F469481

General Info

Members Datasets Scaffolds Average Seq Length
615 240 1230 140

Family's Representative Sequence

Representative Sequence 3300049585|Ga0501069_0019568|Ga0501069_0019568_26_508
Length 160
Sequence MFTPSRDEARRFFFETWRKYGVGEPLSQLEALALKVIGWHPEYHAILDHPERHLERDYTPEDGTVNPFLHLSLHLAVEEQLAIDQPPGLLARYRQLLKKTASEHDARHLIAECLGETVWRAQRDGTMPDAAAYLECVGRKAGNGTPPQRGHEPGMWNETG

Samples

Sample ID Description Type Environment
1 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
72 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
73 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
74 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
95 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
171 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
175 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
176 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
177 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
178 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
179 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
180 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
181 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
182 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
183 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
184 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
185 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
186 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
187 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
188 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
189 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
190 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
191 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
192 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
193 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
194 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
195 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
196 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
197 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
198 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
199 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
200 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
201 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
202 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
203 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
204 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
205 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
206 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
207 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
208 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
209 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
210 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
211 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
212 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
213 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
214 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
215 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
216 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
217 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
218 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
219 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
220 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
221 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
222 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
223 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
224 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
225 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
226 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
227 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
228 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
229 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
230 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
231 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
232 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
233 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
234 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
235 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
236 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
237 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
238 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
239 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
240 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.51
Metatranscriptomes 0.16
Isolates 0.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.76
Nodule 0
Rhizoplane 2.6
Rhizosphere 93.82
Stem 0
Stem Tuber 0
Unclassified 0.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501069_0019568 3300049585 Bacteria 3662
2 rootH1_10267749 3300003323 Bacteria 1035
3 Ga0065704_10391903 3300005289 Bacteria 725
4 Ga0070658_11366401 3300005327 Bacteria 615
5 Ga0070676_10188223 3300005328 Bacteria 1346
6 Ga0070676_10191063 3300005328 Bacteria 1337
7 Ga0070683_100008186 3300005329 Bacteria 8881
8 Ga0070683_100076925 3300005329 Bacteria 3120
9 Ga0070683_100918373 3300005329 Bacteria 840
10 Ga0070690_100000499 3300005330 Bacteria 19618
11 Ga0070690_100005103 3300005330 Bacteria 7355
12 Ga0070690_100360197 3300005330 Bacteria 1058
13 Ga0070670_100026792 3300005331 Bacteria 4958
14 Ga0070670_100053553 3300005331 Bacteria 3465
15 Ga0070670_100220149 3300005331 Bacteria 1651
16 Ga0070670_101120907 3300005331 Bacteria 718
17 Ga0070677_10010992 3300005333 Bacteria 3110
18 Ga0070677_10187560 3300005333 Bacteria 989
19 Ga0068869_100015668 3300005334 Bacteria 5092
20 Ga0068869_100030521 3300005334 Bacteria 3784
21 Ga0068869_100058279 3300005334 Bacteria 2823
22 Ga0068869_101358924 3300005334 Bacteria 628
23 Ga0070666_10062887 3300005335 Bacteria 2515
24 Ga0070666_10142941 3300005335 Bacteria 1667
25 Ga0070680_100041955 3300005336 Bacteria 3711
26 Ga0070680_100326739 3300005336 Bacteria 1302
27 Ga0070682_100017505 3300005337 Bacteria 4180
28 Ga0070682_100974943 3300005337 Bacteria 702
29 Ga0068868_100002092 3300005338 Bacteria 13750
30 Ga0068868_100162577 3300005338 Bacteria 1845
31 Ga0068868_100594059 3300005338 Bacteria 980
32 Ga0068868_101012164 3300005338 Bacteria 761
