_0000006_258093_258710 | 205 |
| 150 | 3300048906 | Ga0496103_0000006 | Ga0496103_0000006_257891_258508 | 205 |
| 151 | 3300048910 | Ga0496107_0026082 | Ga0496107_0026082_3013_3630 | 205 |
| 152 | 3300048914 | Ga0496111_0576243 | Ga0496111_0576243_11_628 | 205 |
| 153 | 3300048919 | Ga0496116_0000025 | Ga0496116_0000025_212032_212649 | 205 |
| 154 | 3300048920 | Ga0496117_0000006 | Ga0496117_0000006_212032_212649 | 205 |
| 155 | 3300048921 | Ga0496118_0000004 | Ga0496118_0000004_212032_212649 | 205 |
| 156 | 3300048922 | Ga0496119_0000035 | Ga0496119_0000035_3627_4244 | 205 |
| 157 | 3300048923 | Ga0496120_0000706 | Ga0496120_0000706_25547_26164 | 205 |
| 158 | 3300048924 | Ga0496121_0000090 | Ga0496121_0000090_163933_164550 | 205 |
| 159 | 3300048929 | Ga0496126_0001450 | Ga0496126_0001450_15749_16366 | 205 |
| 160 | 3300049584 | Ga0501068_0646423 | Ga0501068_0646423_57_674 | 205 |
| 161 | 3300049591 | Ga0501075_0258073 | Ga0501075_0258073_34_651 | 205 |
| 162 | 3300050491 | nmdc:mga00v17_3307_c1 | nmdc:mga00v17_3307_c1_1079_1840 | 205 |
| 163 | 3300050496 | nmdc:mga07m45_183641_c1 | nmdc:mga07m45_183641_c1_428_1048 | 205 |
| 164 | 3300003792 | Ga0055540_1003784 | Ga0055540_10037846 | 206 |
| 165 | 3300005937 | Ga0081455_10000207 | Ga0081455_1000020755 | 206 |
| 166 | 3300006038 | Ga0075365_10058912 | Ga0075365_100589122 | 206 |
| 167 | 3300006038 | Ga0075365_10077292 | Ga0075365_100772922 | 206 |
| 168 | 3300006038 | Ga0075365_10321481 | Ga0075365_103214812 | 206 |
| 169 | 3300006048 | Ga0075363_100001042 | Ga0075363_1000010425 | 206 |
| 170 | 3300006048 | Ga0075363_100147015 | Ga0075363_1001470152 | 206 |
| 171 | 3300006051 | Ga0075364_10001524 | Ga0075364_1000152412 | 206 |
| 172 | 3300006177 | Ga0075362_10161873 | Ga0075362_101618732 | 206 |
| 173 | 3300006178 | Ga0075367_10197659 | Ga0075367_101976592 | 206 |
| 174 | 3300006186 | Ga0075369_10009203 | Ga0075369_100092033 | 206 |
| 175 | 3300006186 | Ga0075369_10011183 | Ga0075369_100111833 | 206 |
| 176 | 3300006186 | Ga0075369_10031646 | Ga0075369_100316463 | 206 |
| 177 | 3300006186 | Ga0075369_10044045 | Ga0075369_100440453 | 206 |
| 178 | 3300006186 | Ga0075369_10084148 | Ga0075369_100841482 | 206 |
| 179 | 3300006353 | Ga0075370_10000679 | Ga0075370_100006798 | 206 |
| 180 | 3300006353 | Ga0075370_10019884 | Ga0075370_100198843 | 206 |
| 181 | 3300025273 | Ga0209673_1032276 | Ga0209673_10322763 | 206 |
| 182 | 3300025303 | Ga0209051_1000374 | Ga0209051_100037449 | 206 |
| 183 | 3300025303 | Ga0209051_1002709 | Ga0209051_100270910 | 206 |
| 184 | 3300025303 | Ga0209051_1014602 | Ga0209051_10146022 | 206 |
| 185 | 3300026067 | Ga0207678_10025987 | Ga0207678_100259873 | 206 |
| 186 | 3300027866 | Ga0209813_10017468 | Ga0209813_100174682 | 206 |
| 187 | 3300031852 | Ga0307410_10141637 | Ga0307410_101416372 | 206 |
| 188 | 3300031903 | Ga0307407_10219850 | Ga0307407_102198502 | 206 |
| 189 | 3300032126 | Ga0307415_100635628 | Ga0307415_1006356282 | 206 |
| 190 | 3300041452 | Ga0451793_1384911 | Ga0451793_1384911_659_1279 | 206 |
| 191 | 3300041456 | Ga0451795_0568771 | Ga0451795_0568771_69_689 | 206 |
| 192 | 3300044684 | Ga0466966_0561341 | Ga0466966_0561341_56_676 | 206 |
| 193 | 3300045976 | Ga0466967_0068759 | Ga0466967_0068759_1937_2557 | 206 |
| 194 | 3300049580 | Ga0501046_0000211 | Ga0501046_0000211_19726_20346 | 206 |
| 195 | 3300050489 | nmdc:mga03683_292364_c1 | nmdc:mga03683_292364_c1_91_711 | 206 |
| 196 | 3300050490 | nmdc:mga03n38_104633_c1 | nmdc:mga03n38_104633_c1_32_652 | 206 |
| 197 | 3300050490 | nmdc:mga03n38_1445_c1 | nmdc:mga03n38_1445_c1_1697_2317 | 206 |
| 198 | 3300050490 | nmdc:mga03n38_24439_c1 | nmdc:mga03n38_24439_c1_1735_2355 | 206 |
| 199 | 3300050491 | nmdc:mga00v17_119386_c1 | nmdc:mga00v17_119386_c1_306_926 | 206 |
| 200 | 3300050491 | nmdc:mga00v17_284749_c1 | nmdc:mga00v17_284749_c1_263_883 | 206 |
| 201 | 3300050491 | nmdc:mga00v17_3432_c1 | nmdc:mga00v17_3432_c1_245_865 | 206 |
| 202 | 3300050492 | nmdc:mga0yw44_11204_c1 | nmdc:mga0yw44_11204_c1_174_794 | 206 |
| 203 | 3300050492 | nmdc:mga0yw44_303579_c1 | nmdc:mga0yw44_303579_c1_435_1055 | 206 |
| 204 | 3300050492 | nmdc:mga0yw44_85307_c1 | nmdc:mga0yw44_85307_c1_343_963 | 206 |
| 205 | 3300050494 | nmdc:mga06z11_189233_c1 | nmdc:mga06z11_189233_c1_394_1014 | 206 |
| 206 | 3300050494 | nmdc:mga06z11_7615_c1 | nmdc:mga06z11_7615_c1_3593_4213 | 206 |
| 207 | 3300050495 | nmdc:mga04h51_71360_c1 | nmdc:mga04h51_71360_c1_315_935 | 206 |
| 208 | 3300050496 | nmdc:mga07m45_2158_c1 | nmdc:mga07m45_2158_c1_7747_8367 | 206 |
| 209 | 3300050496 | nmdc:mga07m45_4451_c1 | nmdc:mga07m45_4451_c1_2777_3397 | 206 |