33 Ga0070660_100036055 3300005339 Bacteria 3744
34 Ga0070660_100143448 3300005339 Bacteria 1917
35 Ga0070660_100230727 3300005339 Bacteria 1506
36 Ga0070660_100396451 3300005339 Bacteria 1141
37 Ga0070689_100092183 3300005340 Bacteria 2389
38 Ga0070689_100200042 3300005340 Bacteria 1631
39 Ga0070689_100994111 3300005340 Bacteria 746
40 Ga0070687_100042465 3300005343 Bacteria 2304
41 Ga0070661_100009635 3300005344 Bacteria 6694
42 Ga0070661_100030528 3300005344 Bacteria 3894
43 Ga0070661_100060004 3300005344 Bacteria 2791
44 Ga0070661_100864960 3300005344 Bacteria 745
45 Ga0070692_10127295 3300005345 Bacteria 1427
46 Ga0070692_10304718 3300005345 Bacteria 974
47 Ga0070692_11074078 3300005345 Bacteria 567
48 Ga0070668_100008739 3300005347 Bacteria 7523
49 Ga0070668_100024886 3300005347 Bacteria 4538
50 Ga0070668_100122727 3300005347 Bacteria 2078
51 Ga0070668_100136886 3300005347 Bacteria 1970
52 Ga0070668_100140947 3300005347 Bacteria 1943
53 Ga0070668_100483688 3300005347 Bacteria 1069
54 Ga0070669_100041519 3300005353 Bacteria 3345
55 Ga0070669_100059066 3300005353 Bacteria 2816
56 Ga0070669_101321415 3300005353 Bacteria 625
57 Ga0070675_100021686 3300005354 Bacteria 5132
58 Ga0070675_100439717 3300005354 Bacteria 1168
59 Ga0070671_100015544 3300005355 Bacteria 6150
60 Ga0070671_100051132 3300005355 Bacteria 3436
61 Ga0070671_100283848 3300005355 Bacteria 1408
62 Ga0070671_100352268 3300005355 Bacteria 1256
63 Ga0070671_101379216 3300005355 Bacteria 622
64 Ga0070674_100016564 3300005356 Bacteria 4621
65 Ga0070674_100035839 3300005356 Bacteria 3326
66 Ga0070674_100072762 3300005356 Bacteria 2435
67 Ga0070674_100092294 3300005356 Bacteria 2188
68 Ga0070674_100659623 3300005356 Bacteria 890
69 Ga0070673_100063168 3300005364 Bacteria 2945
70 Ga0070673_100064247 3300005364 Bacteria 2924
71 Ga0070673_100068462 3300005364 Bacteria 2842
72 Ga0070673_100095439 3300005364 Bacteria 2439
73 Ga0070673_100829659 3300005364 Bacteria 855
74 Ga0070673_101023729 3300005364 Bacteria 770
75 Ga0070688_100085746 3300005365 Bacteria 2048
76 Ga0070659_100273057 3300005366 Bacteria 1405
77 Ga0070659_100273687 3300005366 Bacteria 1403
78 Ga0070667_100055057 3300005367 Bacteria 3359
79 Ga0070667_100079506 3300005367 Bacteria 2803
80 Ga0070667_100639889 3300005367 Bacteria 981
81 Ga0070709_10108519 3300005434 Bacteria 1862
82 Ga0070714_101389170 3300005435 Bacteria 686
83 Ga0070710_10088871 3300005437 Bacteria 1819
84 Ga0070701_10020706 3300005438 Bacteria 3126
85 Ga0070701_10603606 3300005438 Bacteria 727
86 Ga0070711_100427805 3300005439 Bacteria 1080
87 Ga0070711_100438827 3300005439 Bacteria 1067
88 Ga0070705_100085936 3300005440 Bacteria 1946
89 Ga0070705_101035518 3300005440 Bacteria 668
90 Ga0070700_100015970 3300005441 Bacteria 4268
91 Ga0070700_100017304 3300005441 Bacteria 4118
92 Ga0070700_100033081 3300005441 Bacteria 3112
93 Ga0070694_100431616 3300005444 Bacteria 1037
94 Ga0070694_100645527 3300005444 Bacteria 856
95 Ga0070708_100000083 3300005445 Bacteria 61330
96 Ga0070663_100002523 3300005455 Bacteria 10336
97 Ga0070663_100043185 3300005455 Bacteria 3171
98 Ga0070678_100018157 3300005456 Bacteria 4554
99 Ga0070678_100270231 3300005456 Bacteria 1433
100 Ga0070662_100018638 3300005457 Bacteria 4699
101 Ga0070662_100058263 3300005457 Bacteria 2810
102 Ga0070662_100073645 3300005457 Bacteria 2524
103 Ga0070662_100181375 3300005457 Bacteria 1660
104 Ga0070662_101375716 3300005457 Bacteria 608
105 Ga0070681_10066415 3300005458 Bacteria 3576
106 Ga0070681_10076700 3300005458 Bacteria 3300
107 Ga0070681_10429579 3300005458 Bacteria 1233
108 Ga0068867_100042910 3300005459 Bacteria 3310
109 Ga0068867_100058544 3300005459 Bacteria 2855
110 Ga0068867_100341610 3300005459 Bacteria 1247
111 Ga0068867_100896846 3300005459 Bacteria 797
112 Ga0068867_100948028 3300005459 Bacteria 777
113 Ga0068867_101845733 3300005459 Bacteria 569
114 Ga0070685_10031653 3300005466 Bacteria 2957
115 Ga0070685_10210528 3300005466 Bacteria 1269
116 Ga0070685_10443085 3300005466 Bacteria 908
117 Ga0070685_10494814 3300005466 Bacteria 864
118 Ga0070685_10777225 3300005466 Bacteria 704
119 Ga0070679_100186604 3300005530 Bacteria 2044
120 Ga0070679_100303998 3300005530 Bacteria 1546
121 Ga0070684_100000955 3300005535 Bacteria 20577
122 Ga0070684_100054148 3300005535 Bacteria 3495
123 Ga0068853_100038684 3300005539 Bacteria 4064
124 Ga0068853_100044021 3300005539 Bacteria 3820
125 Ga0068853_100141743 3300005539 Bacteria 2158
126 Ga0068853_100160532 3300005539 Bacteria 2028
127 Ga0070672_100003712 3300005543 Bacteria 9934
128 Ga0070672_100029307 3300005543 Bacteria 4127
129 Ga0070672_100038383 3300005543 Bacteria 3659
130 Ga0070672_100061494 3300005543 Bacteria 2960
131 Ga0070686_100007516 3300005544 Bacteria 6082
132 Ga0070686_100024032 3300005544 Bacteria 3649
133 Ga0070686_101130616 3300005544 Bacteria 648
134 Ga0070695_100118592 3300005545 Bacteria 1807
135 Ga0070695_100397395 3300005545 Bacteria 1044
136 Ga0070696_100088581 3300005546 Bacteria 2200
137 Ga0070696_100507785 3300005546 Bacteria 960
138 Ga0070693_100230025 3300005547 Bacteria 1219
139 Ga0070665_100010543 3300005548 Bacteria 9354
140 Ga0070665_100187606 3300005548 Bacteria 2068
141 Ga0070665_100284266 3300005548 Bacteria 1656
142 Ga0070665_100385374 3300005548 Bacteria 1409
143 Ga0070665_101021517 3300005548 Bacteria 839
144 Ga0070665_101548032 3300005548 Unclassified 671
145 Ga0070704_100262437 3300005549 Bacteria 1423
146 Ga0070704_100858257 3300005549 Bacteria 814
147 Ga0070704_100934722 3300005549 Bacteria 781
148 Ga0070704_101114629 3300005549 Bacteria 717
149 Ga0068855_100010295 3300005563 Bacteria 11279
150 Ga0068855_100090390 3300005563 Bacteria 3533
151 Ga0068855_100460325 3300005563 Bacteria 1387
152 Ga0068855_101027861 3300005563 Bacteria 865
153 Ga0068855_101259969 3300005563 Bacteria 767
154 Ga0068855_101393518 3300005563 Bacteria 723
155 Ga0070664_100017590 3300005564 Bacteria 5870
156 Ga0070664_100034612 3300005564 Bacteria 4237
157 Ga0070664_100735834 3300005564 Bacteria 920
158 Ga0070664_100787337 3300005564 Bacteria 889
159 Ga0068857_100009376 3300005577 Bacteria 8497
160 Ga0068857_100056690 3300005577 Bacteria 3477
161 Ga0068857_100064339 3300005577 Bacteria 3261
162 Ga0068857_101731609 3300005577 Bacteria 611
163 Ga0068854_100000368 3300005578 Bacteria 28867
164 Ga0070702_100017972 3300005615 Bacteria 3658
165 Ga0070702_100030515 3300005615 Bacteria 2940
166 Ga0070702_100030554 3300005615 Bacteria 2938
167 Ga0068852_100160680 3300005616 Bacteria 2098
168 Ga0068852_100259166 3300005616 Bacteria 1669
169 Ga0068852_100305553 3300005616 Bacteria 1541
170 Ga0068852_101348481 3300005616 Bacteria 735
171 Ga0068859_100087974 3300005617 Bacteria 3155
172 Ga0068859_100141690 3300005617 Bacteria 2478
173 Ga0068859_100237088 3300005617 Bacteria 1913
174 Ga0068859_100530014 3300005617 Bacteria 1273
175 Ga0068859_100598022 3300005617 Bacteria 1196
176 Ga0068859_101474379 3300005617 Bacteria 751
177 Ga0068864_100000740 3300005618 Bacteria 27362
178 Ga0068864_100093970 3300005618 Bacteria 2649
179 Ga0068864_100204680 3300005618 Bacteria 1815
180 Ga0068864_100260925 3300005618 Bacteria 1612
181 Ga0068864_100817984 3300005618 Bacteria 916
182 Ga0068864_100878403 3300005618 Bacteria 884
183 Ga0068866_10002869 3300005718 Bacteria 7099
184 Ga0068866_10012732 3300005718 Bacteria 3671
185 Ga0068866_10076926 3300005718 Bacteria 1781
186 Ga0068866_10554499 3300005718 Bacteria 769
187 Ga0068861_100070919 3300005719 Bacteria 2699
188 Ga0068861_100898907 3300005719 Bacteria 838
189 Ga0068851_10004158 3300005834 Bacteria 6514
190 Ga0068851_10026134 3300005834 Bacteria 2866
191 Ga0068851_10166112 3300005834 Bacteria 1215
192 Ga0068870_10118823 3300005840 Bacteria 1520
193 Ga0068863_100009389 3300005841 Bacteria 9547
194 Ga0068863_100175177 3300005841 Bacteria 2058
195 Ga0068863_100212270 3300005841 Bacteria 1864
196 Ga0068863_100233450 3300005841 Bacteria 1775
197 Ga0068863_100373407 3300005841 Bacteria 1392
198 Ga0068863_100415704 3300005841 Bacteria 1317
199 Ga0068863_100612746 3300005841 Bacteria 1078
200 Ga0068863_101118505 3300005841 Bacteria 792
201 Ga0068863_101184916 3300005841 Bacteria 770
202 Ga0068858_100027643 3300005842 Bacteria 5269
203 Ga0068858_100047694 3300005842 Bacteria 3970
204 Ga0068858_100066861 3300005842 Bacteria 3328
205 Ga0068858_100091522 3300005842 Bacteria 2831
206 Ga0068858_101865716 3300005842 Bacteria 594
207 Ga0068860_100003131 3300005843 Bacteria 17089
208 Ga0068860_100047609 3300005843 Bacteria 4086
209 Ga0068860_100475858 3300005843 Bacteria 1244
210 Ga0068860_100852119 3300005843 Bacteria 926
211 Ga0068860_100959958 3300005843 Bacteria 872
212 Ga0068860_101022931 3300005843 Bacteria 844
213 Ga0068862_100038642 3300005844 Bacteria 4049
214 Ga0068862_100065310 3300005844 Bacteria 3134
215 Ga0068862_100180223 3300005844 Bacteria 1896
216 Ga0068862_101139119 3300005844 Bacteria 776
217 Ga0081539_10043735 3300005985 Bacteria 2593
218 Ga0081539_10055852 3300005985 Bacteria 2194
219 Ga0075368_10070953 3300006042 Bacteria 1406
220 Ga0070716_100131822 3300006173 Bacteria 1581
221 Ga0075367_10705127 3300006178 Bacteria 642
222 Ga0075366_10143512 3300006195 Bacteria 1444
223 Ga0097621_100012599 3300006237 Bacteria 6273
224 Ga0097621_100042707 3300006237 Bacteria 3653
225 Ga0097621_100165023 3300006237 Bacteria 1906
226 Ga0097621_100180941 3300006237 Bacteria 1821
227 Ga0097621_100189579 3300006237 Bacteria 1780
228 Ga0097621_100285404 3300006237 Bacteria 1454
229 Ga0097621_101652110 3300006237 Bacteria 609
230 Ga0068871_100025829 3300006358 Bacteria 4576
231 Ga0068871_100077500 3300006358 Bacteria 2747
232 Ga0068871_100237501 3300006358 Bacteria 1583
233 Ga0068871_100576921 3300006358 Bacteria 1021
234 Ga0068871_102088390 3300006358 Bacteria 540
235 Ga0075434_100279418 3300006871 Bacteria 1689
236 Ga0075434_101824706 3300006871 Bacteria 615
237 Ga0068865_100004579 3300006881 Bacteria 8345
238 Ga0068865_100103285 3300006881 Bacteria 2090
239 Ga0068865_100480896 3300006881 Bacteria 1032
240 Ga0068865_100690177 3300006881 Bacteria 871
241 Ga0097620_100087972 3300006931 Bacteria 3155
242 Ga0097620_100141687 3300006931 Bacteria 2478
243 Ga0097620_100237106 3300006931 Bacteria 1913
244 Ga0097620_100529992 3300006931 Bacteria 1273
245 Ga0097620_100597928 3300006931 Bacteria 1196
246 Ga0097620_101474544 3300006931 Bacteria 751
247 Ga0105240_10120117 3300009093 Bacteria 3165
248 Ga0105240_10371403 3300009093 Bacteria 1617
249 Ga0111539_10052102 3300009094 Bacteria 4872
250 Ga0111539_10066569 3300009094 Bacteria 4255
251 Ga0105245_10108938 3300009098 Bacteria 2573
252 Ga0105245_10244140 3300009098 Bacteria 1742
253 Ga0105245_10944980 3300009098 Bacteria 905
254 Ga0105247_10289103 3300009101 Bacteria 1133
255 Ga0114129_12637592 3300009147 Bacteria 599
256 Ga0105243_10011751 3300009148 Bacteria 6621
257 Ga0105243_10210530 3300009148 Bacteria 1712
258 Ga0105243_10871453 3300009148 Bacteria 893
259 Ga0105241_10051432 3300009174 Bacteria 3142
260 Ga0105241_10157414 3300009174 Bacteria 1864
261 Ga0105242_10001090 3300009176 Bacteria 21341
262 Ga0105242_10017265 3300009176 Bacteria 5621
263 Ga0105242_10060086 3300009176 Bacteria 3121
264 Ga0105248_10011535 3300009177 Bacteria 9741
265 Ga0105248_10034640 3300009177 Bacteria 5648
266 Ga0105248_10126633 3300009177 Bacteria 2881
267 Ga0105248_10186427 3300009177 Bacteria 2338
268 Ga0105248_10201580 3300009177 Bacteria 2242
269 Ga0105248_11344944 3300009177 Bacteria 808
270 Ga0105237_10111681 3300009545 Bacteria 2725
271 Ga0105237_10404916 3300009545 Unclassified 1369
272 Ga0105238_10360094 3300009551 Bacteria 1444
273 Ga0105238_10369645 3300009551 Bacteria 1424
274 Ga0105249_10127106 3300009553 Bacteria 2429
275 Ga0105249_10462535 3300009553 Bacteria 1309
276 Ga0105249_10683434 3300009553 Bacteria 1085
277 Ga0105239_10025267 3300010375 Bacteria 6541
278 Ga0105239_10027414 3300010375 Bacteria 6271
279 Ga0105239_11326996 3300010375 Bacteria 830
280 Ga0105239_11414788 3300010375 Bacteria 803
281 Ga0105246_10067078 3300011119 Bacteria 2514
282 Ga0105246_10269628 3300011119 Bacteria 1360
283 Ga0157323_1038719 3300012495 Bacteria 538
284 Ga0157326_1016907 3300012513 Bacteria 868
285 Ga0157373_10003126 3300013100 Bacteria 12510
286 Ga0157370_10013186 3300013104 Bacteria 8524
287 Ga0157370_10020666 3300013104 Bacteria 6571
288 Ga0157370_10027661 3300013104 Bacteria 5590
289 Ga0157369_10081908 3300013105 Bacteria 3453
290 Ga0157369_10192976 3300013105 Bacteria 2139
291 Ga0157369_10833552 3300013105 Bacteria 947
292 Ga0157374_10077204 3300013296 Bacteria 3151
293 Ga0157374_10084839 3300013296 Bacteria 3011