| 210 | 3300050516 | nmdc:mga0sz30_11381_c1 | nmdc:mga0sz30_11381_c1_859_1479 | 206 |
| 211 | 3300050516 | nmdc:mga0sz30_25827_c1 | nmdc:mga0sz30_25827_c1_1313_1933 | 206 |
| 212 | 3300050516 | nmdc:mga0sz30_35294_c1 | nmdc:mga0sz30_35294_c1_537_1157 | 206 |
| 213 | 3300050516 | nmdc:mga0sz30_6651_c1 | nmdc:mga0sz30_6651_c1_2742_3362 | 206 |
| 214 | 3300053130 | Ga0500642_0143918 | Ga0500642_0143918_274_894 | 206 |
| 215 | 3300053153 | Ga0500616_0014815 | Ga0500616_0014815_1724_2344 | 206 |
| 216 | 3300059625 | Ga0587113_015439 | Ga0587113_015439_109_729 | 206 |
| 217 | 3300059628 | Ga0587122_014792 | Ga0587122_014792_149_769 | 206 |
| 218 | 3300059647 | Ga0587079_090783 | Ga0587079_090783_80_700 | 206 |
| 219 | 3300059652 | Ga0587107_033495 | Ga0587107_033495_151_771 | 206 |
| 220 | 3300060346 | Ga0587111_0086014 | Ga0587111_0086014_44_664 | 206 |
| 221 | 3300003792 | Ga0055540_1000038 | Ga0055540_1000038136 | 207 |
| 222 | 3300005329 | Ga0070683_100157648 | Ga0070683_1001576481 | 207 |
| 223 | 3300005335 | Ga0070666_10025598 | Ga0070666_100255983 | 207 |
| 224 | 3300005337 | Ga0070682_100155270 | Ga0070682_1001552702 | 207 |
| 225 | 3300005367 | Ga0070667_100000883 | Ga0070667_10000088311 | 207 |
| 226 | 3300005435 | Ga0070714_100594129 | Ga0070714_1005941292 | 207 |
| 227 | 3300005436 | Ga0070713_100692151 | Ga0070713_1006921511 | 207 |
| 228 | 3300005455 | Ga0070663_100004514 | Ga0070663_1000045146 | 207 |
| 229 | 3300005456 | Ga0070678_100280349 | Ga0070678_1002803492 | 207 |
| 230 | 3300005456 | Ga0070678_100829076 | Ga0070678_1008290761 | 207 |
| 231 | 3300005535 | Ga0070684_100209224 | Ga0070684_1002092243 | 207 |
| 232 | 3300005535 | Ga0070684_100637972 | Ga0070684_1006379722 | 207 |
| 233 | 3300005548 | Ga0070665_101633095 | Ga0070665_1016330951 | 207 |
| 234 | 3300005615 | Ga0070702_100391043 | Ga0070702_1003910431 | 207 |
| 235 | 3300005616 | Ga0068852_100516158 | Ga0068852_1005161583 | 207 |
| 236 | 3300005718 | Ga0068866_10453684 | Ga0068866_104536841 | 207 |
| 237 | 3300005841 | Ga0068863_100856370 | Ga0068863_1008563701 | 207 |
| 238 | 3300005842 | Ga0068858_100425812 | Ga0068858_1004258121 | 207 |
| 239 | 3300006028 | Ga0070717_10286919 | Ga0070717_102869193 | 207 |
| 240 | 3300006051 | Ga0075364_10024010 | Ga0075364_100240105 | 207 |
| 241 | 3300006051 | Ga0075364_10039469 | Ga0075364_100394693 | 207 |
| 242 | 3300006177 | Ga0075362_10158376 | Ga0075362_101583762 | 207 |
| 243 | 3300006178 | Ga0075367_10240779 | Ga0075367_102407792 | 207 |
| 244 | 3300006353 | Ga0075370_10078689 | Ga0075370_100786891 | 207 |
| 245 | 3300009098 | Ga0105245_10252616 | Ga0105245_102526162 | 207 |
| 246 | 3300009098 | Ga0105245_10612284 | Ga0105245_106122841 | 207 |
| 247 | 3300009176 | Ga0105242_11116067 | Ga0105242_111160671 | 207 |
| 248 | 3300009545 | Ga0105237_10005032 | Ga0105237_1000503212 | 207 |
| 249 | 3300010375 | Ga0105239_10064574 | Ga0105239_100645741 | 207 |
| 250 | 3300011119 | Ga0105246_10207809 | Ga0105246_102078092 | 207 |
| 251 | 3300011119 | Ga0105246_10337432 | Ga0105246_103374321 | 207 |
| 252 | 3300013104 | Ga0157370_10907487 | Ga0157370_109074871 | 207 |
| 253 | 3300013105 | Ga0157369_10314346 | Ga0157369_103143461 | 207 |
| 254 | 3300013306 | Ga0163162_11019529 | Ga0163162_110195291 | 207 |
| 255 | 3300013308 | Ga0157375_11281557 | Ga0157375_112815572 | 207 |
| 256 | 3300014325 | Ga0163163_11275127 | Ga0163163_112751271 | 207 |
| 257 | 3300014326 | Ga0157380_11736769 | Ga0157380_117367691 | 207 |
| 258 | 3300017792 | Ga0163161_10358734 | Ga0163161_103587342 | 207 |
| 259 | 3300020080 | Ga0206350_10065044 | Ga0206350_100650441 | 207 |
| 260 | 3300020610 | Ga0154015_1584249 | Ga0154015_15842492 | 207 |
| 261 | 3300021384 | Ga0213876_10006253 | Ga0213876_100062536 | 207 |
| 262 | 3300021388 | Ga0213875_10132135 | Ga0213875_101321351 | 207 |
| 263 | 3300021388 | Ga0213875_10299607 | Ga0213875_102996071 | 207 |
| 264 | 3300025303 | Ga0209051_1000014 | Ga0209051_1000014206 | 207 |
| 265 | 3300025898 | Ga0207692_10461580 | Ga0207692_104615801 | 207 |
| 266 | 3300025914 | Ga0207671_10005149 | Ga0207671_1000514915 | 207 |
| 267 | 3300025928 | Ga0207700_10678459 | Ga0207700_106784591 | 207 |
| 268 | 3300025929 | Ga0207664_10048736 | Ga0207664_100487365 | 207 |
| 269 | 3300025938 | Ga0207704_10347750 | Ga0207704_103477502 | 207 |
| 270 | 3300025944 | Ga0207661_10089038 | Ga0207661_100890382 | 207 |
| 271 | 3300025972 | Ga0207668_10281216 | Ga0207668_102812161 | 207 |
| 272 | 3300025986 | Ga0207658_10001419 | Ga0207658_1000141915 | 207 |
| 273 | 3300026067 | Ga0207678_10000934 | Ga0207678_100009344 | 207 |