294 Ga0157374_10090431 3300013296 Bacteria 2918
295 Ga0157374_10318555 3300013296 Bacteria 1541
296 Ga0157374_10400750 3300013296 Bacteria 1369
297 Ga0157374_10776494 3300013296 Bacteria 973
298 Ga0157378_10028236 3300013297 Bacteria 4948
299 Ga0157378_10063593 3300013297 Bacteria 3297
300 Ga0157378_10110503 3300013297 Bacteria 2519
301 Ga0157378_10193029 3300013297 Bacteria 1922
302 Ga0157378_11245219 3300013297 Bacteria 784
303 Ga0157378_12071466 3300013297 Unclassified 619
304 Ga0163162_10028096 3300013306 Bacteria 5564
305 Ga0163162_10087313 3300013306 Bacteria 3197
306 Ga0163162_10176514 3300013306 Bacteria 2262
307 Ga0163162_10561643 3300013306 Bacteria 1269
308 Ga0163162_11092503 3300013306 Bacteria 904
309 Ga0163162_11322366 3300013306 Bacteria 819
310 Ga0157372_10086493 3300013307 Bacteria 3556
311 Ga0157372_10392019 3300013307 Bacteria 1618
312 Ga0157372_11421168 3300013307 Bacteria 800
313 Ga0157372_12410247 3300013307 Bacteria 604
314 Ga0157375_10033163 3300013308 Bacteria 4904
315 Ga0157375_10269326 3300013308 Bacteria 1865
316 Ga0157375_10485401 3300013308 Bacteria 1400
317 Ga0163163_10037483 3300014325 Bacteria 4717
318 Ga0163163_10077924 3300014325 Bacteria 3310
319 Ga0163163_10500503 3300014325 Bacteria 1277
320 Ga0163163_11364602 3300014325 Bacteria 771
321 Ga0157380_10031073 3300014326 Bacteria 4097
322 Ga0157380_10087623 3300014326 Bacteria 2560
323 Ga0157377_10001742 3300014745 Bacteria 9487
324 Ga0157377_10012164 3300014745 Bacteria 4319
325 Ga0157379_10068748 3300014968 Bacteria 3167
326 Ga0157379_10534767 3300014968 Bacteria 1089
327 Ga0157379_10701982 3300014968 Bacteria 950
328 Ga0157379_11619682 3300014968 Bacteria 632
329 Ga0157379_11676624 3300014968 Bacteria 622
330 Ga0157376_10292601 3300014969 Bacteria 1538
331 Ga0157376_10675292 3300014969 Bacteria 1036
332 Ga0157376_11406334 3300014969 Bacteria 729
333 Ga0157376_11861874 3300014969 Bacteria 638
334 Ga0163161_10029737 3300017792 Bacteria 3884
335 Ga0163161_10238280 3300017792 Bacteria 1414
336 Ga0163161_10298099 3300017792 Bacteria 1269
337 Ga0163161_11535382 3300017792 Bacteria 585
338 Ga0197907_10121607 3300020069 Bacteria 910
339 Ga0207666_1009803 3300025271 Bacteria 1300
340 Ga0207697_10000706 3300025315 Bacteria 19029
341 Ga0207697_10011044 3300025315 Bacteria 3831
342 Ga0207656_10063622 3300025321 Bacteria 1624
343 Ga0207656_10074294 3300025321 Bacteria 1517
344 Ga0207682_10001799 3300025893 Bacteria 9807
345 Ga0207692_10745158 3300025898 Bacteria 638
346 Ga0207642_10334613 3300025899 Bacteria 888
347 Ga0207688_10016745 3300025901 Bacteria 3979
348 Ga0207688_10032003 3300025901 Bacteria 2906
349 Ga0207680_10554598 3300025903 Bacteria 820
350 Ga0207680_10727269 3300025903 Bacteria 711
351 Ga0207699_10056612 3300025906 Bacteria 2338
352 Ga0207645_10003782 3300025907 Bacteria 11365
353 Ga0207645_10019606 3300025907 Bacteria 4432
354 Ga0207645_10036471 3300025907 Bacteria 3156
355 Ga0207645_10039971 3300025907 Bacteria 3004
356 Ga0207645_10207412 3300025907 Bacteria 1290
357 Ga0207643_10000751 3300025908 Bacteria 19908
358 Ga0207643_10001436 3300025908 Bacteria 13676
359 Ga0207643_10502853 3300025908 Bacteria 775
360 Ga0207705_10314648 3300025909 Bacteria 1202
361 Ga0207707_10002089 3300025912 Bacteria 18070
362 Ga0207707_10281075 3300025912 Bacteria 1442
363 Ga0207707_10492557 3300025912 Bacteria 1046
364 Ga0207671_10092173 3300025914 Bacteria 2284
365 Ga0207671_10439696 3300025914 Bacteria 1038
366 Ga0207660_10004612 3300025917 Bacteria 8979
367 Ga0207660_10122207 3300025917 Bacteria 1973
368 Ga0207660_10351298 3300025917 Bacteria 1182
369 Ga0207662_10063207 3300025918 Bacteria 2226
370 Ga0207662_10953222 3300025918 Bacteria 608
371 Ga0207657_10010010 3300025919 Bacteria 9486
372 Ga0207657_10010281 3300025919 Bacteria 9341
373 Ga0207657_10024752 3300025919 Bacteria 5550
374 Ga0207657_10201091 3300025919 Bacteria 1603
375 Ga0207657_10229450 3300025919 Bacteria 1485
376 Ga0207649_10039432 3300025920 Bacteria 2864
377 Ga0207649_10071408 3300025920 Bacteria 2217
378 Ga0207649_10436425 3300025920 Bacteria 986
379 Ga0207681_10099826 3300025923 Bacteria 2091
380 Ga0207681_10223640 3300025923 Bacteria 1457
381 Ga0207681_10573516 3300025923 Bacteria 930
382 Ga0207681_11074920 3300025923 Bacteria 675
383 Ga0207694_10014549 3300025924 Bacteria 5933
384 Ga0207650_10002097 3300025925 Bacteria 13941
385 Ga0207650_10022253 3300025925 Bacteria 4485
386 Ga0207650_10024237 3300025925 Bacteria 4311
387 Ga0207650_10047388 3300025925 Bacteria 3167
388 Ga0207650_10425634 3300025925 Bacteria 1102
389 Ga0207650_10873728 3300025925 Bacteria 763
390 Ga0207650_11433753 3300025925 Bacteria 587
391 Ga0207659_10085135 3300025926 Bacteria 2348
392 Ga0207659_10302616 3300025926 Bacteria 1314
393 Ga0207659_10459250 3300025926 Bacteria 1074
394 Ga0207687_10120808 3300025927 Bacteria 1959
395 Ga0207687_10739463 3300025927 Bacteria 837
396 Ga0207644_10030799 3300025931 Bacteria 3734
397 Ga0207644_10050163 3300025931 Bacteria 2991
398 Ga0207644_10218531 3300025931 Bacteria 1509
399 Ga0207644_10300301 3300025931 Bacteria 1294
400 Ga0207644_10406396 3300025931 Bacteria 1114
401 Ga0207690_10151686 3300025932 Bacteria 1718
402 Ga0207690_10579290 3300025932 Bacteria 914
403 Ga0207706_10004986 3300025933 Bacteria 12400
404 Ga0207706_10020624 3300025933 Bacteria 5923
405 Ga0207706_10032668 3300025933 Bacteria 4633
406 Ga0207706_10066738 3300025933 Bacteria 3166
407 Ga0207706_10145463 3300025933 Bacteria 2085
408 Ga0207686_10049245 3300025934 Bacteria 2614
409 Ga0207670_10106258 3300025936 Bacteria 2013
410 Ga0207670_11014521 3300025936 Bacteria 698
411 Ga0207670_11233550 3300025936 Bacteria 633
412 Ga0207670_11650065 3300025936 Bacteria 545
413 Ga0207670_11758654 3300025936 Bacteria 527
414 Ga0207669_10015518 3300025937 Bacteria 3843
415 Ga0207669_10041284 3300025937 Bacteria 2684
416 Ga0207669_10318882 3300025937 Bacteria 1189
417 Ga0207704_10091065 3300025938 Bacteria 2003
418 Ga0207704_10927823 3300025938 Bacteria 733
419 Ga0207665_10153491 3300025939 Bacteria 1651
420 Ga0207665_10295718 3300025939 Bacteria 1209
421 Ga0207691_10009885 3300025940 Bacteria 9158
422 Ga0207691_10035610 3300025940 Bacteria 4618
423 Ga0207691_10037177 3300025940 Bacteria 4510
424 Ga0207691_10042799 3300025940 Bacteria 4174
425 Ga0207691_10043975 3300025940 Bacteria 4113
426 Ga0207691_10249566 3300025940 Bacteria 1532
427 Ga0207711_10044746 3300025941 Bacteria 3780
428 Ga0207711_10763261 3300025941 Bacteria 901
429 Ga0207711_11982733 3300025941 Bacteria 525
430 Ga0207689_10001375 3300025942 Bacteria 23326
431 Ga0207689_10002760 3300025942 Bacteria 16241
432 Ga0207661_10050375 3300025944 Bacteria 3317
433 Ga0207661_10148528 3300025944 Bacteria 2024
434 Ga0207661_10199705 3300025944 Bacteria 1758
435 Ga0207661_10824329 3300025944 Bacteria 854
436 Ga0207679_10045892 3300025945 Bacteria 3163
437 Ga0207679_10339911 3300025945 Bacteria 1305
438 Ga0207679_11399106 3300025945 Bacteria 642
439 Ga0207667_10032145 3300025949 Bacteria 5657
440 Ga0207667_10043503 3300025949 Bacteria 4766
441 Ga0207667_10074955 3300025949 Bacteria 3514
442 Ga0207667_10354359 3300025949 Bacteria 1496
443 Ga0207667_10404097 3300025949 Bacteria 1391
444 Ga0207651_10359192 3300025960 Bacteria 1229
445 Ga0207651_10686950 3300025960 Bacteria 901
446 Ga0207712_10663006 3300025961 Bacteria 908
447 Ga0207668_10056481 3300025972 Bacteria 2734
448 Ga0207668_10064657 3300025972 Bacteria 2586
449 Ga0207668_10089028 3300025972 Bacteria 2262
450 Ga0207668_10211286 3300025972 Bacteria 1552
451 Ga0207668_10712241 3300025972 Bacteria 883
452 Ga0207668_10793499 3300025972 Bacteria 838
453 Ga0207640_10004093 3300025981 Bacteria 7877
454 Ga0207640_10258457 3300025981 Bacteria 1356
455 Ga0207658_10183644 3300025986 Bacteria 1733
456 Ga0207658_10226901 3300025986 Bacteria 1574
457 Ga0207658_10276119 3300025986 Bacteria 1438
458 Ga0207658_10288717 3300025986 Bacteria 1409
459 Ga0207658_10398456 3300025986 Bacteria 1209
460 Ga0207658_10590281 3300025986 Bacteria 997
461 Ga0207677_10136692 3300026023 Bacteria 1870
462 Ga0207677_10181242 3300026023 Bacteria 1657
463 Ga0207677_10735482 3300026023 Bacteria 878
464 Ga0207677_11862915 3300026023 Bacteria 559
465 Ga0207703_10022314 3300026035 Bacteria 4963
466 Ga0207703_10058626 3300026035 Bacteria 3143
467 Ga0207703_10134029 3300026035 Bacteria 2142
468 Ga0207703_10230704 3300026035 Bacteria 1659
469 Ga0207703_10287518 3300026035 Bacteria 1495
470 Ga0207703_10445855 3300026035 Bacteria 1208
471 Ga0207703_10737926 3300026035 Bacteria 938
472 Ga0207703_11398605 3300026035 Bacteria 673
473 Ga0207639_10018692 3300026041 Bacteria 4928
474 Ga0207639_10028308 3300026041 Bacteria 4090
475 Ga0207639_10250008 3300026041 Bacteria 1546
476 Ga0207639_10636470 3300026041 Bacteria 986
477 Ga0207678_10011055 3300026067 Bacteria 7929
478 Ga0207678_10016426 3300026067 Bacteria 6499
479 Ga0207708_10000793 3300026075 Bacteria 23837
480 Ga0207708_10004037 3300026075 Bacteria 10791
481 Ga0207708_10054979 3300026075 Bacteria 3035
482 Ga0207702_10429241 3300026078 Bacteria 1279
483 Ga0207641_10071749 3300026088 Bacteria 2980
484 Ga0207641_10096439 3300026088 Bacteria 2597
485 Ga0207641_10280850 3300026088 Bacteria 1566
486 Ga0207641_10480312 3300026088 Bacteria 1204
487 Ga0207641_10570230 3300026088 Bacteria 1105
488 Ga0207641_10740680 3300026088 Bacteria 970
489 Ga0207641_10795159 3300026088 Bacteria 935
490 Ga0207641_11080945 3300026088 Bacteria 800
491 Ga0207648_10002475 3300026089 Bacteria 19842
492 Ga0207648_10006164 3300026089 Bacteria 11950
493 Ga0207648_10006236 3300026089 Bacteria 11872
494 Ga0207648_10200986 3300026089 Bacteria 1767
495 Ga0207648_10644517 3300026089 Bacteria 979
496 Ga0207648_10675989 3300026089 Bacteria 956
497 Ga0207648_11705852 3300026089 Bacteria 591
498 Ga0207676_10003025 3300026095 Bacteria 11992
499 Ga0207676_10029187 3300026095 Bacteria 4127
500 Ga0207676_10049009 3300026095 Bacteria 3283
501 Ga0207676_10113866 3300026095 Bacteria 2268
502 Ga0207674_10000237 3300026116 Bacteria 68721
503 Ga0207674_10008366 3300026116 Bacteria 11968
504 Ga0207674_10015324 3300026116 Bacteria 8425
505 Ga0207674_10221312 3300026116 Bacteria 1841
506 Ga0207675_100002899 3300026118 Bacteria 16869
507 Ga0207675_100008392 3300026118 Bacteria 9742
508 Ga0207675_100031810 3300026118 Bacteria 4915
509 Ga0207683_10003901 3300026121 Bacteria 12923
510 Ga0207683_10006830 3300026121 Bacteria 9770
511 Ga0207683_10012474 3300026121 Bacteria 7251
512 Ga0207683_10014931 3300026121 Bacteria 6611
513 Ga0207698_10004075 3300026142 Bacteria 8870
514 Ga0207698_10198538 3300026142 Bacteria 1794
515 Ga0207698_10620646 3300026142 Bacteria 1068
516 Ga0207698_10772187 3300026142 Bacteria 961
517 Ga0209981_1022892 3300027378 Bacteria 897
518 Ga0209968_1005221 3300027526 Bacteria 1950
519 Ga0209971_1002080 3300027682 Bacteria 4875
520 Ga0209966_1006439 3300027695 Bacteria 2039
521 Ga0207428_10258920 3300027907 Bacteria 1296
522 Ga0207428_10526305 3300027907 Bacteria 857
523 Ga0268266_10013268 3300028379 Bacteria 7101
524 Ga0268266_10077365 3300028379 Bacteria 2892
525 Ga0268266_10336195 3300028379 Bacteria 1417
526 Ga0268265_10059258 3300028380 Bacteria 2928
527 Ga0268265_10251033 3300028380 Bacteria 1567
528 Ga0268265_10533312 3300028380 Bacteria 1111
529 Ga0268264_10037939 3300028381 Bacteria 3974
530 Ga0268264_10335104 3300028381 Bacteria 1435
531 Ga0268264_10575752 3300028381 Bacteria 1107
532 Ga0268264_10716253 3300028381 Bacteria 995
533 Ga0265318_10003576 3300028577 Bacteria 7779
534 Ga0307511_10000570 3300030521 Bacteria 39538
535 Ga0265330_10089023 3300031235 Bacteria 1326
536 Ga0265332_10020320 3300031238 Bacteria 2931
537 Ga0265328_10003951 3300031239 Bacteria 6518
538 Ga0265328_10144306 3300031239 Bacteria 894
539 Ga0265320_10014323 3300031240 Bacteria 4520
540 Ga0265329_10018565 3300031242 Bacteria 2376
541 Ga0265339_10080200 3300031249 Bacteria 1726
542 Ga0265331_10000577 3300031250 Bacteria 32877
543 Ga0265316_10023838 3300031344 Bacteria 5139
544 Ga0265314_10000335 3300031711 Bacteria 66101
545 Ga0265342_10015609 3300031712 Bacteria 4992
546 Ga0307507_10027912 3300033179 Bacteria 6034
547 Ga0307507_10389661 3300033179 Bacteria 798
548 Ga0373944_0056286 3300035089 Bacteria 1251
549 Ga0373953_0150396 3300035117 Bacteria 998
550 Ga0373943_0054169 3300035170 Bacteria 1983
551 Ga0373955_0256377 3300035172 Bacteria 1049
552 Ga0373955_0350150 3300035172 Bacteria 894
553 Ga0373955_0559229 3300035172 Bacteria 700
554 Ga0373927_0585147 3300035695 Bacteria 738
555 Ga0373947_0214412 3300035725 Bacteria 1264
556 Ga0373947_0265059 3300035725 Bacteria 1139
557 Ga0373937_0021467 3300036401 Bacteria 5795