| 274 | 3300026067 | Ga0207678_10411387 | Ga0207678_104113872 | 207 |
| 275 | 3300026088 | Ga0207641_11220657 | Ga0207641_112206572 | 207 |
| 276 | 3300026116 | Ga0207674_11213387 | Ga0207674_112133871 | 207 |
| 277 | 3300026121 | Ga0207683_10324271 | Ga0207683_103242712 | 207 |
| 278 | 3300026121 | Ga0207683_10862305 | Ga0207683_108623052 | 207 |
| 279 | 3300028786 | Ga0307517_10277239 | Ga0307517_102772391 | 207 |
| 280 | 3300028794 | Ga0307515_10054821 | Ga0307515_100548213 | 207 |
| 281 | 3300030521 | Ga0307511_10284115 | Ga0307511_102841151 | 207 |
| 282 | 3300030522 | Ga0307512_10277320 | Ga0307512_102773201 | 207 |
| 283 | 3300030742 | Ga0316183_1173540 | Ga0316183_11735401 | 207 |
| 284 | 3300031251 | Ga0265327_10000363 | Ga0265327_1000036315 | 207 |
| 285 | 3300031251 | Ga0265327_10000718 | Ga0265327_1000071813 | 207 |
| 286 | 3300031251 | Ga0265327_10035317 | Ga0265327_100353173 | 207 |
| 287 | 3300031507 | Ga0307509_10231320 | Ga0307509_102313202 | 207 |
| 288 | 3300031731 | Ga0307405_10088021 | Ga0307405_100880213 | 207 |
| 289 | 3300031824 | Ga0307413_10125169 | Ga0307413_101251691 | 207 |
| 290 | 3300031838 | Ga0307518_10000537 | Ga0307518_1000053714 | 207 |
| 291 | 3300033179 | Ga0307507_10010108 | Ga0307507_1001010810 | 207 |
| 292 | 3300033180 | Ga0307510_10055559 | Ga0307510_100555592 | 207 |
| 293 | 3300035090 | Ga0373949_0133861 | Ga0373949_0133861_58_681 | 207 |
| 294 | 3300037853 | Ga0436364_1009445 | Ga0436364_1009445_21876_22499 | 207 |
| 295 | 3300037853 | Ga0436364_1332711 | Ga0436364_1332711_4304_4927 | 207 |
| 296 | 3300037853 | Ga0436364_1469378 | Ga0436364_1469378_3485_4108 | 207 |
| 297 | 3300039437 | Ga0436365_0812603 | Ga0436365_0812603_3372_3995 | 207 |
| 298 | 3300039437 | Ga0436365_1635789 | Ga0436365_1635789_1790_2413 | 207 |
| 299 | 3300039450 | Ga0436363_1213162 | Ga0436363_1213162_3229_3852 | 207 |
| 300 | 3300041411 | Ga0439466_0004549 | Ga0439466_0004549_4089_4712 | 207 |
| 301 | 3300041443 | Ga0451789_0651037 | Ga0451789_0651037_37_660 | 207 |
| 302 | 3300041451 | Ga0451791_0061301 | Ga0451791_0061301_999_1622 | 207 |
| 303 | 3300041452 | Ga0451793_0166662 | Ga0451793_0166662_70_693 | 207 |
| 304 | 3300041453 | Ga0451797_0468809 | Ga0451797_0468809_81_704 | 207 |
| 305 | 3300041459 | Ga0451800_1453589 | Ga0451800_1453589_62_685 | 207 |
| 306 | 3300041460 | Ga0451802_1877652 | Ga0451802_1877652_549_1172 | 207 |
| 307 | 3300041486 | Ga0451807_0080565 | Ga0451807_0080565_206_829 | 207 |
| 308 | 3300041496 | Ga0451839_1156414 | Ga0451839_1156414_190_813 | 207 |
| 309 | 3300041496 | Ga0451839_1205715 | Ga0451839_1205715_286_909 | 207 |
| 310 | 3300041498 | Ga0451841_0503750 | Ga0451841_0503750_433_1056 | 207 |
| 311 | 3300041503 | Ga0451847_0262175 | Ga0451847_0262175_83_706 | 207 |
| 312 | 3300041509 | Ga0451843_0729029 | Ga0451843_0729029_1958_2581 | 207 |
| 313 | 3300041997 | Ga0439431_0000284 | Ga0439431_0000284_7830_8453 | 207 |
| 314 | 3300042004 | Ga0439445_0010564 | Ga0439445_0010564_706_1329 | 207 |
| 315 | 3300042435 | Ga0439434_0014629 | Ga0439434_0014629_761_1384 | 207 |
| 316 | 3300042436 | Ga0439435_0103587 | Ga0439435_0103587_40_663 | 207 |
| 317 | 3300044658 | Ga0466972_0002342 | Ga0466972_0002342_4647_5270 | 207 |
| 318 | 3300044658 | Ga0466972_0004109 | Ga0466972_0004109_6367_6990 | 207 |
| 319 | 3300044658 | Ga0466972_0050109 | Ga0466972_0050109_79_702 | 207 |
| 320 | 3300044658 | Ga0466972_0246042 | Ga0466972_0246042_49_672 | 207 |
| 321 | 3300044683 | Ga0466965_0036779 | Ga0466965_0036779_717_1340 | 207 |
| 322 | 3300044683 | Ga0466965_0179684 | Ga0466965_0179684_232_855 | 207 |
| 323 | 3300044683 | Ga0466965_0319488 | Ga0466965_0319488_188_811 | 207 |
| 324 | 3300044693 | Ga0466961_0437341 | Ga0466961_0437341_121_744 | 207 |
| 325 | 3300044694 | Ga0466963_0062607 | Ga0466963_0062607_1779_2402 | 207 |
| 326 | 3300044694 | Ga0466963_0101767 | Ga0466963_0101767_1053_1676 | 207 |
| 327 | 3300044694 | Ga0466963_0504683 | Ga0466963_0504683_174_797 | 207 |
| 328 | 3300044719 | Ga0466971_0002362 | Ga0466971_0002362_3693_4316 | 207 |
| 329 | 3300044719 | Ga0466971_0300103 | Ga0466971_0300103_125_748 | 207 |
| 330 | 3300044735 | Ga0466968_0031758 | Ga0466968_0031758_755_1378 | 207 |
| 331 | 3300044765 | Ga0466970_0011371 | Ga0466970_0011371_1063_1686 | 207 |
| 332 | 3300044842 | Ga0466957_0054983 | Ga0466957_0054983_1288_1911 | 207 |
| 333 | 3300044901 | Ga0466960_0000501 | Ga0466960_0000501_3138_3761 | 207 |
| 334 | 3300044901 | Ga0466960_0000607 | Ga0466960_0000607_6821_7444 | 207 |
| 335 | 3300044901 | Ga0466960_0001790 | Ga0466960_0001790_2645_3268 | 207 |