558 Ga0373937_0214050 3300036401 Bacteria 1813
559 Ga0373925_0319121 3300037068 Bacteria 1257
560 Ga0395900_0580482 3300037418 Bacteria 1063
561 Ga0395905_0053224 3300037471 Bacteria 3788
562 Ga0395905_0053918 3300037471 Bacteria 3763
563 Ga0395905_0240811 3300037471 Bacteria 1690
564 Ga0395901_0015270 3300038443 Bacteria 7813
565 Ga0451853_2512646 3300041512 Bacteria 1015
566 Ga0451577_0067673 3300042876 Bacteria 3186
567 Ga0466963_0488065 3300044694 Bacteria 870
568 Ga0451576_0469913 3300045051 Bacteria 1321
569 Ga0495628_1045795 3300046516 Bacteria 560
570 Ga0495598_0011465 3300046537 Bacteria 2151
571 Ga0495621_0173455 3300046539 Bacteria 858
572 Ga0495658_0056703 3300046683 Bacteria 2235
573 Ga0496101_0085183 3300048904 Bacteria 2341
574 Ga0496102_0457998 3300048905 Bacteria 1196
575 Ga0496102_0471597 3300048905 Bacteria 1176
576 Ga0496104_0045599 3300048907 Bacteria 4124
577 Ga0496105_0014540 3300048908 Bacteria 6266
578 Ga0496105_1003956 3300048908 Bacteria 624
579 Ga0496106_0062806 3300048909 Bacteria 2821
580 Ga0496107_0042172 3300048910 Bacteria 3277
581 Ga0496108_0045527 3300048911 Bacteria 3664
582 Ga0496108_0341741 3300048911 Bacteria 1306
583 Ga0496109_0041638 3300048912 Bacteria 4160
584 Ga0496109_1548178 3300048912 Bacteria 598
585 Ga0496110_0698105 3300048913 Unclassified 916
586 Ga0496112_0009955 3300048915 Bacteria 8601
587 Ga0496112_0304245 3300048915 Bacteria 1540
588 Ga0496114_0022944 3300048917 Bacteria 5087
589 Ga0501069_0406538 3300049585 Bacteria 806
590 Ga0501069_0526498 3300049585 Bacteria 706
591 Ga0501070_0228087 3300049586 Bacteria 1526
592 Ga0501073_0386927 3300049589 Bacteria 966
593 Ga0501080_0120462 3300049742 Bacteria 2432
594 nmdc:mga0k408_488268_c1 3300050493 Bacteria 730
595 nmdc:mga0k408_78883_c1 3300050493 Bacteria 1401
596 nmdc:mga06z11_100034_c1 3300050494 Bacteria 1589
597 nmdc:mga04h51_85716_c1 3300050495 Bacteria 1125
598 nmdc:mga05p37_1635121_c1 3300050507 Bacteria 632
599 nmdc:mga08y16_358243_c1 3300050511 Bacteria 1498
600 nmdc:mga0rr50_505145_c1 3300050513 Bacteria 1028
601 nmdc:mga08x19_417732_c1 3300050514 Bacteria 942
602 nmdc:mga0sz30_56177_c1 3300050516 Bacteria 1676
603 Ga0495655_0088352 3300053083 Unclassified 899
604 Ga0495595_0123760 3300053084 Bacteria 1261
605 Ga0500583_0099127 3300053092 Bacteria 1425
606 Ga0500641_0072881 3300053096 Bacteria 1448
607 Ga0500650_0177480 3300053098 Bacteria 977
608 Ga0500555_133943 3300053103 Bacteria 613
609 Ga0500594_0037165 3300053118 Bacteria 1314
610 Ga0500568_0072843 3300053139 Bacteria 1313
611 Ga0500604_0002312 3300053151 Bacteria 5209
612 Ga0500622_0234064 3300053156 Bacteria 816
613 Ga0500637_0129698 3300053178 Bacteria 1462
614 2891634885 2891633521 Bacteria 4602265
615 2904436959 2904434214 Bacteria 6230908
616 Ga0501069_0019568
617 rootH1_10267749
618 Ga0065704_10391903
619 Ga0070658_11366401
620 Ga0070676_10188223
621 Ga0070676_10191063
622 Ga0070683_100008186
623 Ga0070683_100076925
624 Ga0070683_100918373
625 Ga0070690_100000499
626 Ga0070690_100005103
627 Ga0070690_100360197
628 Ga0070670_100026792
629 Ga0070670_100053553
630 Ga0070670_100220149
631 Ga0070670_101120907
632 Ga0070677_10010992
633 Ga0070677_10187560
634 Ga0068869_100015668
635 Ga0068869_100030521
636 Ga0068869_100058279
637 Ga0068869_101358924
638 Ga0070666_10062887
639 Ga0070666_10142941
640 Ga0070680_100041955
641 Ga0070680_100326739
642 Ga0070682_100017505
643 Ga0070682_100974943
644 Ga0068868_100002092
645 Ga0068868_100162577
646 Ga0068868_100594059
647 Ga0068868_101012164
648 Ga0070660_100036055
649 Ga0070660_100143448
650 Ga0070660_100230727
651 Ga0070660_100396451
652 Ga0070689_100092183
653 Ga0070689_100200042
654 Ga0070689_100994111
655 Ga0070687_100042465
656 Ga0070661_100009635
657 Ga0070661_100030528
658 Ga0070661_100060004
659 Ga0070661_100864960
660 Ga0070692_10127295
661 Ga0070692_10304718
662 Ga0070692_11074078
663 Ga0070668_100008739
664 Ga0070668_100024886
665 Ga0070668_100122727
666 Ga0070668_100136886
667 Ga0070668_100140947
668 Ga0070668_100483688
669 Ga0070669_100041519
670 Ga0070669_100059066
671 Ga0070669_101321415
672 Ga0070675_100021686
673 Ga0070675_100439717
674 Ga0070671_100015544
675 Ga0070671_100051132
676 Ga0070671_100283848
677 Ga0070671_100352268
678 Ga0070671_101379216
679 Ga0070674_100016564
680 Ga0070674_100035839
681 Ga0070674_100072762
682 Ga0070674_100092294
683 Ga0070674_100659623
684 Ga0070673_100063168
685 Ga0070673_100064247
686 Ga0070673_100068462
687 Ga0070673_100095439
688 Ga0070673_100829659
689 Ga0070673_101023729
690 Ga0070688_100085746
691 Ga0070659_100273057
692 Ga0070659_100273687
693 Ga0070667_100055057
694 Ga0070667_100079506
695 Ga0070667_100639889
696 Ga0070709_10108519
697 Ga0070714_101389170
698 Ga0070710_10088871
699 Ga0070701_10020706
700 Ga0070701_10603606
701 Ga0070711_100427805
702 Ga0070711_100438827
703 Ga0070705_100085936
704 Ga0070705_101035518
705 Ga0070700_100015970
706 Ga0070700_100017304
707 Ga0070700_100033081
708 Ga0070694_100431616
709 Ga0070694_100645527
710 Ga0070708_100000083
711 Ga0070663_100002523
712 Ga0070663_100043185
713 Ga0070678_100018157
714 Ga0070678_100270231
715 Ga0070662_100018638
716 Ga0070662_100058263
717 Ga0070662_100073645
718 Ga0070662_100181375
719 Ga0070662_101375716
720 Ga0070681_10066415
721 Ga0070681_10076700
722 Ga0070681_10429579
723 Ga0068867_100042910
724 Ga0068867_100058544
725 Ga0068867_100341610
726 Ga0068867_100896846
727 Ga0068867_100948028
728 Ga0068867_101845733
729 Ga0070685_10031653
730 Ga0070685_10210528
731 Ga0070685_10443085
732 Ga0070685_10494814
733 Ga0070685_10777225
734 Ga0070679_100186604
735 Ga0070679_100303998
736 Ga0070684_100000955
737 Ga0070684_100054148
738 Ga0068853_100038684
739 Ga0068853_100044021
740 Ga0068853_100141743
741 Ga0068853_100160532
742 Ga0070672_100003712
743 Ga0070672_100029307
744 Ga0070672_100038383
745 Ga0070672_100061494
746 Ga0070686_100007516
747 Ga0070686_100024032
748 Ga0070686_101130616
749 Ga0070695_100118592
750 Ga0070695_100397395
751 Ga0070696_100088581
752 Ga0070696_100507785
753 Ga0070693_100230025
754 Ga0070665_100010543
755 Ga0070665_100187606
756 Ga0070665_100284266
757 Ga0070665_100385374
758 Ga0070665_101021517
759 Ga0070665_101548032
760 Ga0070704_100262437
761 Ga0070704_100858257
762 Ga0070704_100934722
763 Ga0070704_101114629