| 336 | 3300044901 | Ga0466960_0042153 | Ga0466960_0042153_1199_1822 | 207 |
| 337 | 3300045836 | Ga0466958_0032928 | Ga0466958_0032928_1800_2423 | 207 |
| 338 | 3300045836 | Ga0466958_0655382 | Ga0466958_0655382_39_662 | 207 |
| 339 | 3300045836 | Ga0466958_0661483 | Ga0466958_0661483_42_665 | 207 |
| 340 | 3300045976 | Ga0466967_0004822 | Ga0466967_0004822_3115_3738 | 207 |
| 341 | 3300045976 | Ga0466967_0128660 | Ga0466967_0128660_1080_1703 | 207 |
| 342 | 3300045976 | Ga0466967_0281547 | Ga0466967_0281547_81_704 | 207 |
| 343 | 3300046461 | Ga0495641_0125160 | Ga0495641_0125160_467_1090 | 207 |
| 344 | 3300046473 | Ga0495582_0262013 | Ga0495582_0262013_166_789 | 207 |
| 345 | 3300047323 | Ga0495683_0001308 | Ga0495683_0001308_8911_9534 | 207 |
| 346 | 3300048903 | Ga0496100_0000087 | Ga0496100_0000087_13807_14430 | 207 |
| 347 | 3300048904 | Ga0496101_0000034 | Ga0496101_0000034_131856_132479 | 207 |
| 348 | 3300048905 | Ga0496102_0007220 | Ga0496102_0007220_2270_2893 | 207 |
| 349 | 3300048905 | Ga0496102_0241949 | Ga0496102_0241949_84_707 | 207 |
| 350 | 3300048905 | Ga0496102_0792706 | Ga0496102_0792706_186_809 | 207 |
| 351 | 3300048906 | Ga0496103_0005953 | Ga0496103_0005953_2626_3249 | 207 |
| 352 | 3300048907 | Ga0496104_0444854 | Ga0496104_0444854_326_949 | 207 |
| 353 | 3300048909 | Ga0496106_0043502 | Ga0496106_0043502_1340_1963 | 207 |
| 354 | 3300048909 | Ga0496106_0056467 | Ga0496106_0056467_1423_2046 | 207 |
| 355 | 3300048910 | Ga0496107_0000108 | Ga0496107_0000108_14066_14689 | 207 |
| 356 | 3300048911 | Ga0496108_0007784 | Ga0496108_0007784_7834_8457 | 207 |
| 357 | 3300048911 | Ga0496108_0277126 | Ga0496108_0277126_500_1123 | 207 |
| 358 | 3300048912 | Ga0496109_0000127 | Ga0496109_0000127_31864_32487 | 207 |
| 359 | 3300048913 | Ga0496110_0000632 | Ga0496110_0000632_10204_10827 | 207 |
| 360 | 3300048914 | Ga0496111_0063969 | Ga0496111_0063969_557_1180 | 207 |
| 361 | 3300048917 | Ga0496114_0000277 | Ga0496114_0000277_1288_1911 | 207 |
| 362 | 3300048917 | Ga0496114_0170692 | Ga0496114_0170692_954_1577 | 207 |
| 363 | 3300048919 | Ga0496116_0009881 | Ga0496116_0009881_2056_2679 | 207 |
| 364 | 3300048920 | Ga0496117_0022600 | Ga0496117_0022600_198_821 | 207 |
| 365 | 3300048921 | Ga0496118_0012406 | Ga0496118_0012406_3678_4301 | 207 |
| 366 | 3300048922 | Ga0496119_0007860 | Ga0496119_0007860_4529_5152 | 207 |
| 367 | 3300048924 | Ga0496121_0000048 | Ga0496121_0000048_135746_136369 | 207 |
| 368 | 3300048925 | Ga0496122_0002047 | Ga0496122_0002047_6870_7493 | 207 |
| 369 | 3300048926 | Ga0496123_0005077 | Ga0496123_0005077_11408_12031 | 207 |
| 370 | 3300048927 | Ga0496124_0000044 | Ga0496124_0000044_193874_194497 | 207 |
| 371 | 3300048928 | Ga0496125_0000037 | Ga0496125_0000037_135746_136369 | 207 |
| 372 | 3300048929 | Ga0496126_0000046 | Ga0496126_0000046_135746_136369 | 207 |
| 373 | 3300049569 | Ga0501032_0002384 | Ga0501032_0002384_13768_14391 | 207 |
| 374 | 3300049571 | Ga0501034_0011550 | Ga0501034_0011550_8491_9114 | 207 |
| 375 | 3300049571 | Ga0501034_0031705 | Ga0501034_0031705_4343_4966 | 207 |
| 376 | 3300049572 | Ga0501036_0024273 | Ga0501036_0024273_3498_4121 | 207 |
| 377 | 3300049573 | Ga0501037_0001507 | Ga0501037_0001507_10809_11432 | 207 |
| 378 | 3300049573 | Ga0501037_0010756 | Ga0501037_0010756_186_809 | 207 |
| 379 | 3300049575 | Ga0501039_0000312 | Ga0501039_0000312_30797_31420 | 207 |
| 380 | 3300049579 | Ga0501043_0003966 | Ga0501043_0003966_5784_6407 | 207 |
| 381 | 3300049579 | Ga0501043_0280794 | Ga0501043_0280794_588_1211 | 207 |
| 382 | 3300049580 | Ga0501046_0002714 | Ga0501046_0002714_3924_4547 | 207 |
| 383 | 3300049581 | Ga0501047_0004432 | Ga0501047_0004432_11978_12601 | 207 |
| 384 | 3300049582 | Ga0501048_0008617 | Ga0501048_0008617_3856_4479 | 207 |
| 385 | 3300049586 | Ga0501070_0000555 | Ga0501070_0000555_15173_15796 | 207 |
| 386 | 3300049586 | Ga0501070_0008107 | Ga0501070_0008107_4413_5036 | 207 |
| 387 | 3300049587 | Ga0501071_0464338 | Ga0501071_0464338_30_653 | 207 |
| 388 | 3300049589 | Ga0501073_0027373 | Ga0501073_0027373_2272_2895 | 207 |
| 389 | 3300049822 | Ga0501035_0001560 | Ga0501035_0001560_3876_4499 | 207 |
| 390 | 3300049823 | Ga0501044_0003330 | Ga0501044_0003330_12663_13286 | 207 |
| 391 | 3300049823 | Ga0501044_0012905 | Ga0501044_0012905_5352_5975 | 207 |
| 392 | 3300050490 | nmdc:mga03n38_13994_c1 | nmdc:mga03n38_13994_c1_1120_1743 | 207 |
| 393 | 3300050491 | nmdc:mga00v17_1500_c1 | nmdc:mga00v17_1500_c1_359_982 | 207 |
| 394 | 3300050491 | nmdc:mga00v17_206142_c1 | nmdc:mga00v17_206142_c1_633_1256 | 207 |
| 395 | 3300050491 | nmdc:mga00v17_2304_c1 | nmdc:mga00v17_2304_c1_951_1574 | 207 |
| 396 | 3300050491 | nmdc:mga00v17_95465_c1 | nmdc:mga00v17_95465_c1_801_1424 | 207 |
| 397 | 3300050496 | nmdc:mga07m45_104000_c1 | nmdc:mga07m45_104000_c1_135_758 | 207 |
| 398 | 3300050496 | nmdc:mga07m45_74577_c1 | nmdc:mga07m45_74577_c1_424_1047 | 207 |
| 399 | 3300050511 | nmdc:mga08y16_1043553_c1 | nmdc:mga08y16_1043553_c1_139_762 | 207 |
| 400 | 3300053088 | Ga0500644_0102943 | Ga0500644_0102943_385_1008 | 207 |
| 401 | 3300053098 | Ga0500650_0316548 | Ga0500650_0316548_33_656 | 207 |
| 402 | 3300053099 | Ga0500654_132538 | Ga0500654_132538_171_794 | 207 |
| 403 | 3300059492 | Ga0587073_0056959 | Ga0587073_0056959_109_732 | 207 |
| 404 | 3300059644 | Ga0587075_033034 | Ga0587075_033034_125_748 | 207 |
| 405 | 3300001979 | JGI24740J21852_10005429 | JGI24740J21852_100054297 | 208 |
| 406 | 3300003373 | JGI25407J50210_10005288 | JGI25407J50210_100052881 | 208 |
| 407 | 3300003559 | Ga0007427J51700_105926 | Ga0007427J51700_1059261 | 208 |
| 408 | 3300003735 | Ga0006780_1008331 | Ga0006780_10083311 | 208 |
| 409 | 3300005334 | Ga0068869_100147204 | Ga0068869_1001472041 | 208 |
| 410 | 3300005337 | Ga0070682_100322331 | Ga0070682_1003223312 | 208 |
| 411 | 3300005347 | Ga0070668_100042491 | Ga0070668_1000424913 | 208 |
| 412 | 3300005347 | Ga0070668_100159624 | Ga0070668_1001596241 | 208 |
| 413 | 3300005366 | Ga0070659_100052957 | Ga0070659_1000529572 | 208 |
| 414 | 3300005444 | Ga0070694_100840447 | Ga0070694_1008404471 | 208 |
| 415 | 3300005457 | Ga0070662_100019711 | Ga0070662_1000197113 | 208 |
| 416 | 3300005539 | Ga0068853_100588154 | Ga0068853_1005881542 | 208 |
| 417 | 3300005548 | Ga0070665_100063466 | Ga0070665_1000634663 | 208 |
| 418 | 3300005577 | Ga0068857_100212955 | Ga0068857_1002129552 | 208 |
| 419 | 3300005616 | Ga0068852_100320633 | Ga0068852_1003206332 | 208 |
| 420 | 3300005618 | Ga0068864_100513670 | Ga0068864_1005136702 | 208 |
| 421 | 3300005719 | Ga0068861_100033383 | Ga0068861_1000333834 | 208 |
| 422 | 3300005841 | Ga0068863_100339613 | Ga0068863_1003396132 | 208 |
| 423 | 3300005843 | Ga0068860_100108047 | Ga0068860_1001080473 | 208 |
| 424 | 3300005844 | Ga0068862_100323257 | Ga0068862_1003232571 | 208 |
| 425 | 3300005937 | Ga0081455_10064417 | Ga0081455_100644173 | 208 |
| 426 | 3300005981 | Ga0081538_10000264 | Ga0081538_1000026452 | 208 |
| 427 | 3300005985 | Ga0081539_10000238 | Ga0081539_10000238100 | 208 |
| 428 | 3300006051 | Ga0075364_10061223 | Ga0075364_100612231 | 208 |
| 429 | 3300006058 | Ga0075432_10000510 | Ga0075432_100005103 | 208 |
| 430 | 3300006058 | Ga0075432_10004766 | Ga0075432_100047663 | 208 |
| 431 | 3300006844 | Ga0075428_100027233 | Ga0075428_1000272335 | 208 |
| 432 | 3300006844 | Ga0075428_100706748 | Ga0075428_1007067482 | 208 |
| 433 | 3300006847 | Ga0075431_100021145 | Ga0075431_1000211454 | 208 |
| 434 | 3300006852 | Ga0075433_10001532 | Ga0075433_1000153215 | 208 |
| 435 | 3300006852 | Ga0075433_10079522 | Ga0075433_100795224 | 208 |
| 436 | 3300006852 | Ga0075433_10110140 | Ga0075433_101101402 | 208 |
| 437 | 3300006871 | Ga0075434_100015448 | Ga0075434_1000154485 | 208 |
| 438 | 3300006871 | Ga0075434_100016447 | Ga0075434_1000164474 | 208 |
| 439 | 3300006880 | Ga0075429_100004156 | Ga0075429_1000041567 | 208 |
| 440 | 3300006914 | Ga0075436_100003245 | Ga0075436_1000032459 | 208 |
| 441 | 3300006914 | Ga0075436_100236204 | Ga0075436_1002362041 | 208 |
| 442 | 3300007076 | Ga0075435_100010972 | Ga0075435_1000109728 | 208 |
| 443 | 3300007076 | Ga0075435_100029647 | Ga0075435_1000296474 | 208 |
| 444 | 3300007076 | Ga0075435_100135837 | Ga0075435_1001358373 | 208 |
| 445 | 3300007265 | Ga0099794_10000738 | Ga0099794_100007386 | 208 |
| 446 | 3300009094 | Ga0111539_10003621 | Ga0111539_1000362114 | 208 |
| 447 | 3300009094 | Ga0111539_10070087 | Ga0111539_100700872 | 208 |
| 448 | 3300009098 | Ga0105245_10164386 | Ga0105245_101643863 | 208 |
| 449 | 3300009147 | Ga0114129_10001176 | Ga0114129_1000117613 | 208 |
| 450 | 3300009147 | Ga0114129_10001788 | Ga0114129_100017887 | 208 |
| 451 | 3300009147 | Ga0114129_10361425 | Ga0114129_103614252 | 208 |
| 452 | 3300009148 | Ga0105243_10155893 | Ga0105243_101558932 | 208 |
| 453 | 3300009174 | Ga0105241_10032975 | Ga0105241_100329751 | 208 |
| 454 | 3300009176 | Ga0105242_10868133 | Ga0105242_108681331 | 208 |
| 455 | 3300009545 | Ga0105237_10256395 | Ga0105237_102563952 | 208 |
| 456 | 3300009551 | Ga0105238_10105106 | Ga0105238_101051061 | 208 |
| 457 | 3300009551 | Ga0105238_10212671 | Ga0105238_102126712 | 208 |