764 Ga0068855_100010295
765 Ga0068855_100090390
766 Ga0068855_100460325
767 Ga0068855_101027861
768 Ga0068855_101259969
769 Ga0068855_101393518
770 Ga0070664_100017590
771 Ga0070664_100034612
772 Ga0070664_100735834
773 Ga0070664_100787337
774 Ga0068857_100009376
775 Ga0068857_100056690
776 Ga0068857_100064339
777 Ga0068857_101731609
778 Ga0068854_100000368
779 Ga0070702_100017972
780 Ga0070702_100030515
781 Ga0070702_100030554
782 Ga0068852_100160680
783 Ga0068852_100259166
784 Ga0068852_100305553
785 Ga0068852_101348481
786 Ga0068859_100087974
787 Ga0068859_100141690
788 Ga0068859_100237088
789 Ga0068859_100530014
790 Ga0068859_100598022
791 Ga0068859_101474379
792 Ga0068864_100000740
793 Ga0068864_100093970
794 Ga0068864_100204680
795 Ga0068864_100260925
796 Ga0068864_100817984
797 Ga0068864_100878403
798 Ga0068866_10002869
799 Ga0068866_10012732
800 Ga0068866_10076926
801 Ga0068866_10554499
802 Ga0068861_100070919
803 Ga0068861_100898907
804 Ga0068851_10004158
805 Ga0068851_10026134
806 Ga0068851_10166112
807 Ga0068870_10118823
808 Ga0068863_100009389
809 Ga0068863_100175177
810 Ga0068863_100212270
811 Ga0068863_100233450
812 Ga0068863_100373407
813 Ga0068863_100415704
814 Ga0068863_100612746
815 Ga0068863_101118505
816 Ga0068863_101184916
817 Ga0068858_100027643
818 Ga0068858_100047694
819 Ga0068858_100066861
820 Ga0068858_100091522
821 Ga0068858_101865716
822 Ga0068860_100003131
823 Ga0068860_100047609
824 Ga0068860_100475858
825 Ga0068860_100852119
826 Ga0068860_100959958
827 Ga0068860_101022931
828 Ga0068862_100038642
829 Ga0068862_100065310
830 Ga0068862_100180223
831 Ga0068862_101139119
832 Ga0081539_10043735
833 Ga0081539_10055852
834 Ga0075368_10070953
835 Ga0070716_100131822
836 Ga0075367_10705127
837 Ga0075366_10143512
838 Ga0097621_100012599
839 Ga0097621_100042707
840 Ga0097621_100165023
841 Ga0097621_100180941
842 Ga0097621_100189579
843 Ga0097621_100285404
844 Ga0097621_101652110
845 Ga0068871_100025829
846 Ga0068871_100077500
847 Ga0068871_100237501
848 Ga0068871_100576921
849 Ga0068871_102088390
850 Ga0075434_100279418
851 Ga0075434_101824706
852 Ga0068865_100004579
853 Ga0068865_100103285
854 Ga0068865_100480896
855 Ga0068865_100690177
856 Ga0097620_100087972
857 Ga0097620_100141687
858 Ga0097620_100237106
859 Ga0097620_100529992
860 Ga0097620_100597928
861 Ga0097620_101474544
862 Ga0105240_10120117
863 Ga0105240_10371403
864 Ga0111539_10052102
865 Ga0111539_10066569
866 Ga0105245_10108938
867 Ga0105245_10244140
868 Ga0105245_10944980
869 Ga0105247_10289103
870 Ga0114129_12637592
871 Ga0105243_10011751
872 Ga0105243_10210530
873 Ga0105243_10871453
874 Ga0105241_10051432
875 Ga0105241_10157414
876 Ga0105242_10001090
877 Ga0105242_10017265
878 Ga0105242_10060086
879 Ga0105248_10011535
880 Ga0105248_10034640
881 Ga0105248_10126633
882 Ga0105248_10186427
883 Ga0105248_10201580
884 Ga0105248_11344944
885 Ga0105237_10111681
886 Ga0105237_10404916
887 Ga0105238_10360094
888 Ga0105238_10369645
889 Ga0105249_10127106
890 Ga0105249_10462535
891 Ga0105249_10683434
892 Ga0105239_10025267
893 Ga0105239_10027414
894 Ga0105239_11326996
895 Ga0105239_11414788
896 Ga0105246_10067078
897 Ga0105246_10269628
898 Ga0157323_1038719
899 Ga0157326_1016907
900 Ga0157373_10003126
901 Ga0157370_10013186
902 Ga0157370_10020666
903 Ga0157370_10027661
904 Ga0157369_10081908
905 Ga0157369_10192976
906 Ga0157369_10833552
907 Ga0157374_10077204
908 Ga0157374_10084839
909 Ga0157374_10090431
910 Ga0157374_10318555
911 Ga0157374_10400750
912 Ga0157374_10776494
913 Ga0157378_10028236
914 Ga0157378_10063593
915 Ga0157378_10110503
916 Ga0157378_10193029
917 Ga0157378_11245219
918 Ga0157378_12071466
919 Ga0163162_10028096
920 Ga0163162_10087313
921 Ga0163162_10176514
922 Ga0163162_10561643
923 Ga0163162_11092503
924 Ga0163162_11322366
925 Ga0157372_10086493
926 Ga0157372_10392019
927 Ga0157372_11421168
928 Ga0157372_12410247
929 Ga0157375_10033163
930 Ga0157375_10269326
931 Ga0157375_10485401
932 Ga0163163_10037483
933 Ga0163163_10077924
934 Ga0163163_10500503
935 Ga0163163_11364602
936 Ga0157380_10031073
937 Ga0157380_10087623
938 Ga0157377_10001742
939 Ga0157377_10012164
940 Ga0157379_10068748
941 Ga0157379_10534767
942 Ga0157379_10701982
943 Ga0157379_11619682
944 Ga0157379_11676624
945 Ga0157376_10292601
946 Ga0157376_10675292
947 Ga0157376_11406334
948 Ga0157376_11861874
949 Ga0163161_10029737
950 Ga0163161_10238280
951 Ga0163161_10298099
952 Ga0163161_11535382
953 Ga0197907_10121607
954 Ga0207666_1009803
955 Ga0207697_10000706
956 Ga0207697_10011044
957 Ga0207656_10063622
958 Ga0207656_10074294
959 Ga0207682_10001799
960 Ga0207692_10745158
961 Ga0207642_10334613
962 Ga0207688_10016745
963 Ga0207688_10032003
964 Ga0207680_10554598
965 Ga0207680_10727269
966 Ga0207699_10056612
967 Ga0207645_10003782
968 Ga0207645_10019606
969 Ga0207645_10036471
970 Ga0207645_10039971
971 Ga0207645_10207412
972 Ga0207643_10000751
973 Ga0207643_10001436
974 Ga0207643_10502853
975 Ga0207705_10314648
976 Ga0207707_10002089
977 Ga0207707_10281075
978 Ga0207707_10492557
979 Ga0207671_10092173
980 Ga0207671_10439696
981 Ga0207660_10004612
982 Ga0207660_10122207
983 Ga0207660_10351298
984 Ga0207662_10063207
985 Ga0207662_10953222
986 Ga0207657_10010010
987 Ga0207657_10010281
988 Ga0207657_10024752
989 Ga0207657_10201091
990 Ga0207657_10229450
991 Ga0207649_10039432
992 Ga0207649_10071408
993 Ga0207649_10436425
994 Ga0207681_10099826
995 Ga0207681_10223640
996 Ga0207681_10573516
997 Ga0207681_11074920
998 Ga0207694_10014549
999 Ga0207650_10002097
1000 Ga0207650_10022253
1001 Ga0207650_10024237
1002 Ga0207650_10047388
1003 Ga0207650_10425634
1004 Ga0207650_10873728
1005 Ga0207650_11433753
1006 Ga0207659_10085135
1007 Ga0207659_10302616
1008 Ga0207659_10459250
1009 Ga0207687_10120808
1010 Ga0207687_10739463
1011 Ga0207644_10030799
1012 Ga0207644_10050163
1013 Ga0207644_10218531
1014 Ga0207644_10300301
1015 Ga0207644_10406396
1016 Ga0207690_10151686
1017 Ga0207690_10579290
1018 Ga0207706_10004986
1019 Ga0207706_10020624
1020 Ga0207706_10032668
1021 Ga0207706_10066738
1022 Ga0207706_10145463
1023 Ga0207686_10049245
1024 Ga0207670_10106258
1025 Ga0207670_11014521
1026 Ga0207670_11233550
1027 Ga0207670_11650065
1028 Ga0207670_11758654
1029 Ga0207669_10015518
1030 Ga0207669_10041284
1031 Ga0207669_10318882
1032 Ga0207704_10091065
1033 Ga0207704_10927823
1034 Ga0207665_10153491
1035 Ga0207665_10295718
1036 Ga0207691_10009885
1037 Ga0207691_10035610
1038 Ga0207691_10037177
1039 Ga0207691_10042799
1040 Ga0207691_10043975
1041 Ga0207691_10249566
1042 Ga0207711_10044746
1043 Ga0207711_10763261
1044 Ga0207711_11982733
1045 Ga0207689_10001375
1046 Ga0207689_10002760
1047 Ga0207661_10050375
1048 Ga0207661_10148528
1049 Ga0207661_10199705
1050 Ga0207661_10824329
1051 Ga0207679_10045892
1052 Ga0207679_10339911
1053 Ga0207679_11399106
1054 Ga0207667_10032145
1055 Ga0207667_10043503
1056 Ga0207667_10074955
1057 Ga0207667_10354359
1058 Ga0207667_10404097
1059 Ga0207651_10359192
1060 Ga0207651_10686950
1061 Ga0207712_10663006
1062 Ga0207668_10056481
1063 Ga0207668_10064657
1064 Ga0207668_10089028
1065 Ga0207668_10211286
1066 Ga0207668_10712241
1067 Ga0207668_10793499
1068 Ga0207640_10004093
1069 Ga0207640_10258457
1070 Ga0207658_10183644
1071 Ga0207658_10226901
1072 Ga0207658_10276119
1073 Ga0207658_10288717
1074 Ga0207658_10398456
1075 Ga0207658_10590281
1076 Ga0207677_10136692
1077 Ga0207677_10181242
1078 Ga0207677_10735482
1079 Ga0207677_11862915
1080 Ga0207703_10022314
1081 Ga0207703_10058626
1082 Ga0207703_10134029
1083 Ga0207703_10230704
1084 Ga0207703_10287518
1085 Ga0207703_10445855
1086 Ga0207703_10737926
1087 Ga0207703_11398605
1088 Ga0207639_10018692
1089 Ga0207639_10028308
1090 Ga0207639_10250008
1091 Ga0207639_10636470
1092 Ga0207678_10011055
1093 Ga0207678_10016426
1094 Ga0207708_10000793
1095 Ga0207708_10004037
1096 Ga0207708_10054979
1097 Ga0207702_10429241
1098 Ga0207641_10071749
1099 Ga0207641_10096439
1100 Ga0207641_10280850
1101 Ga0207641_10480312
1102 Ga0207641_10570230
1103 Ga0207641_10740680
1104 Ga0207641_10795159
1105 Ga0207641_11080945
1106 Ga0207648_10002475
1107 Ga0207648_10006164
1108 Ga0207648_10006236
1109 Ga0207648_10200986
1110 Ga0207648_10644517
1111 Ga0207648_10675989
1112 Ga0207648_11705852
1113 Ga0207676_10003025
1114 Ga0207676_10029187
1115 Ga0207676_10049009
1116 Ga0207676_10113866
1117 Ga0207674_10000237
1118 Ga0207674_10008366
1119 Ga0207674_10015324
1120 Ga0207674_10221312
1121 Ga0207675_100002899
1122 Ga0207675_100008392
1123 Ga0207675_100031810
1124 Ga0207683_10003901
1125 Ga0207683_10006830
1126 Ga0207683_10012474
1127 Ga0207683_10014931
1128 Ga0207698_10004075
1129 Ga0207698_10198538
1130 Ga0207698_10620646
1131 Ga0207698_10772187
1132 Ga0209981_1022892
1133 Ga0209968_1005221
1134 Ga0209971_1002080
1135 Ga0209966_1006439
1136 Ga0207428_10258920
1137 Ga0207428_10526305
1138 Ga0268266_10013268
1139 Ga0268266_10077365
1140 Ga0268266_10336195
1141 Ga0268265_10059258
1142 Ga0268265_10251033
1143 Ga0268265_10533312
1144 Ga0268264_10037939
1145 Ga0268264_10335104
1146 Ga0268264_10575752
1147 Ga0268264_10716253
1148 Ga0265318_10003576
1149 Ga0307511_10000570
1150 Ga0265330_10089023
1151 Ga0265332_10020320
1152 Ga0265328_10003951
1153 Ga0265328_10144306
1154 Ga0265320_10014323
1155 Ga0265329_10018565
1156 Ga0265339_10080200
1157 Ga0265331_10000577
1158 Ga0265316_10023838
1159 Ga0265314_10000335
1160 Ga0265342_10015609
1161 Ga0307507_10027912
1162 Ga0307507_10389661
1163 Ga0373944_0056286
1164 Ga0373953_0150396
1165 Ga0373943_0054169
1166 Ga0373955_0256377
1167 Ga0373955_0350150
1168 Ga0373955_0559229
1169 Ga0373927_0585147
1170 Ga0373947_0214412
1171 Ga0373947_0265059
1172 Ga0373937_0021467
1173 Ga0373937_0214050
1174 Ga0373925_0319121
1175 Ga0395900_0580482
1176 Ga0395905_0053224
1177 Ga0395905_0053918
1178 Ga0395905_0240811
1179 Ga0395901_0015270
1180 Ga0451853_2512646
1181 Ga0451577_0067673
1182 Ga0466963_0488065
1183 Ga0451576_0469913
1184 Ga0495628_1045795
1185 Ga0495598_0011465
1186 Ga0495621_0173455
1187 Ga0495658_0056703
1188 Ga0496101_0085183
1189 Ga0496102_0457998
1190 Ga0496102_0471597
1191 Ga0496104_0045599
1192 Ga0496105_0014540
1193 Ga0496105_1003956
1194 Ga0496106_0062806
1195 Ga0496107_0042172
1196 Ga0496108_0045527
1197 Ga0496108_0341741
1198 Ga0496109_0041638
1199 Ga0496109_1548178
1200 Ga0496110_0698105
1201 Ga0496112_0009955
1202 Ga0496112_0304245
1203 Ga0496114_0022944
1204 Ga0501069_0406538
1205 Ga0501069_0526498
1206 Ga0501070_0228087
1207 Ga0501073_0386927
1208 Ga0501080_0120462
1209 nmdc:mga0k408_488268_c1
1210 nmdc:mga0k408_78883_c1
1211 nmdc:mga06z11_100034_c1
1212 nmdc:mga04h51_85716_c1
1213 nmdc:mga05p37_1635121_c1
1214 nmdc:mga08y16_358243_c1
1215 nmdc:mga0rr50_505145_c1
1216 nmdc:mga08x19_417732_c1
1217 nmdc:mga0sz30_56177_c1
1218 Ga0495655_0088352
1219 Ga0495595_0123760
1220 Ga0500583_0099127
1221 Ga0500641_0072881
1222 Ga0500650_0177480
1223 Ga0500555_133943
1224 Ga0500594_0037165
1225 Ga0500568_0072843
1226 Ga0500604_0002312
1227 Ga0500622_0234064
1228 Ga0500637_0129698
1229 2891634885
1230 2904436959

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08897

DUF1841

Domain of unknown function (DUF1841)

5

139

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ufe-assembly1.cif.gz_B structure of transcriptional antiterminator (bglg-family) at 1.5 a resolution 0.3722 40 139
3ufe-assembly1.cif.gz_B structure of transcriptional antiterminator (bglg-family) at 1.5 a resolution 0.3473 40 139
7pwx-assembly2.cif.gz_AAA dutpase from m. tuberculosis in complex with stl 0.3156 9 139
7pwx-assembly2.cif.gz_AAA dutpase from m. tuberculosis in complex with stl 0.302 9 139
6ygi-assembly1.cif.gz_A duck hepatitis b virus capsid mutant r124e_delta78-122 0.2951 2 80
ID Description Score Start End Superfamily
af_Q0JCU7_79_449_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8967 107 139 3.50.50.60
af_P29465_638_983_3.30.497.10 Alpha Beta;2-Layer Sandwich;Antithrombin; Chain I, domain 2;Antithrombin, subunit I, domain 2 0.8598 3 35 3.30.497.10
af_O44978_624_799_1.20.1640.10 Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain 0.4371 72 137 1.20.1640.10
af_P9WGH5_2_93_1.10.1740.10 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.4018 75 139 1.10.1740.10
af_Q9VHG1_6_421_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.3877 2 61 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A171JX16-F1-model_v4 deleted 0.9908 77 139
AF-A0A3N5NS12-F1-model_v4 DUF1841 family protein 0.9901 1 88
AF-A0A4Q6BB78-F1-model_v4 DUF1841 family protein 0.9802 86 140
AF-A0A3N5NS12-F1-model_v4 DUF1841 family protein 0.9791 1 88
AF-G9EJN3-F1-model_v4 Uncharacterized protein 0.9772 92 140

Map