| 458 | 3300009553 | Ga0105249_10006755 | Ga0105249_100067551 | 208 |
| 459 | 3300010375 | Ga0105239_10413774 | Ga0105239_104137742 | 208 |
| 460 | 3300013102 | Ga0157371_10118799 | Ga0157371_101187992 | 208 |
| 461 | 3300013307 | Ga0157372_11048172 | Ga0157372_110481721 | 208 |
| 462 | 3300013308 | Ga0157375_10366935 | Ga0157375_103669352 | 208 |
| 463 | 3300014325 | Ga0163163_10330838 | Ga0163163_103308382 | 208 |
| 464 | 3300014326 | Ga0157380_10114603 | Ga0157380_101146033 | 208 |
| 465 | 3300014326 | Ga0157380_10715681 | Ga0157380_107156811 | 208 |
| 466 | 3300014497 | Ga0182008_10190802 | Ga0182008_101908021 | 208 |
| 467 | 3300014968 | Ga0157379_10543268 | Ga0157379_105432682 | 208 |
| 468 | 3300017792 | Ga0163161_10121492 | Ga0163161_101214921 | 208 |
| 469 | 3300017792 | Ga0163161_10812098 | Ga0163161_108120981 | 208 |
| 470 | 3300020070 | Ga0206356_10655547 | Ga0206356_106555471 | 208 |
| 471 | 3300020077 | Ga0206351_10218445 | Ga0206351_102184452 | 208 |
| 472 | 3300020078 | Ga0206352_11142661 | Ga0206352_111426611 | 208 |
| 473 | 3300020080 | Ga0206350_11464367 | Ga0206350_114643672 | 208 |
| 474 | 3300020082 | Ga0206353_11882339 | Ga0206353_118823391 | 208 |
| 475 | 3300022467 | Ga0224712_10011100 | Ga0224712_100111003 | 208 |
| 476 | 3300022467 | Ga0224712_10289174 | Ga0224712_102891741 | 208 |
| 477 | 3300025711 | Ga0207696_1065610 | Ga0207696_10656102 | 208 |
| 478 | 3300025900 | Ga0207710_10003112 | Ga0207710_100031126 | 208 |
| 479 | 3300025901 | Ga0207688_10084319 | Ga0207688_100843192 | 208 |
| 480 | 3300025904 | Ga0207647_10023748 | Ga0207647_100237482 | 208 |
| 481 | 3300025914 | Ga0207671_10296864 | Ga0207671_102968642 | 208 |
| 482 | 3300025924 | Ga0207694_10024622 | Ga0207694_100246221 | 208 |
| 483 | 3300025924 | Ga0207694_10459915 | Ga0207694_104599152 | 208 |
| 484 | 3300025927 | Ga0207687_10202602 | Ga0207687_102026022 | 208 |
| 485 | 3300025932 | Ga0207690_10140246 | Ga0207690_101402462 | 208 |
| 486 | 3300025933 | Ga0207706_10149490 | Ga0207706_101494902 | 208 |
| 487 | 3300025935 | Ga0207709_10012557 | Ga0207709_100125572 | 208 |
| 488 | 3300025936 | Ga0207670_10042649 | Ga0207670_100426491 | 208 |
| 489 | 3300025936 | Ga0207670_10529493 | Ga0207670_105294931 | 208 |
| 490 | 3300025940 | Ga0207691_10197216 | Ga0207691_101972162 | 208 |
| 491 | 3300025945 | Ga0207679_10777802 | Ga0207679_107778021 | 208 |
| 492 | 3300025960 | Ga0207651_10019580 | Ga0207651_100195802 | 208 |
| 493 | 3300025961 | Ga0207712_10025993 | Ga0207712_100259934 | 208 |
| 494 | 3300025961 | Ga0207712_10112976 | Ga0207712_101129762 | 208 |
| 495 | 3300025972 | Ga0207668_10030967 | Ga0207668_100309673 | 208 |
| 496 | 3300025986 | Ga0207658_10123596 | Ga0207658_101235962 | 208 |
| 497 | 3300026035 | Ga0207703_10031525 | Ga0207703_100315255 | 208 |
| 498 | 3300026041 | Ga0207639_10356521 | Ga0207639_103565212 | 208 |
| 499 | 3300026088 | Ga0207641_10009686 | Ga0207641_100096863 | 208 |
| 500 | 3300026088 | Ga0207641_10347365 | Ga0207641_103473652 | 208 |
| 501 | 3300026089 | Ga0207648_10121817 | Ga0207648_101218173 | 208 |
| 502 | 3300026095 | Ga0207676_10306952 | Ga0207676_103069522 | 208 |
| 503 | 3300026095 | Ga0207676_11073265 | Ga0207676_110732652 | 208 |
| 504 | 3300026118 | Ga0207675_100154406 | Ga0207675_1001544063 | 208 |
| 505 | 3300026121 | Ga0207683_10399725 | Ga0207683_103997252 | 208 |
| 506 | 3300026142 | Ga0207698_10977800 | Ga0207698_109778001 | 208 |
| 507 | 3300027671 | Ga0209588_1005630 | Ga0209588_10056304 | 208 |
| 508 | 3300027907 | Ga0207428_10000964 | Ga0207428_100009644 | 208 |
| 509 | 3300027907 | Ga0207428_10003341 | Ga0207428_100033412 | 208 |
| 510 | 3300028379 | Ga0268266_10674758 | Ga0268266_106747582 | 208 |
| 511 | 3300028381 | Ga0268264_10090174 | Ga0268264_100901742 | 208 |
| 512 | 3300028381 | Ga0268264_10433327 | Ga0268264_104333271 | 208 |
| 513 | 3300030521 | Ga0307511_10001015 | Ga0307511_1000101521 | 208 |
| 514 | 3300031616 | Ga0307508_10221891 | Ga0307508_102218912 | 208 |
| 515 | 3300031731 | Ga0307405_10030192 | Ga0307405_100301922 | 208 |
| 516 | 3300031731 | Ga0307405_10578407 | Ga0307405_105784072 | 208 |
| 517 | 3300031824 | Ga0307413_10477033 | Ga0307413_104770331 | 208 |
| 518 | 3300031901 | Ga0307406_10000821 | Ga0307406_1000082115 | 208 |
| 519 | 3300031901 | Ga0307406_10002452 | Ga0307406_100024523 | 208 |
| 520 | 3300031901 | Ga0307406_10523530 | Ga0307406_105235301 | 208 |
| 521 | 3300031911 | Ga0307412_10858547 | Ga0307412_108585471 | 208 |
| 522 | 3300032126 | Ga0307415_100321637 | Ga0307415_1003216372 | 208 |
| 523 | 3300035090 | Ga0373949_0028873 | Ga0373949_0028873_23_664 | 208 |
| 524 | 3300037466 | Ga0395898_0098556 | Ga0395898_0098556_115_741 | 208 |
| 525 | 3300038443 | Ga0395901_0099814 | Ga0395901_0099814_1232_1936 | 208 |
| 526 | 3300041486 | Ga0451807_2367206 | Ga0451807_2367206_260_886 | 208 |
| 527 | 3300042016 | Ga0439463_015653 | Ga0439463_015653_78_704 | 208 |
| 528 | 3300042136 | Ga0450900_025738 | Ga0450900_025738_143_769 | 208 |
| 529 | 3300042439 | Ga0439464_0002492 | Ga0439464_0002492_1136_1762 | 208 |
| 530 | 3300044735 | Ga0466968_0010727 | Ga0466968_0010727_531_1157 | 208 |
| 531 | 3300044765 | Ga0466970_0000004 | Ga0466970_0000004_107946_108587 | 208 |
| 532 | 3300044765 | Ga0466970_0000304 | Ga0466970_0000304_16894_17538 | 208 |
| 533 | 3300044765 | Ga0466970_0250350 | Ga0466970_0250350_311_940 | 208 |
| 534 | 3300044842 | Ga0466957_0074070 | Ga0466957_0074070_1295_1924 | 208 |
| 535 | 3300045836 | Ga0466958_0671914 | Ga0466958_0671914_19_645 | 208 |
| 536 | 3300045976 | Ga0466967_0246404 | Ga0466967_0246404_439_1068 | 208 |
| 537 | 3300045976 | Ga0466967_1282063 | Ga0466967_1282063_23_664 | 208 |
| 538 | 3300046453 | Ga0495627_000393 | Ga0495627_000393_4466_5092 | 208 |
| 539 | 3300046648 | Ga0495611_0139278 | Ga0495611_0139278_54_683 | 208 |
| 540 | 3300046694 | Ga0495649_0132142 | Ga0495649_0132142_580_1269 | 208 |
| 541 | 3300047315 | Ga0495581_0443533 | Ga0495581_0443533_15_656 | 208 |
| 542 | 3300047469 | Ga0495673_0126810 | Ga0495673_0126810_219_929 | 208 |
| 543 | 3300048906 | Ga0496103_0458772 | Ga0496103_0458772_93_725 | 208 |
| 544 | 3300048912 | Ga0496109_0701784 | Ga0496109_0701784_272_898 | 208 |
| 545 | 3300048914 | Ga0496111_0115788 | Ga0496111_0115788_652_1281 | 208 |
| 546 | 3300048917 | Ga0496114_0008890 | Ga0496114_0008890_3618_4247 | 208 |
| 547 | 3300048917 | Ga0496114_0221967 | Ga0496114_0221967_621_1247 | 208 |
| 548 | 3300048920 | Ga0496117_0003089 | Ga0496117_0003089_1820_2461 | 208 |
| 549 | 3300048921 | Ga0496118_0005105 | Ga0496118_0005105_7589_8230 | 208 |
| 550 | 3300048922 | Ga0496119_0327567 | Ga0496119_0327567_59_691 | 208 |
| 551 | 3300048923 | Ga0496120_0068725 | Ga0496120_0068725_96_722 | 208 |
| 552 | 3300048924 | Ga0496121_0000040 | Ga0496121_0000040_166549_167175 | 208 |
| 553 | 3300048924 | Ga0496121_0003120 | Ga0496121_0003120_12058_12690 | 208 |
| 554 | 3300048925 | Ga0496122_0203205 | Ga0496122_0203205_268_894 | 208 |
| 555 | 3300048925 | Ga0496122_0326539 | Ga0496122_0326539_87_728 | 208 |
| 556 | 3300048928 | Ga0496125_0006515 | Ga0496125_0006515_1979_2611 | 208 |
| 557 | 3300048928 | Ga0496125_0021790 | Ga0496125_0021790_2935_3576 | 208 |
| 558 | 3300048929 | Ga0496126_0081083 | Ga0496126_0081083_212_838 | 208 |
| 559 | 3300048929 | Ga0496126_0140060 | Ga0496126_0140060_1250_1891 | 208 |
| 560 | 3300049527 | Ga0501311_036131 | Ga0501311_036131_49_675 | 208 |
| 561 | 3300049572 | Ga0501036_0000459 | Ga0501036_0000459_13447_14073 | 208 |
| 562 | 3300049574 | Ga0501038_0089186 | Ga0501038_0089186_1652_2293 | 208 |
| 563 | 3300049575 | Ga0501039_0083026 | Ga0501039_0083026_668_1294 | 208 |
| 564 | 3300049576 | Ga0501040_0026327 | Ga0501040_0026327_802_1428 | 208 |
| 565 | 3300049578 | Ga0501042_0308864 | Ga0501042_0308864_494_1120 | 208 |
| 566 | 3300049579 | Ga0501043_0476007 | Ga0501043_0476007_134_760 | 208 |
| 567 | 3300049582 | Ga0501048_0000185 | Ga0501048_0000185_35168_35794 | 208 |
| 568 | 3300049583 | Ga0501067_0002625 | Ga0501067_0002625_6298_6924 | 208 |
| 569 | 3300049584 | Ga0501068_0077838 | Ga0501068_0077838_14_640 | 208 |
| 570 | 3300049585 | Ga0501069_0002840 | Ga0501069_0002840_3964_4590 | 208 |
| 571 | 3300049587 | Ga0501071_0015252 | Ga0501071_0015252_2954_3580 | 208 |
| 572 | 3300049590 | Ga0501074_0000871 | Ga0501074_0000871_4441_5067 | 208 |
| 573 | 3300049742 | Ga0501080_0003956 | Ga0501080_0003956_8598_9224 | 208 |
| 574 | 3300049744 | Ga0501083_0030985 | Ga0501083_0030985_389_1015 | 208 |
| 575 | 3300050492 | nmdc:mga0yw44_350591_c1 | nmdc:mga0yw44_350591_c1_262_903 | 208 |
| 576 | 3300050507 | nmdc:mga05p37_10589_c1 | nmdc:mga05p37_10589_c1_8517_9143 | 208 |
| 577 | 3300050507 | nmdc:mga05p37_34311_c1 | nmdc:mga05p37_34311_c1_45_707 | 208 |
| 578 | 3300050508 | nmdc:mga09592_18311_c1 | nmdc:mga09592_18311_c1_4907_5533 | 208 |
| 579 | 3300050510 | nmdc:mga06r32_24238_c1 | nmdc:mga06r32_24238_c1_2696_3322 | 208 |
| 580 | 3300050511 | nmdc:mga08y16_278553_c1 | nmdc:mga08y16_278553_c1_991_1617 | 208 |
| 581 | 3300050511 | nmdc:mga08y16_72775_c1 | nmdc:mga08y16_72775_c1_2698_3324 | 208 |
| 582 | 3300050512 | nmdc:mga0n895_11598_c1 | nmdc:mga0n895_11598_c1_3050_3676 | 208 |
| 583 | 3300050512 | nmdc:mga0n895_132334_c1 | nmdc:mga0n895_132334_c1_1664_2290 | 208 |
| 584 | 3300050513 | nmdc:mga0rr50_21063_c1 | nmdc:mga0rr50_21063_c1_1724_2350 | 208 |
| 585 | 3300050513 | nmdc:mga0rr50_7007_c1 | nmdc:mga0rr50_7007_c1_2038_2664 | 208 |
| 586 | 3300050514 | nmdc:mga08x19_325399_c1 | nmdc:mga08x19_325399_c1_428_1057 | 208 |
| 587 | 3300050514 | nmdc:mga08x19_4005_c1 | nmdc:mga08x19_4005_c1_932_1558 | 208 |
| 588 | 3300050515 | nmdc:mga0a205_137500_c1 | nmdc:mga0a205_137500_c1_97_723 | 208 |
| 589 | 3300050515 | nmdc:mga0a205_208177_c1 | nmdc:mga0a205_208177_c1_95_799 | 208 |
| 590 | 3300050515 | nmdc:mga0a205_28133_c1 | nmdc:mga0a205_28133_c1_3189_3815 | 208 |
| 591 | 3300053178 | Ga0500637_0004373 | Ga0500637_0004373_2758_3390 | 208 |
| 592 | 3300059477 | Ga0587084_003261 | Ga0587084_003261_380_1021 | 208 |
| 593 | 3300059490 | Ga0587066_011070 | Ga0587066_011070_586_1218 | 208 |
| 594 | 3300059491 | Ga0587070_001134 | Ga0587070_001134_1862_2503 | 208 |
| 595 | 3300059493 | Ga0587077_060062 | Ga0587077_060062_96_728 | 208 |
| 596 | 3300059504 | Ga0587082_039780 | Ga0587082_039780_34_660 | 208 |
| 597 | 3300059505 | Ga0587083_0044997 | Ga0587083_0044997_244_876 | 208 |
| 598 | 3300059508 | Ga0587088_002719 | Ga0587088_002719_162_803 | 208 |
| 599 | 3300059512 | Ga0587092_000504 | Ga0587092_000504_402_1043 | 208 |
| 600 | 3300059513 | Ga0587094_004894 | Ga0587094_004894_179_820 | 208 |
| 601 | 3300059603 | Ga0587097_00209 | Ga0587097_00209_169_810 | 208 |
| 602 | 3300059607 | Ga0587125_000589 | Ga0587125_000589_1327_1968 | 208 |
| 603 | 3300059623 | Ga0587101_000151 | Ga0587101_000151_299_940 | 208 |
| 604 | 3300059624 | Ga0587109_027977 | Ga0587109_027977_251_892 | 208 |
| 605 | 3300059626 | Ga0587115_006793 | Ga0587115_006793_370_1011 | 208 |
| 606 | 3300059627 | Ga0587117_002855 | Ga0587117_002855_727_1368 | 208 |
| 607 | 3300059628 | Ga0587122_004021 | Ga0587122_004021_131_772 | 208 |
| 608 | 3300059630 | Ga0587128_006070 | Ga0587128_006070_100_741 | 208 |
| 609 | 3300059642 | Ga0587069_004114 | Ga0587069_004114_810_1451 | 208 |
| 610 | 3300059644 | Ga0587075_015692 | Ga0587075_015692_417_1049 | 208 |
| 611 | 3300059648 | Ga0587100_000082 | Ga0587100_000082_186_827 | 208 |
| 612 | 3300059652 | Ga0587107_003205 | Ga0587107_003205_108_749 | 208 |
| 613 | 3300059655 | Ga0587114_009537 | Ga0587114_009537_481_1113 | 208 |
| 614 | 3300060353 | Ga0501082_0238169 | Ga0501082_0238169_363_989 | 208 |
| 615 | iso_pu_bacteria | 2946033335 | 2946033503 | 208 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1gn4-assembly1.cif.gz_D | h145e mutant of mycobacterium tuberculosis iron-superoxide dismutase. | 0.9712 | 2 | 197 |
| 1gn2-assembly1.cif.gz_A | s123c mutant of the iron-superoxide dismutase from mycobacterium tuberculosis. | 0.9708 | 2 | 197 |
| 1gn6-assembly1.cif.gz_A | g152a mutant of mycobacterium tuberculosis iron-superoxide dismutase. | 0.9704 | 2 | 197 |
| 1ids-assembly1.cif.gz_C | x-ray structure analysis of the iron-dependent superoxide dismutase from mycobacterium tuberculosis at 2.0 angstroms resolutions reveals novel dimer-dimer interactions | 0.9703 | 2 | 197 |
| 1gn3-assembly1.cif.gz_A | h145q mutant of mycobacterium tuberculosis iron-superoxide dismutase. | 0.9686 | 2 | 197 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WGE7_21_84_1.10.287.990 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Fe,Mn superoxide dismutase (SOD) domain | 0.9979 | 21 | 84 | 1.10.287.990 |
| 1idsB01 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Fe,Mn superoxide dismutase (SOD) domain | 0.997 | 21 | 84 | 1.10.287.990 |
| 1idsC01 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Fe,Mn superoxide dismutase (SOD) domain | 0.9967 | 21 | 84 | 1.10.287.990 |
| 1ar4B01 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Fe,Mn superoxide dismutase (SOD) domain | 0.9967 | 21 | 84 | 1.10.287.990 |
| 1ar4A01 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Fe,Mn superoxide dismutase (SOD) domain | 0.9965 | 21 | 84 | 1.10.287.990 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V6SUL7-F1-model_v4 | Superoxide dismutase (EC 1.15.1.1) | 0.9913 | 1 | 139 |
GO:0004784
GO:0046872 |
| AF-A0A0C2W735-F1-model_v4 | superoxide dismutase (EC 1.15.1.1) | 0.991 | 4 | 113 |
GO:0004784
GO:0046872 |
| AF-A0A6N7ZP99-F1-model_v4 | Superoxide dismutase (EC 1.15.1.1) | 0.9905 | 7 | 123 |
GO:0004784
GO:0046872 |
| AF-A0A2P0ZG51-F1-model_v4 | Superoxide dismutase (EC 1.15.1.1) | 0.9904 | 27 | 162 |
GO:0004784
GO:0046872 |
| AF-A0A1I2QXU2-F1-model_v4 | superoxide dismutase (EC 1.15.1.1) | 0.9904 | 2 | 115 |
GO:0004784
GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar