F469503

General Info

Members Datasets Scaffolds Average Seq Length
616 276 616 215

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10002218|Ga0070658_100022187
Length 231
Sequence MSVNLPNAFTVGRIAVTPLIAWLPMAPNTALRLTAFVLFVVAAVTDYVDGRLARSRKQETDLGRLLDPLADKLLLVATVVPMFLLMRPSLHSSQGWPAKALDNVLPFRTPFGDVALAWWIIAVVLGRELFMTVFRQAAARRGVVIAAIGPAKWKTGFQSVWVGSAYFWFFAATLAATRGWKTPAWNAFAMFNGSVGVLTMIGAVGLTLYSLVLYLRAYGRVFSGAPVRGRG

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
174 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
175 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
176 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
177 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
178 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
179 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
180 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
181 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
182 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
183 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
184 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
185 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
186 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
187 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
188 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
189 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
190 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
191 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
192 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
193 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
194 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
195 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
196 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
197 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
198 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
199 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
200 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
201 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
202 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
203 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
204 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
205 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
206 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
207 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
208 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
209 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
210 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
211 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
212 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
213 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
214 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
215 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
216 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
217 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
218 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
219 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
220 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
221 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
222 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
223 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
224 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
225 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
226 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
227 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
228 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
229 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
230 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
231 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
232 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
233 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
234 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
235 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
236 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
237 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
238 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
239 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
240 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
241 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
242 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
243 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
244 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
245 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
250 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
251 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
252 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
253 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
254 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
255 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
256 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
257 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
258 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
259 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
260 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
261 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
262 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
263 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
264 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
265 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
266 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
267 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
268 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
269 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
270 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
272 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
273 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
274 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
275 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
276 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.27
Rhizosphere 97.56
Stem 0
Stem Tuber 0
Unclassified 0.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_10986866 2162886012 Unclassified 2855
2 MBSR1b_contig_545708 2162886012 Bacteria 2111
3 LJQas_1008542 3300000549 Bacteria 1244
4 JGI24737J22298_10028029 3300001990 Unclassified 1773
5 Ga0065715_10094902 3300005293 Bacteria 4215
6 Ga0065715_10095089 3300005293 Bacteria 4169
7 Ga0065715_10252904 3300005293 Bacteria 1161
8 Ga0065715_10296232 3300005293 Bacteria 1052
9 Ga0070658_10002218 3300005327 Bacteria 16306
10 Ga0070658_10015518 3300005327 Bacteria 6092
11 Ga0070658_10022112 3300005327 Bacteria 5102
12 Ga0070658_10176763 3300005327 Bacteria 1795
13 Ga0070658_10316322 3300005327 Bacteria 1332
14 Ga0070658_10392659 3300005327 Bacteria 1191
15 Ga0070658_10519911 3300005327 Bacteria 1029
16 Ga0070676_10015406 3300005328 Bacteria 4217
17 Ga0070676_10019953 3300005328 Bacteria 3735
18 Ga0070676_10241265 3300005328 Unclassified 1202
19 Ga0070683_100000588 3300005329 Bacteria 25968
20 Ga0070683_100006454 3300005329 Bacteria 9841
21 Ga0070683_100009728 3300005329 Bacteria 8234
22 Ga0070683_100038843 3300005329 Bacteria 4366
23 Ga0070683_100052156 3300005329 Bacteria 3788
24 Ga0070683_100063261 3300005329 Bacteria 3442
25 Ga0070683_100088528 3300005329 Bacteria 2905
26 Ga0070683_100094528 3300005329 Bacteria 2809
27 Ga0070683_100136769 3300005329 Bacteria 2320
28 Ga0070683_100349132 3300005329 Bacteria 1409
29 Ga0070683_100563781 3300005329 Bacteria 1089
30 Ga0070683_100835170 3300005329 Bacteria 883
31 Ga0070690_100041687 3300005330 Bacteria 2907
32 Ga0070690_100068051 3300005330 Bacteria 2309
33 Ga0070690_100215801 3300005330 Unclassified 1342
34 Ga0070670_100165303 3300005331 Bacteria 1918
35 Ga0068869_100387468 3300005334 Bacteria 1147
36 Ga0068869_100539574 3300005334 Bacteria 978
37 Ga0070666_10214304 3300005335 Bacteria 1357
38 Ga0070680_100000354 3300005336 Bacteria 30834
39 Ga0070680_100000489 3300005336 Bacteria 27191
40 Ga0070680_100020720 3300005336 Bacteria 5217
41 Ga0070680_100078840 3300005336 Bacteria 2714
42 Ga0070680_100091843 3300005336 Bacteria 2513
43 Ga0070680_100200121 3300005336 Bacteria 1684
44 Ga0070680_100409236 3300005336 Bacteria 1157
45 Ga0070682_100000492 3300005337 Bacteria 24800
46 Ga0070682_100008751 3300005337 Bacteria 5712
47 Ga0070682_100091994 3300005337 Bacteria 1986
48 Ga0068868_100564684 3300005338 Bacteria 1004
49 Ga0070660_100009663 3300005339 Bacteria 6794
50 Ga0070689_100023872 3300005340 Bacteria 4583
51 Ga0070689_100043551 3300005340 Bacteria 3450
52 Ga0070691_10118175 3300005341 Bacteria 1332
53 Ga0070687_100022298 3300005343 Bacteria 2992
54 Ga0070687_100123057 3300005343 Bacteria 1487
55 Ga0070661_100021690 3300005344 Bacteria 4592
56 Ga0070661_100052197 3300005344 Bacteria 2992
57 Ga0070661_100309970 3300005344 Bacteria 1230
58 Ga0070661_100310497 3300005344 Unclassified 1229
59 Ga0070692_10014399 3300005345 Bacteria 3715
60 Ga0070668_100107142 3300005347 Bacteria 2221
61 Ga0070668_100189791 3300005347 Bacteria 1683
62 Ga0070669_100044637 3300005353 Bacteria 3229
63 Ga0070669_100069804 3300005353 Bacteria 2595
64 Ga0070669_100173467 3300005353 Bacteria 1683
65 Ga0070675_100032135 3300005354 Bacteria 4245
66 Ga0070675_100130588 3300005354 Bacteria 2140
67 Ga0070675_100739478 3300005354 Bacteria 897
68 Ga0070671_100016066 3300005355 Bacteria 6050
69 Ga0070671_100025904 3300005355 Bacteria 4816
70 Ga0070671_100271195 3300005355 Unclassified 1442
71 Ga0070674_100061989 3300005356 Bacteria 2612
72 Ga0070673_100024766 3300005364 Bacteria 4405
73 Ga0070673_100032682 3300005364 Bacteria 3922
74 Ga0070673_100059989 3300005364 Bacteria 3013
75 Ga0070673_100181023 3300005364 Unclassified 1804
76 Ga0070688_100005659 3300005365 Bacteria 6598
77 Ga0070659_100025729 3300005366 Bacteria 4524
78 Ga0070659_100292106 3300005366 Bacteria 1358
79 Ga0070667_100059416 3300005367 Bacteria 3234
80 Ga0070667_100121474 3300005367 Bacteria 2272
81 Ga0070709_10017799 3300005434 Bacteria 4083
82 Ga0070709_10039769 3300005434 Bacteria 2887
83 Ga0070709_10109269 3300005434 Bacteria 1856
84 Ga0070714_100001803 3300005435 Bacteria 15572
85 Ga0070713_100004812 3300005436 Bacteria 9146
86 Ga0070710_10076722 3300005437 Bacteria 1940
87 Ga0070711_100039252 3300005439 Bacteria 3187
88 Ga0070711_100651224 3300005439 Unclassified 883
89 Ga0070700_100008003 3300005441 Bacteria 5741
90 Ga0070694_100009796 3300005444 Bacteria 5886
91 Ga0070694_100117332 3300005444 Bacteria 1905
92 Ga0070708_100000038 3300005445 Bacteria 85764
93 Ga0070708_100000557 3300005445 Bacteria 27909
94 Ga0070708_100116120 3300005445 Bacteria 2464
95 Ga0070663_100000657 3300005455 Bacteria 18567
96 Ga0070663_100403621 3300005455 Bacteria 1118
97 Ga0070678_100223904 3300005456 Bacteria 1565
98 Ga0070678_100659745 3300005456 Bacteria 939
99 Ga0070662_100006003 3300005457 Bacteria 7791
100 Ga0070662_100682475 3300005457 Bacteria 868
101 Ga0070681_10003610 3300005458 Bacteria 14508
102 Ga0070681_10042879 3300005458 Bacteria 4533
103 Ga0070681_10249922 3300005458 Bacteria 1686
104 Ga0070681_10273188 3300005458 Unclassified 1601
105 Ga0070681_10364929 3300005458 Bacteria 1354
106 Ga0070681_10524503 3300005458 Bacteria 1098
107 Ga0070681_10545691 3300005458 Bacteria 1073
108 Ga0068867_100005743 3300005459 Bacteria 8802
109 Ga0068867_100127351 3300005459 Bacteria 1975
110 Ga0070685_10010783 3300005466 Bacteria 4760
111 Ga0070685_10147704 3300005466 Bacteria 1487
112 Ga0070706_100050717 3300005467 Bacteria 3829
113 Ga0070706_100170498 3300005467 Bacteria 2032
114 Ga0070707_100017092 3300005468 Bacteria 6812
115 Ga0070707_100024874 3300005468 Bacteria 5676
116 Ga0070698_100009782 3300005471 Bacteria 10251
117 Ga0070698_100010089 3300005471 Bacteria 10090
118 Ga0070698_100021929 3300005471 Bacteria 6687
119 Ga0070699_100007723 3300005518 Bacteria 9351
120 Ga0070699_100149293 3300005518 Bacteria 2066
121 Ga0070699_100241147 3300005518 Bacteria 1614
122 Ga0070699_100251550 3300005518 Bacteria 1579
123 Ga0070699_100796857 3300005518 Bacteria 865
124 Ga0070679_100000377 3300005530 Bacteria 37955
125 Ga0070679_100061707 3300005530 Bacteria 3737
126 Ga0070679_100075909 3300005530 Bacteria 3350
127 Ga0070679_100143239 3300005530 Bacteria 2369
128 Ga0070679_100224971 3300005530 Unclassified 1836
129 Ga0070679_100422142 3300005530 Bacteria 1279
130 Ga0070679_100463033 3300005530 Bacteria 1212
131 Ga0070679_100480877 3300005530 Unclassified 1186
132 Ga0070684_100021184 3300005535 Bacteria 5403
133 Ga0070684_100035542 3300005535 Bacteria 4265
134 Ga0070684_100041085 3300005535 Bacteria 3986
135 Ga0070684_100066524 3300005535 Bacteria 3164
136 Ga0070684_100110796 3300005535 Bacteria 2461
137 Ga0070684_100130366 3300005535 Bacteria 2268
138 Ga0070684_100130803 3300005535 Bacteria 2264
139 Ga0070684_100136839 3300005535 Bacteria 2213
140 Ga0070684_100156666 3300005535 Bacteria 2065
141 Ga0070684_100527022 3300005535 Bacteria 1095
142 Ga0070697_100059204 3300005536 Bacteria 3118
143 Ga0070697_100202703 3300005536 Bacteria 1686
144 Ga0070697_100758748 3300005536 Bacteria 857
145 Ga0068853_100035824 3300005539 Bacteria 4217
146 Ga0068853_100049978 3300005539 Bacteria 3596
147 Ga0068853_100317927 3300005539 Bacteria 1443
148 Ga0070672_100036869 3300005543 Bacteria 3728
149 Ga0070672_100083943 3300005543 Bacteria 2557
150 Ga0070672_100177964 3300005543 Bacteria 1771
151 Ga0070672_100267632 3300005543 Bacteria 1442
152 Ga0070686_100014767 3300005544 Bacteria 4506
153 Ga0070686_100077205 3300005544 Bacteria 2195
154 Ga0070686_100455048 3300005544 Bacteria 985
155 Ga0070695_100007270 3300005545 Bacteria 6564
156 Ga0070696_100003340 3300005546 Bacteria 10719
157 Ga0070696_100012630 3300005546 Bacteria 5670
158 Ga0070696_100199997 3300005546 Bacteria 1491
159 Ga0070693_100001724 3300005547 Bacteria 9944
160 Ga0070665_100089358 3300005548 Bacteria 3086
161 Ga0068855_100007038 3300005563 Bacteria 13645
162 Ga0068855_100029666 3300005563 Bacteria 6539
163 Ga0068855_100054011 3300005563 Bacteria 4725
164 Ga0068855_100121690 3300005563 Bacteria 2986
165 Ga0068855_100189635 3300005563 Bacteria 2320
166 Ga0070664_100026438 3300005564 Bacteria 4814
167 Ga0070664_100035049 3300005564 Bacteria 4212
168 Ga0070664_100209682 3300005564 Bacteria 1741
169 Ga0070664_100219014 3300005564 Bacteria 1703
170 Ga0070664_100223454 3300005564 Bacteria 1685
171 Ga0070664_100478304 3300005564 Bacteria 1146
172 Ga0070664_100759312 3300005564 Bacteria 905
173 Ga0068857_100027095 3300005577 Bacteria 5055
174 Ga0068854_100005726 3300005578 Bacteria 7857
175 Ga0068856_100010080 3300005614 Bacteria 9184
176 Ga0070702_100196560 3300005615 Bacteria 1331
177 Ga0070702_100219806 3300005615 Bacteria 1270
178 Ga0068852_100005268 3300005616 Bacteria 9231
179 Ga0068852_100043124 3300005616 Bacteria 3825
180 Ga0068852_100085174 3300005616 Bacteria 2815
181 Ga0068852_100101700 3300005616 Bacteria 2596
182 Ga0068859_100051195 3300005617 Bacteria 4150
183 Ga0068859_100059676 3300005617 Bacteria 3843
184 Ga0068859_100135973 3300005617 Bacteria 2531
185 Ga0068864_100323383 3300005618 Bacteria 1449
186 Ga0068864_100441775 3300005618 Bacteria 1243
187 Ga0068866_10071650 3300005718 Bacteria 1834
188 Ga0068866_10096017 3300005718 Bacteria 1625
189 Ga0068861_100034167 3300005719 Bacteria 3759
190 Ga0068861_100252421 3300005719 Bacteria 1506
191 Ga0068861_100637188 3300005719 Bacteria 983
192 Ga0068851_10040153 3300005834 Bacteria 2351
193 Ga0068870_10003341 3300005840 Bacteria 6783
194 Ga0068870_10308709 3300005840 Unclassified 1001
195 Ga0068863_100634106 3300005841 Bacteria 1059
196 Ga0068858_100290965 3300005842 Bacteria 1557
197 Ga0068860_100210819 3300005843 Bacteria 1885
198 Ga0068860_100602908 3300005843 Bacteria 1104
199 Ga0068860_100662927 3300005843 Bacteria 1052
200 Ga0068862_100044188 3300005844 Bacteria 3800
201 Ga0070712_100288105 3300006175 Bacteria 1325
202 Ga0070712_100496929 3300006175 Bacteria 1022
203 Ga0068871_100119934 3300006358 Bacteria 2221
204 Ga0068871_100338775 3300006358 Bacteria 1328
205 Ga0075433_10007884 3300006852 Bacteria 8469
206 Ga0075434_100028012 3300006871 Bacteria 5532
207 Ga0068865_100006993 3300006881 Bacteria 6921
208 Ga0068865_100073262 3300006881 Bacteria 2435
209 Ga0075436_100225073 3300006914 Bacteria 1332
210 Ga0097620_100051195 3300006931 Bacteria 4150
211 Ga0097620_100059675 3300006931 Bacteria 3843
212 Ga0097620_100135973 3300006931 Bacteria 2531
213 Ga0105240_10001901 3300009093 Bacteria 34675
214 Ga0105240_10003398 3300009093 Bacteria 24750
215 Ga0105240_10038998 3300009093 Bacteria 6088
216 Ga0105240_10056687 3300009093 Bacteria 4902
217 Ga0105240_10210645 3300009093 Bacteria 2271
218 Ga0105240_10754736 3300009093 Bacteria 1057
219 Ga0111539_10035036 3300009094 Bacteria 6078
220 Ga0111539_11256563 3300009094 Bacteria 860
221 Ga0105245_10048971 3300009098 Unclassified 3782
222 Ga0105245_10070103 3300009098 Bacteria 3180
223 Ga0105245_10164684 3300009098 Bacteria 2107
224 Ga0105245_11029221 3300009098 Bacteria 868
225 Ga0114129_10186370 3300009147 Bacteria 2820
226 Ga0105243_10160545 3300009148 Bacteria 1938
227 Ga0105243_10242652 3300009148 Bacteria 1604
228 Ga0105243_10313800 3300009148 Bacteria 1426
229 Ga0105243_10917581 3300009148 Bacteria 872
230 Ga0105241_10276886 3300009174 Bacteria 1431
231 Ga0105242_10003515 3300009176 Bacteria 12176
232 Ga0105242_10269899 3300009176 Bacteria 1540
233 Ga0105248_10046791 3300009177 Bacteria 4851
234 Ga0105248_10193270 3300009177 Bacteria 2293
235 Ga0105237_10007185 3300009545 Bacteria 12230
236 Ga0105238_10037867 3300009551 Bacteria 4901
237 Ga0105238_10114565 3300009551 Bacteria 2675
238 Ga0105249_10047289 3300009553 Bacteria 3920
239 Ga0105239_10376615 3300010375 Bacteria 1604
240 Ga0157316_1005936 3300012510 Bacteria 983
241 Ga0157373_10000902 3300013100 Bacteria 23019
242 Ga0157373_10034536 3300013100 Bacteria 3632
243 Ga0157373_10105675 3300013100 Bacteria 1980
244 Ga0157371_10023342 3300013102 Bacteria 4524
245 Ga0157371_10064836 3300013102 Bacteria 2588
246 Ga0157371_10248033 3300013102 Bacteria 1281
247 Ga0157370_10012699 3300013104 Bacteria 8716
248 Ga0157370_10034666 3300013104 Bacteria 4911
249 Ga0157370_10050158 3300013104 Bacteria 3991
250 Ga0157370_10197619 3300013104 Bacteria 1866
251 Ga0157370_10371493 3300013104 Bacteria 1318
252 Ga0157370_10481097 3300013104 Bacteria 1141
253 Ga0157369_10006735 3300013105 Bacteria 13258
254 Ga0157369_10019497 3300013105 Bacteria 7590
255 Ga0157369_10028815 3300013105 Bacteria 6141
256 Ga0157369_10042377 3300013105 Bacteria 4966
257 Ga0157369_10057459 3300013105 Bacteria 4198
258 Ga0157369_10079689 3300013105 Bacteria 3507
259 Ga0157369_10276582 3300013105 Unclassified 1749
260 Ga0157369_10524047 3300013105 Unclassified 1226
261 Ga0157369_10567122 3300013105 Bacteria 1173
262 Ga0157374_10073752 3300013296 Bacteria 3221
263 Ga0157378_10014701 3300013297 Bacteria 6857
264 Ga0157378_10017905 3300013297 Bacteria 6218
265 Ga0157378_10357593 3300013297 Bacteria 1428
266 Ga0157378_10393404 3300013297 Bacteria 1364
267 Ga0163162_10270155 3300013306 Bacteria 1832
268 Ga0157372_10001161 3300013307 Bacteria 28502
269 Ga0157372_10003116 3300013307 Bacteria 17881
270 Ga0157372_10006551 3300013307 Bacteria 12388
271 Ga0157372_10009434 3300013307 Bacteria 10382
272 Ga0157372_10028273 3300013307 Bacteria 6119
273 Ga0157372_10029216 3300013307 Bacteria 6018
274 Ga0157372_10029467 3300013307 Bacteria 5994
275 Ga0157372_10044752 3300013307 Bacteria 4906
276 Ga0157372_10048350 3300013307 Bacteria 4728
277 Ga0157372_10075622 3300013307 Bacteria 3800
278 Ga0157372_10186834 3300013307 Bacteria 2400
279 Ga0157372_10279321 3300013307 Bacteria 1941
280 Ga0157372_10560779 3300013307 Bacteria 1331
281 Ga0157372_10955000 3300013307 Bacteria 994
282 Ga0157375_10011285 3300013308 Bacteria 7888
283 Ga0157375_10013766 3300013308 Bacteria 7212
284 Ga0157375_10021058 3300013308 Bacteria 5972
285 Ga0157375_10031948 3300013308 Bacteria 4987
286 Ga0157375_10542597 3300013308 Bacteria 1325
287 Ga0163163_10535446 3300014325 Bacteria 1234
288 Ga0157380_10101014 3300014326 Bacteria 2402
289 Ga0182008_10212748 3300014497 Bacteria 987
290 Ga0157377_10061235 3300014745 Bacteria 2150
291 Ga0157379_10527192 3300014968 Bacteria 1097
292 Ga0157376_10868371 3300014969 Bacteria 918
293 Ga0207697_10016206 3300025315 Bacteria 3073
294 Ga0207682_10005041 3300025893 Bacteria 5413
295 Ga0207692_10159209 3300025898 Unclassified 1300
296 Ga0207692_10246697 3300025898 Bacteria 1068
297 Ga0207642_10005679 3300025899 Bacteria 4087
298 Ga0207688_10079061 3300025901 Bacteria 1875
299 Ga0207680_10202188 3300025903 Bacteria 1354
300 Ga0207647_10139104 3300025904 Bacteria 1423
301 Ga0207699_10031482 3300025906 Bacteria 2978
302 Ga0207645_10010773 3300025907 Bacteria 6268
303 Ga0207645_10090050 3300025907 Bacteria 1973
304 Ga0207645_10192353 3300025907 Unclassified 1341
305 Ga0207643_10041580 3300025908 Bacteria 2591
306 Ga0207705_10005895 3300025909 Bacteria 9109
307 Ga0207705_10036993 3300025909 Bacteria 3493
308 Ga0207705_10055658 3300025909 Bacteria 2852
309 Ga0207705_10103290 3300025909 Bacteria 2099
310 Ga0207705_10248380 3300025909 Bacteria 1357
311 Ga0207705_10257492 3300025909 Bacteria 1332
312 Ga0207705_10371210 3300025909 Bacteria 1104
313 Ga0207705_10681323 3300025909 Bacteria 799
314 Ga0207684_10415187 3300025910 Unclassified 1156
315 Ga0207707_10002464 3300025912 Bacteria 16657
316 Ga0207707_10002797 3300025912 Bacteria 15562
317 Ga0207707_10005608 3300025912 Bacteria 10982
318 Ga0207707_10439668 3300025912 Bacteria 1117
319 Ga0207707_10552243 3300025912 Bacteria 978
320 Ga0207695_10001210 3300025913 Bacteria 44236
321 Ga0207695_10006853 3300025913 Bacteria 14666
322 Ga0207695_10007203 3300025913 Bacteria 14227
323 Ga0207695_10013093 3300025913 Bacteria 9903
324 Ga0207695_10023163 3300025913 Bacteria 7026
325 Ga0207695_10105862 3300025913 Bacteria 2800
326 Ga0207671_10026872 3300025914 Bacteria 4305
327 Ga0207693_10054509 3300025915 Bacteria 3136
328 Ga0207660_10000027 3300025917 Bacteria 68840
329 Ga0207660_10002473 3300025917 Bacteria 12139
330 Ga0207660_10014362 3300025917 Bacteria 5207
331 Ga0207660_10057385 3300025917 Bacteria 2788
332 Ga0207660_10384875 3300025917 Bacteria 1128
333 Ga0207660_10480972 3300025917 Bacteria 1006
334 Ga0207662_10011048 3300025918 Bacteria 4997
335 Ga0207662_10014059 3300025918 Bacteria 4484
336 Ga0207662_10018268 3300025918 Bacteria 3975
337 Ga0207657_10001987 3300025919 Bacteria 22084
338 Ga0207657_10041492 3300025919 Bacteria 4069
339 Ga0207657_10159653 3300025919 Bacteria 1832
340 Ga0207657_10184335 3300025919 Bacteria 1686
341 Ga0207649_10013241 3300025920 Bacteria 4601
342 Ga0207649_10069112 3300025920 Bacteria 2248
343 Ga0207649_10156190 3300025920 Bacteria 1576
344 Ga0207649_10230993 3300025920 Unclassified 1323
345 Ga0207652_10000336 3300025921 Bacteria 48795
346 Ga0207652_10035727 3300025921 Bacteria 4196
347 Ga0207652_10076188 3300025921 Bacteria 2924
348 Ga0207652_10209346 3300025921 Unclassified 1756
349 Ga0207652_10257931 3300025921 Bacteria 1573
350 Ga0207652_10391075 3300025921 Bacteria 1255
351 Ga0207652_10564579 3300025921 Bacteria 1022
352 Ga0207646_10266829 3300025922 Bacteria 1547
353 Ga0207681_10018728 3300025923 Bacteria 4366
354 Ga0207681_10123011 3300025923 Bacteria 1906
355 Ga0207681_10361744 3300025923 Unclassified 1164
356 Ga0207681_10495074 3300025923 Bacteria 1000
357 Ga0207694_10011414 3300025924 Bacteria 6705
358 Ga0207694_10073076 3300025924 Bacteria 2682
359 Ga0207650_10338339 3300025925 Bacteria 1235
360 Ga0207659_10037533 3300025926 Bacteria 3364
361 Ga0207659_10155715 3300025926 Bacteria 1789
362 Ga0207659_10175182 3300025926 Bacteria 1695
363 Ga0207659_10235769 3300025926 Bacteria 1478
364 Ga0207659_10326210 3300025926 Unclassified 1268
365 Ga0207687_10049041 3300025927 Bacteria 2934
366 Ga0207687_10580862 3300025927 Bacteria 943
367 Ga0207700_10149008 3300025928 Bacteria 1932
368 Ga0207700_10237857 3300025928 Bacteria 1551
369 Ga0207664_10027237 3300025929 Bacteria 4331
370 Ga0207664_10048992 3300025929 Bacteria 3324
371 Ga0207644_10054987 3300025931 Bacteria 2868
372 Ga0207644_10478627 3300025931 Bacteria 1025
373 Ga0207690_10135233 3300025932 Bacteria 1809
374 Ga0207706_10001172 3300025933 Bacteria 26572
375 Ga0207706_10038760 3300025933 Bacteria 4227
376 Ga0207686_10053607 3300025934 Bacteria 2522
377 Ga0207686_10219486 3300025934 Bacteria 1372
378 Ga0207686_10556820 3300025934 Unclassified 897
379 Ga0207709_10118788 3300025935 Bacteria 1781
380 Ga0207709_10170685 3300025935 Bacteria 1526
381 Ga0207709_10204320 3300025935 Bacteria 1413
382 Ga0207670_10024466 3300025936 Bacteria 3774
383 Ga0207670_10058608 3300025936 Bacteria 2616
384 Ga0207669_10439254 3300025937 Bacteria 1031
385 Ga0207704_10515556 3300025938 Bacteria 966
386 Ga0207691_10010422 3300025940 Bacteria 8920
387 Ga0207691_10027451 3300025940 Bacteria 5336
388 Ga0207691_10240106 3300025940 Bacteria 1567
389 Ga0207691_10255244 3300025940 Bacteria 1512
390 Ga0207691_10268403 3300025940 Bacteria 1470
391 Ga0207691_10584936 3300025940 Bacteria 945
392 Ga0207711_10041700 3300025941 Bacteria 3909
393 Ga0207711_10118302 3300025941 Bacteria 2364
394 Ga0207711_10124903 3300025941 Bacteria 2301
395 Ga0207711_10406991 3300025941 Bacteria 1264
396 Ga0207689_10045028 3300025942 Bacteria 3649
397 Ga0207661_10002202 3300025944 Bacteria 13446
398 Ga0207661_10002811 3300025944 Bacteria 12019
399 Ga0207661_10010100 3300025944 Bacteria 6784
400 Ga0207661_10033658 3300025944 Bacteria 3979
401 Ga0207661_10034615 3300025944 Bacteria 3931
402 Ga0207661_10036045 3300025944 Bacteria 3859
403 Ga0207661_10068159 3300025944 Bacteria 2896
404 Ga0207661_10126579 3300025944 Bacteria 2183
405 Ga0207661_10243819 3300025944 Unclassified 1595
406 Ga0207661_10292498 3300025944 Bacteria 1458
407 Ga0207661_10353120 3300025944 Bacteria 1327
408 Ga0207661_10512402 3300025944 Bacteria 1097
409 Ga0207679_10138519 3300025945 Bacteria 1963
410 Ga0207679_10501347 3300025945 Bacteria 1083
411 Ga0207679_10772483 3300025945 Unclassified 875
412 Ga0207667_10007411 3300025949 Bacteria 13189
413 Ga0207667_10176585 3300025949 Bacteria 2194
414 Ga0207667_10222990 3300025949 Bacteria 1931
415 Ga0207651_10154936 3300025960 Bacteria 1788
416 Ga0207651_10313173 3300025960 Bacteria 1309
417 Ga0207651_10491610 3300025960 Unclassified 1059
418 Ga0207712_10026939 3300025961 Bacteria 3835
419 Ga0207668_10031879 3300025972 Bacteria 3476
420 Ga0207668_10056201 3300025972 Bacteria 2740
421 Ga0207668_10088226 3300025972 Bacteria 2271
422 Ga0207668_10927067 3300025972 Bacteria 776
423 Ga0207640_10002009 3300025981 Bacteria 10989
424 Ga0207640_10032284 3300025981 Bacteria 3245
425 Ga0207658_10089066 3300025986 Bacteria 2388
426 Ga0207658_10275557 3300025986 Bacteria 1440
427 Ga0207677_10097579 3300026023 Bacteria 2153
428 Ga0207639_10037588 3300026041 Bacteria 3597
429 Ga0207678_10000562 3300026067 Bacteria 33903
430 Ga0207708_10049905 3300026075 Bacteria 3186
431 Ga0207708_10327159 3300026075 Bacteria 1252
432 Ga0207702_10218910 3300026078 Bacteria 1774
433 Ga0207702_10252157 3300026078 Bacteria 1658
434 Ga0207702_10433193 3300026078 Bacteria 1273
435 Ga0207648_10014800 3300026089 Bacteria 7198
436 Ga0207648_10054836 3300026089 Bacteria 3481
437 Ga0207648_10154382 3300026089 Bacteria 2026
438 Ga0207648_10231897 3300026089 Bacteria 1642
439 Ga0207676_10385278 3300026095 Bacteria 1306
440 Ga0207676_10534513 3300026095 Bacteria 1118
441 Ga0207674_10015817 3300026116 Bacteria 8273
442 Ga0207674_10033328 3300026116 Bacteria 5393
443 Ga0207674_10169610 3300026116 Bacteria 2136
444 Ga0207674_10396296 3300026116 Bacteria 1334
445 Ga0207675_100290075 3300026118 Bacteria 1591
446 Ga0207683_10065581 3300026121 Bacteria 3201
447 Ga0207683_10098845 3300026121 Bacteria 2604
448 Ga0207683_10210900 3300026121 Bacteria 1768
449 Ga0207698_10274689 3300026142 Bacteria 1555
450 Ga0209999_1002000 3300027543 Bacteria 3557
451 Ga0209998_10000291 3300027717 Bacteria 15357
452 Ga0268265_10020036 3300028380 Bacteria 4662
453 Ga0268265_10295034 3300028380 Bacteria 1457
454 Ga0268264_10194460 3300028381 Bacteria 1851
455 Ga0268264_10376366 3300028381 Bacteria 1359
456 Ga0307408_100181520 3300031548 Unclassified 1688
457 Ga0307405_10015762 3300031731 Bacteria 4102
458 Ga0307405_10088896 3300031731 Bacteria 2040
459 Ga0307410_10046790 3300031852 Bacteria 2888
460 Ga0307410_10065830 3300031852 Unclassified 2494
461 Ga0307412_10061868 3300031911 Unclassified 2518
462 Ga0307412_10390834 3300031911 Bacteria 1129
463 Ga0307409_100063391 3300031995 Bacteria 2898
464 Ga0307409_100080438 3300031995 Bacteria 2629
465 Ga0307409_100292667 3300031995 Bacteria 1511
466 Ga0307409_100300426 3300031995 Unclassified 1493
467 Ga0307411_10048722 3300032005 Unclassified 2748
468 Ga0307411_10148556 3300032005 Bacteria 1739
469 Ga0307415_100105899 3300032126 Bacteria 2075
470 Ga0307415_100181485 3300032126 Unclassified 1652
471 Ga0307415_100392508 3300032126 Unclassified 1182
472 Ga0307415_100438567 3300032126 Bacteria 1126
473 Ga0373930_0043548 3300034816 Bacteria 963
474 Ga0373959_0020063 3300034820 Bacteria 1272
475 Ga0373936_0065852 3300035113 Bacteria 1487
476 Ga0373939_0106399 3300035114 Bacteria 970
477 Ga0373954_0060524 3300035118 Bacteria 1786
478 Ga0373956_0031930 3300035119 Bacteria 2309
479 Ga0373956_0057645 3300035119 Bacteria 1755
480 Ga0373956_0235683 3300035119 Bacteria 869
481 Ga0373957_0074667 3300035120 Bacteria 1331
482 Ga0373957_0123320 3300035120 Bacteria 1050
483 Ga0373943_0026246 3300035170 Bacteria 2729
484 Ga0373943_0190096 3300035170 Unclassified 1132
485 Ga0373955_0162463 3300035172 Bacteria 1319
486 Ga0373935_0326761 3300035692 Bacteria 1089
487 Ga0373927_0015471 3300035695 Bacteria 5040
488 Ga0373947_0020600 3300035725 Bacteria 3809
489 Ga0373947_0156653 3300035725 Bacteria 1470
490 Ga0373937_0004555 3300036401 Bacteria 11766
491 Ga0373937_0103166 3300036401 Bacteria 2648
492 Ga0373925_0047451 3300037068 Bacteria 3197
493 Ga0373925_0824896 3300037068 Bacteria 764
494 Ga0242420_006728 3300038996 Bacteria 1823
495 Ga0451853_3891242 3300041512 Unclassified 1593
496 Ga0466966_0005999 3300044684 Bacteria 8020
497 Ga0466966_0031561 3300044684 Bacteria 3435
498 Ga0466959_0050845 3300045049 Bacteria 3042
499 Ga0466959_0067153 3300045049 Bacteria 2600
500 Ga0466958_0189269 3300045836 Unclassified 1308
501 Ga0466967_0069433 3300045976 Bacteria 3149
502 Ga0495603_0220631 3300046455 Unclassified 1094
503 Ga0495629_0004819 3300046459 Bacteria 10121
504 Ga0495629_0088832 3300046459 Bacteria 2156
505 Ga0495629_0121697 3300046459 Bacteria 1818
506 Ga0495651_0104696 3300046462 Bacteria 2100
507 Ga0495651_0268724 3300046462 Bacteria 1157
508 Ga0495653_0030536 3300046463 Bacteria 4291
509 Ga0495653_0332604 3300046463 Bacteria 981
510 Ga0495580_0012607 3300046472 Bacteria 6480
511 Ga0495580_0121597 3300046472 Bacteria 1812
512 Ga0495580_0366729 3300046472 Unclassified 974
513 Ga0495582_0008245 3300046473 Bacteria 5749
514 Ga0495582_0026893 3300046473 Bacteria 3153
515 Ga0495664_0044737 3300046477 Bacteria 2624
516 Ga0495664_0091613 3300046477 Bacteria 1828
517 Ga0495594_0018810 3300046499 Bacteria 3664
518 Ga0495608_0021338 3300046511 Bacteria 4445
519 Ga0495618_0012828 3300046514 Bacteria 5093
520 Ga0495628_0026155 3300046516 Bacteria 4764
521 Ga0495630_0009308 3300046517 Bacteria 7063
522 Ga0495630_0049865 3300046517 Bacteria 3133
523 Ga0495666_0027256 3300046526 Bacteria 2813
524 Ga0495652_0018708 3300046529 Bacteria 6174
525 Ga0495652_0259875 3300046529 Bacteria 1282
526 Ga0495665_0004906 3300046531 Bacteria 7211
527 Ga0495665_0049891 3300046531 Bacteria 2219
528 Ga0495665_0106417 3300046531 Bacteria 1472
529 Ga0495640_0043573 3300046533 Bacteria 3124
530 Ga0495640_0355819 3300046533 Bacteria 903
531 Ga0495586_0045397 3300046535 Bacteria 2368
532 Ga0495586_0050098 3300046535 Bacteria 2259
533 Ga0495586_0692949 3300046535 Bacteria 588
534 Ga0495587_0010256 3300046536 Bacteria 5972
535 Ga0495587_0076668 3300046536 Bacteria 1941
536 Ga0495645_0007759 3300046543 Bacteria 7462
537 Ga0495645_0119225 3300046543 Bacteria 1859
538 Ga0495667_0005908 3300046559 Bacteria 8284
539 Ga0495667_0025081 3300046559 Bacteria 4019
540 Ga0495635_0422407 3300046663 Bacteria 884
541 Ga0495635_0425831 3300046663 Bacteria 879
542 Ga0495588_0011470 3300046674 Bacteria 4162
543 Ga0495657_0276685 3300046675 Bacteria 1005
544 Ga0495599_0000646 3300046678 Bacteria 19723
545 Ga0495599_0025164 3300046678 Bacteria 3725
546 Ga0495623_0029027 3300046679 Bacteria 3560
547 Ga0495646_0106855 3300046680 Bacteria 1597
548 Ga0495658_0013031 3300046683 Bacteria 4226
549 Ga0495658_0077588 3300046683 Bacteria 1943
550 Ga0495658_0258580 3300046683 Bacteria 1096
551 Ga0495658_0483505 3300046683 Bacteria 792
552 Ga0495669_0194539 3300046684 Bacteria 968
553 Ga0495613_0185861 3300046689 Bacteria 1470
554 Ga0495613_0615034 3300046689 Unclassified 722
555 Ga0495581_0061004 3300047315 Bacteria 2179
556 Ga0495581_0118704 3300047315 Unclassified 1539
557 Ga0495604_0006036 3300047317 Bacteria 9613
558 Ga0495674_0176865 3300047319 Bacteria 1778
559 Ga0495674_0177748 3300047319 Unclassified 1773
560 Ga0495674_0497634 3300047319 Bacteria 975
561 Ga0495672_0010420 3300047320 Bacteria 6620
562 Ga0495675_0004413 3300047444 Bacteria 8511
563 Ga0495675_0040545 3300047444 Bacteria 2967
564 Ga0495675_0061497 3300047444 Bacteria 2378
565 Ga0495675_0293117 3300047444 Unclassified 968
566 Ga0495684_0069647 3300047471 Bacteria 2674
567 Ga0495684_0142930 3300047471 Bacteria 1793
568 Ga0495602_0043996 3300048088 Bacteria 4053
569 Ga0495614_0075048 3300048089 Bacteria 1461
570 Ga0496100_0093310 3300048903 Bacteria 2059
571 Ga0496104_0033468 3300048907 Bacteria 4788
572 Ga0496104_0050128 3300048907 Bacteria 3939
573 Ga0496107_0105367 3300048910 Bacteria 2070
574 Ga0496108_0205938 3300048911 Bacteria 1707
575 Ga0496109_0153910 3300048912 Bacteria 2154
576 Ga0496109_0181953 3300048912 Bacteria 1974
577 Ga0496109_0451567 3300048912 Bacteria 1214
578 Ga0496110_0256271 3300048913 Bacteria 1593
579 Ga0496112_0028047 3300048915 Bacteria 5431
580 Ga0496112_0188485 3300048915 Bacteria 2025
581 Ga0496112_0331156 3300048915 Bacteria 1466
582 Ga0496113_0048379 3300048916 Bacteria 3163
583 Ga0496113_0089794 3300048916 Bacteria 2366
584 Ga0501032_0081206 3300049569 Bacteria 2157
585 Ga0501037_0054563 3300049573 Bacteria 2923
586 Ga0501043_0012328 3300049579 Bacteria 6684
587 Ga0501047_0003790 3300049581 Bacteria 14231
588 Ga0501201_005583 3300049651 Unclassified 1179
589 Ga0501202_011881 3300049652 Bacteria 1636
590 Ga0501209_022180 3300049656 Bacteria 1520
591 Ga0501216_000507 3300049660 Bacteria 4631
592 Ga0501224_011773 3300049664 Unclassified 1287
593 Ga0501227_001814 3300049665 Bacteria 4732
594 Ga0501233_001266 3300049668 Bacteria 4311
595 Ga0501235_000951 3300049669 Bacteria 5973
596 Ga0501240_023143 3300049673 Unclassified 950
597 Ga0501243_002882 3300049675 Unclassified 2533
598 Ga0501250_013186 3300049680 Unclassified 988
599 Ga0501259_002588 3300049688 Bacteria 2919
600 Ga0501225_0008444 3300049705 Bacteria 2956
601 Ga0501234_002610 3300049707 Bacteria 2838
602 Ga0501232_027140 3300049757 Unclassified 775
603 Ga0501263_006353 3300049760 Unclassified 1362
604 Ga0501264_002675 3300049761 Bacteria 1643
605 Ga0501266_000428 3300049763 Bacteria 5580
606 Ga0501268_003987 3300049765 Unclassified 2057
607 Ga0501270_002989 3300049767 Unclassified 1787
608 Ga0501271_002764 3300049768 Unclassified 1588
609 Ga0501044_0095276 3300049823 Bacteria 3000
610 Ga0501044_0185691 3300049823 Bacteria 2044
611 Ga0501212_024949 3300049851 Unclassified 942
612 nmdc:mga08y16_51769_c1 3300050511 Bacteria 4296
613 nmdc:mga0rr50_433008_c1 3300050513 Bacteria 1113
614 nmdc:mga0a205_9732_c1 3300050515 Bacteria 8805
615 Ga0495601_0260664 3300053077 Bacteria 1132
616 Ga0495612_0032831 3300053078 Bacteria 2098

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046535 Ga0495586_0692949 Ga0495586_0692949_16_564 178
2 3300046689 Ga0495613_0615034 Ga0495613_0615034_147_695 178
3 3300026121 Ga0207683_10210900 Ga0207683_102109003 183
4 3300005336 Ga0070680_100020720 Ga0070680_1000207207 191
5 3300005530 Ga0070679_100061707 Ga0070679_1000617072 191
6 3300005547 Ga0070693_100001724 Ga0070693_1000017248 191
7 3300005456 Ga0070678_100223904 Ga0070678_1002239041 192
8 3300005615 Ga0070702_100219806 Ga0070702_1002198062 192
9 3300013297 Ga0157378_10017905 Ga0157378_100179053 192
10 3300026089 Ga0207648_10054836 Ga0207648_100548363 192
11 3300026121 Ga0207683_10098845 Ga0207683_100988455 192
12 3300047315 Ga0495581_0061004 Ga0495581_0061004_66_662 194
13 3300014326 Ga0157380_10101014 Ga0157380_101010142 197
14 3300025937 Ga0207669_10439254 Ga0207669_104392542 197
15 3300005334 Ga0068869_100539574 Ga0068869_1005395741 198
16 3300009098 Ga0105245_10070103 Ga0105245_100701032 198
17 3300025926 Ga0207659_10326210 Ga0207659_103262102 198
18 3300025927 Ga0207687_10049041 Ga0207687_100490415 198
19 3300005355 Ga0070671_100016066 Ga0070671_1000160663 199
20 3300005544 Ga0070686_100455048 Ga0070686_1004550482 199
21 3300012510 Ga0157316_1005936 Ga0157316_10059362 199
22 3300025938 Ga0207704_10515556 Ga0207704_105155561 199
23 3300001990 JGI24737J22298_10028029 JGI24737J22298_100280293 200
24 3300005327 Ga0070658_10022112 Ga0070658_100221125 200
25 3300005329 Ga0070683_100835170 Ga0070683_1008351701 200
26 3300005336 Ga0070680_100409236 Ga0070680_1004092362 200
27 3300005367 Ga0070667_100059416 Ga0070667_1000594161 200
28 3300005455 Ga0070663_100403621 Ga0070663_1004036212 200
29 3300005458 Ga0070681_10524503 Ga0070681_105245031 200
30 3300005459 Ga0068867_100005743 Ga0068867_1000057438 200
31 3300005535 Ga0070684_100136839 Ga0070684_1001368394 200
32 3300005539 Ga0068853_100317927 Ga0068853_1003179271 200
33 3300005543 Ga0070672_100083943 Ga0070672_1000839432 200
34 3300005564 Ga0070664_100026438 Ga0070664_1000264384 200
35 3300005564 Ga0070664_100759312 Ga0070664_1007593122 200
36 3300005719 Ga0068861_100252421 Ga0068861_1002524212 200
37 3300005834 Ga0068851_10040153 Ga0068851_100401533 200
38 3300006881 Ga0068865_100006993 Ga0068865_1000069935 200
39 3300009098 Ga0105245_11029221 Ga0105245_110292211 200
40 3300009148 Ga0105243_10160545 Ga0105243_101605452 200
41 3300009176 Ga0105242_10003515 Ga0105242_100035157 200
42 3300010375 Ga0105239_10376615 Ga0105239_103766152 200
43 3300013105 Ga0157369_10567122 Ga0157369_105671222 200
44 3300013307 Ga0157372_10279321 Ga0157372_102793212 200
45 3300013308 Ga0157375_10542597 Ga0157375_105425971 200
46 3300025904 Ga0207647_10139104 Ga0207647_101391042 200
47 3300025931 Ga0207644_10478627 Ga0207644_104786272 200
48 3300025934 Ga0207686_10053607 Ga0207686_100536072 200
49 3300025935 Ga0207709_10204320 Ga0207709_102043202 200
50 3300025940 Ga0207691_10010422 Ga0207691_100104222 200
51 3300025941 Ga0207711_10041700 Ga0207711_100417005 200
52 3300025944 Ga0207661_10033658 Ga0207661_100336582 200
53 3300025945 Ga0207679_10772483 Ga0207679_107724832 200
54 3300025972 Ga0207668_10031879 Ga0207668_100318792 200
55 3300026116 Ga0207674_10015817 Ga0207674_100158179 200
56 3300026118 Ga0207675_100290075 Ga0207675_1002900752 200
57 3300028381 Ga0268264_10194460 Ga0268264_101944602 200
58 3300045836 Ga0466958_0189269 Ga0466958_0189269_10_615 200
59 3300046684 Ga0495669_0194539 Ga0495669_0194539_146_838 200
60 3300048911 Ga0496108_0205938 Ga0496108_0205938_746_1438 200
61 3300048912 Ga0496109_0181953 Ga0496109_0181953_181_873 200
62 3300048915 Ga0496112_0331156 Ga0496112_0331156_53_745 200
63 3300048916 Ga0496113_0048379 Ga0496113_0048379_609_1301 200
64 3300005347 Ga0070668_100189791 Ga0070668_1001897912 201
65 3300005355 Ga0070671_100025904 Ga0070671_1000259045 201
66 3300005543 Ga0070672_100177964 Ga0070672_1001779642 201
67 3300005843 Ga0068860_100602908 Ga0068860_1006029082 201
68 3300006358 Ga0068871_100119934 Ga0068871_1001199343 201
69 3300013104 Ga0157370_10371493 Ga0157370_103714932 201
70 3300013306 Ga0163162_10270155 Ga0163162_102701552 201
71 3300025925 Ga0207650_10338339 Ga0207650_103383392 201
72 3300025927 Ga0207687_10580862 Ga0207687_105808622 201
73 3300025931 Ga0207644_10054987 Ga0207644_100549872 201
74 3300025933 Ga0207706_10038760 Ga0207706_100387604 201
75 3300025940 Ga0207691_10584936 Ga0207691_105849361 201
76 3300026023 Ga0207677_10097579 Ga0207677_100975792 201
77 3300048903 Ga0496100_0093310 Ga0496100_0093310_1234_1926 201
78 3300048910 Ga0496107_0105367 Ga0496107_0105367_1023_1715 201
79 3300048912 Ga0496109_0451567 Ga0496109_0451567_152_844 201
80 3300005455 Ga0070663_100000657 Ga0070663_10000065719 202
81 3300005530 Ga0070679_100480877 Ga0070679_1004808772 202
82 3300005535 Ga0070684_100021184 Ga0070684_1000211847 202
83 3300005616 Ga0068852_100043124 Ga0068852_1000431244 202
84 3300009093 Ga0105240_10038998 Ga0105240_100389984 202
85 3300009093 Ga0105240_10754736 Ga0105240_107547362 202
86 3300009551 Ga0105238_10037867 Ga0105238_100378674 202
87 3300013102 Ga0157371_10023342 Ga0157371_100233422 202
88 3300013104 Ga0157370_10034666 Ga0157370_100346662 202
89 3300013105 Ga0157369_10028815 Ga0157369_100288154 202
90 3300013105 Ga0157369_10057459 Ga0157369_100574592 202
91 3300013307 Ga0157372_10075622 Ga0157372_100756222 202
92 3300025909 Ga0207705_10055658 Ga0207705_100556584 202
93 3300025913 Ga0207695_10007203 Ga0207695_100072037 202
94 3300025920 Ga0207649_10230993 Ga0207649_102309931 202
95 3300025921 Ga0207652_10257931 Ga0207652_102579312 202
96 3300025924 Ga0207694_10073076 Ga0207694_100730761 202
97 3300025944 Ga0207661_10126579 Ga0207661_101265792 202
98 3300025949 Ga0207667_10007411 Ga0207667_100074119 202
99 3300025981 Ga0207640_10032284 Ga0207640_100322842 202
100 3300026067 Ga0207678_10000562 Ga0207678_1000056233 202
101 3300046663 Ga0495635_0422407 Ga0495635_0422407_88_780 202
102 3300046675 Ga0495657_0276685 Ga0495657_0276685_245_937 202
103 3300047444 Ga0495675_0040545 Ga0495675_0040545_878_1570 202
104 3300048907 Ga0496104_0033468 Ga0496104_0033468_1279_1971 202
105 3300048913 Ga0496110_0256271 Ga0496110_0256271_418_1110 202
106 3300013297 Ga0157378_10393404 Ga0157378_103934042 203
107 3300005331 Ga0070670_100165303 Ga0070670_1001653032 204
108 3300005354 Ga0070675_100739478 Ga0070675_1007394781 204
109 3300005366 Ga0070659_100292106 Ga0070659_1002921062 204
110 3300005564 Ga0070664_100223454 Ga0070664_1002234542 204
111 3300013308 Ga0157375_10013766 Ga0157375_1001376610 204
112 3300014325 Ga0163163_10535446 Ga0163163_105354462 204
113 3300025893 Ga0207682_10005041 Ga0207682_100050412 204
114 3300025923 Ga0207681_10361744 Ga0207681_103617442 204
115 3300025926 Ga0207659_10175182 Ga0207659_101751823 204
116 3300025940 Ga0207691_10255244 Ga0207691_102552442 204
117 3300026075 Ga0207708_10327159 Ga0207708_103271592 204
118 3300026089 Ga0207648_10231897 Ga0207648_102318972 204
119 3300026095 Ga0207676_10534513 Ga0207676_105345132 204
120 3300047320 Ga0495672_0010420 Ga0495672_0010420_3234_3866 204
121 3300005329 Ga0070683_100000588 Ga0070683_10000058824 206
122 3300005329 Ga0070683_100006454 Ga0070683_1000064547 206
123 3300005329 Ga0070683_100038843 Ga0070683_1000388436 206
124 3300005329 Ga0070683_100088528 Ga0070683_1000885283 206
125 3300005329 Ga0070683_100349132 Ga0070683_1003491322 206
126 3300005329 Ga0070683_100563781 Ga0070683_1005637812 206
127 3300005330 Ga0070690_100041687 Ga0070690_1000416872 206
128 3300005336 Ga0070680_100000489 Ga0070680_10000048923 206
129 3300005338 Ga0068868_100564684 Ga0068868_1005646841 206
130 3300005340 Ga0070689_100043551 Ga0070689_1000435513 206
131 3300005343 Ga0070687_100022298 Ga0070687_1000222983 206
132 3300005347 Ga0070668_100107142 Ga0070668_1001071421 206
133 3300005353 Ga0070669_100173467 Ga0070669_1001734671 206
134 3300005354 Ga0070675_100032135 Ga0070675_1000321353 206
135 3300005355 Ga0070671_100271195 Ga0070671_1002711952 206
136 3300005364 Ga0070673_100059989 Ga0070673_1000599895 206
137 3300005367 Ga0070667_100121474 Ga0070667_1001214742 206
138 3300005434 Ga0070709_10017799 Ga0070709_100177992 206
139 3300005436 Ga0070713_100004812 Ga0070713_1000048127 206
140 3300005439 Ga0070711_100039252 Ga0070711_1000392522 206
141 3300005445 Ga0070708_100000038 Ga0070708_10000003832 206
142 3300005456 Ga0070678_100659745 Ga0070678_1006597452 206
143 3300005458 Ga0070681_10249922 Ga0070681_102499221 206
144 3300005466 Ga0070685_10147704 Ga0070685_101477042 206
145 3300005467 Ga0070706_100170498 Ga0070706_1001704982 206
146 3300005471 Ga0070698_100010089 Ga0070698_1000100896 206
147 3300005535 Ga0070684_100035542 Ga0070684_1000355422 206
148 3300005535 Ga0070684_100066524 Ga0070684_1000665246 206
149 3300005535 Ga0070684_100130366 Ga0070684_1001303662 206
150 3300005535 Ga0070684_100130803 Ga0070684_1001308033 206
151 3300005543 Ga0070672_100036869 Ga0070672_1000368691 206
152 3300005544 Ga0070686_100077205 Ga0070686_1000772052 206
153 3300005546 Ga0070696_100003340 Ga0070696_1000033406 206
154 3300005548 Ga0070665_100089358 Ga0070665_1000893583 206
155 3300005563 Ga0068855_100029666 Ga0068855_1000296669 206
156 3300005564 Ga0070664_100219014 Ga0070664_1002190142 206
157 3300005564 Ga0070664_100478304 Ga0070664_1004783041 206
158 3300005614 Ga0068856_100010080 Ga0068856_10001008011 206
159 3300005615 Ga0070702_100196560 Ga0070702_1001965602 206
160 3300005617 Ga0068859_100051195 Ga0068859_1000511952 206
161 3300005617 Ga0068859_100135973 Ga0068859_1001359732 206
162 3300005618 Ga0068864_100323383 Ga0068864_1003233832 206
163 3300005618 Ga0068864_100441775 Ga0068864_1004417752 206
164 3300005718 Ga0068866_10096017 Ga0068866_100960172 206
165 3300005719 Ga0068861_100637188 Ga0068861_1006371882 206
166 3300005840 Ga0068870_10308709 Ga0068870_103087092 206
167 3300005841 Ga0068863_100634106 Ga0068863_1006341062 206
168 3300005842 Ga0068858_100290965 Ga0068858_1002909652 206
169 3300005843 Ga0068860_100662927 Ga0068860_1006629272 206
170 3300005844 Ga0068862_100044188 Ga0068862_1000441884 206
171 3300006175 Ga0070712_100288105 Ga0070712_1002881051 206
172 3300006175 Ga0070712_100496929 Ga0070712_1004969292 206
173 3300006358 Ga0068871_100338775 Ga0068871_1003387752 206
174 3300006931 Ga0097620_100051195 Ga0097620_1000511952 206
175 3300006931 Ga0097620_100135973 Ga0097620_1001359732 206
176 3300009094 Ga0111539_11256563 Ga0111539_112565631 206
177 3300009148 Ga0105243_10242652 Ga0105243_102426522 206
178 3300009148 Ga0105243_10313800 Ga0105243_103138002 206
179 3300009148 Ga0105243_10917581 Ga0105243_109175811 206
180 3300009176 Ga0105242_10269899 Ga0105242_102698991 206
181 3300009177 Ga0105248_10046791 Ga0105248_100467914 206
182 3300009177 Ga0105248_10193270 Ga0105248_101932702 206
183 3300009551 Ga0105238_10114565 Ga0105238_101145653 206
184 3300009553 Ga0105249_10047289 Ga0105249_100472894 206
185 3300013104 Ga0157370_10012699 Ga0157370_100126995 206
186 3300013104 Ga0157370_10050158 Ga0157370_100501582 206
187 3300013105 Ga0157369_10019497 Ga0157369_100194979 206
188 3300013297 Ga0157378_10357593 Ga0157378_103575932 206
189 3300013307 Ga0157372_10003116 Ga0157372_1000311616 206
190 3300013307 Ga0157372_10048350 Ga0157372_100483503 206
191 3300013307 Ga0157372_10955000 Ga0157372_109550002 206
192 3300013308 Ga0157375_10011285 Ga0157375_100112856 206
193 3300013308 Ga0157375_10021058 Ga0157375_100210587 206
194 3300014968 Ga0157379_10527192 Ga0157379_105271922 206
195 3300014969 Ga0157376_10868371 Ga0157376_108683712 206
196 3300025898 Ga0207692_10246697 Ga0207692_102466971 206
197 3300025906 Ga0207699_10031482 Ga0207699_100314822 206
198 3300025907 Ga0207645_10090050 Ga0207645_100900502 206
199 3300025910 Ga0207684_10415187 Ga0207684_104151872 206
200 3300025912 Ga0207707_10439668 Ga0207707_104396682 206
201 3300025913 Ga0207695_10013093 Ga0207695_100130933 206
202 3300025915 Ga0207693_10054509 Ga0207693_100545095 206
203 3300025917 Ga0207660_10000027 Ga0207660_1000002722 206
204 3300025918 Ga0207662_10018268 Ga0207662_100182683 206
205 3300025923 Ga0207681_10123011 Ga0207681_101230112 206
206 3300025924 Ga0207694_10011414 Ga0207694_100114144 206
207 3300025926 Ga0207659_10155715 Ga0207659_101557152 206
208 3300025926 Ga0207659_10235769 Ga0207659_102357692 206
209 3300025928 Ga0207700_10149008 Ga0207700_101490082 206
210 3300025934 Ga0207686_10219486 Ga0207686_102194862 206
211 3300025934 Ga0207686_10556820 Ga0207686_105568202 206
212 3300025935 Ga0207709_10118788 Ga0207709_101187882 206
213 3300025935 Ga0207709_10170685 Ga0207709_101706852 206
214 3300025936 Ga0207670_10058608 Ga0207670_100586084 206
215 3300025941 Ga0207711_10124903 Ga0207711_101249032 206
216 3300025941 Ga0207711_10406991 Ga0207711_104069911 206
217 3300025944 Ga0207661_10034615 Ga0207661_100346154 206
218 3300025944 Ga0207661_10068159 Ga0207661_100681593 206
219 3300025944 Ga0207661_10243819 Ga0207661_102438192 206
220 3300025944 Ga0207661_10292498 Ga0207661_102924982 206
221 3300025944 Ga0207661_10353120 Ga0207661_103531202 206
222 3300025960 Ga0207651_10154936 Ga0207651_101549363 206
223 3300025961 Ga0207712_10026939 Ga0207712_100269393 206
224 3300025972 Ga0207668_10056201 Ga0207668_100562015 206
225 3300025972 Ga0207668_10927067 Ga0207668_109270672 206
226 3300025986 Ga0207658_10089066 Ga0207658_100890663 206
227 3300026078 Ga0207702_10218910 Ga0207702_102189102 206
228 3300026078 Ga0207702_10252157 Ga0207702_102521571 206
229 3300026089 Ga0207648_10014800 Ga0207648_100148007 206
230 3300026095 Ga0207676_10385278 Ga0207676_103852782 206
231 3300026116 Ga0207674_10169610 Ga0207674_101696102 206
232 3300026116 Ga0207674_10396296 Ga0207674_103962961 206
233 3300026121 Ga0207683_10065581 Ga0207683_100655814 206
234 3300028380 Ga0268265_10020036 Ga0268265_100200366 206
235 3300028381 Ga0268264_10376366 Ga0268264_103763662 206
236 3300032126 Ga0307415_100105899 Ga0307415_1001058992 206
237 3300035113 Ga0373936_0065852 Ga0373936_0065852_531_1163 206
238 3300035118 Ga0373954_0060524 Ga0373954_0060524_655_1287 206
239 3300035119 Ga0373956_0031930 Ga0373956_0031930_1615_2247 206
240 3300035119 Ga0373956_0057645 Ga0373956_0057645_12_644 206
241 3300035119 Ga0373956_0235683 Ga0373956_0235683_114_746 206
242 3300035120 Ga0373957_0074667 Ga0373957_0074667_134_766 206
243 3300035120 Ga0373957_0123320 Ga0373957_0123320_69_701 206
244 3300035170 Ga0373943_0190096 Ga0373943_0190096_312_944 206
245 3300035172 Ga0373955_0162463 Ga0373955_0162463_304_936 206
246 3300035695 Ga0373927_0015471 Ga0373927_0015471_402_1034 206
247 3300035725 Ga0373947_0020600 Ga0373947_0020600_3109_3741 206
248 3300035725 Ga0373947_0156653 Ga0373947_0156653_15_647 206
249 3300036401 Ga0373937_0004555 Ga0373937_0004555_10677_11309 206
250 3300036401 Ga0373937_0103166 Ga0373937_0103166_1290_1922 206
251 3300037068 Ga0373925_0047451 Ga0373925_0047451_284_916 206
252 3300037068 Ga0373925_0824896 Ga0373925_0824896_50_682 206
253 3300045976 Ga0466967_0069433 Ga0466967_0069433_2072_2788 206
254 3300046455 Ga0495603_0220631 Ga0495603_0220631_327_959 206
255 3300046459 Ga0495629_0004819 Ga0495629_0004819_3858_4490 206
256 3300046459 Ga0495629_0088832 Ga0495629_0088832_83_715 206
257 3300046459 Ga0495629_0121697 Ga0495629_0121697_1135_1767 206
258 3300046462 Ga0495651_0104696 Ga0495651_0104696_688_1320 206
259 3300046462 Ga0495651_0268724 Ga0495651_0268724_126_758 206
260 3300046463 Ga0495653_0030536 Ga0495653_0030536_3425_4057 206
261 3300046463 Ga0495653_0332604 Ga0495653_0332604_40_672 206
262 3300046472 Ga0495580_0012607 Ga0495580_0012607_1455_2087 206
263 3300046472 Ga0495580_0121597 Ga0495580_0121597_739_1371 206
264 3300046472 Ga0495580_0366729 Ga0495580_0366729_83_715 206
265 3300046473 Ga0495582_0008245 Ga0495582_0008245_4679_5311 206
266 3300046473 Ga0495582_0026893 Ga0495582_0026893_2466_3098 206
267 3300046477 Ga0495664_0044737 Ga0495664_0044737_1528_2160 206
268 3300046477 Ga0495664_0091613 Ga0495664_0091613_865_1497 206
269 3300046499 Ga0495594_0018810 Ga0495594_0018810_2681_3313 206
270 3300046511 Ga0495608_0021338 Ga0495608_0021338_2358_2990 206
271 3300046514 Ga0495618_0012828 Ga0495618_0012828_3346_3978 206
272 3300046516 Ga0495628_0026155 Ga0495628_0026155_1749_2381 206
273 3300046517 Ga0495630_0009308 Ga0495630_0009308_5186_5818 206
274 3300046517 Ga0495630_0049865 Ga0495630_0049865_80_712 206
275 3300046526 Ga0495666_0027256 Ga0495666_0027256_1182_1814 206
276 3300046529 Ga0495652_0018708 Ga0495652_0018708_5378_6010 206
277 3300046529 Ga0495652_0259875 Ga0495652_0259875_599_1231 206
278 3300046531 Ga0495665_0004906 Ga0495665_0004906_4343_4975 206
279 3300046531 Ga0495665_0049891 Ga0495665_0049891_842_1474 206
280 3300046531 Ga0495665_0106417 Ga0495665_0106417_633_1265 206
281 3300046533 Ga0495640_0043573 Ga0495640_0043573_1066_1698 206
282 3300046533 Ga0495640_0355819 Ga0495640_0355819_241_873 206
283 3300046535 Ga0495586_0045397 Ga0495586_0045397_1557_2189 206
284 3300046535 Ga0495586_0050098 Ga0495586_0050098_1452_2084 206
285 3300046536 Ga0495587_0010256 Ga0495587_0010256_2956_3588 206
286 3300046536 Ga0495587_0076668 Ga0495587_0076668_1117_1749 206
287 3300046543 Ga0495645_0007759 Ga0495645_0007759_3032_3664 206
288 3300046543 Ga0495645_0119225 Ga0495645_0119225_1101_1733 206
289 3300046559 Ga0495667_0005908 Ga0495667_0005908_5973_6605 206
290 3300046559 Ga0495667_0025081 Ga0495667_0025081_820_1452 206
291 3300046663 Ga0495635_0425831 Ga0495635_0425831_49_681 206
292 3300046678 Ga0495599_0000646 Ga0495599_0000646_9922_10554 206
293 3300046678 Ga0495599_0025164 Ga0495599_0025164_832_1464 206
294 3300046679 Ga0495623_0029027 Ga0495623_0029027_2474_3106 206
295 3300046680 Ga0495646_0106855 Ga0495646_0106855_478_1110 206
296 3300046683 Ga0495658_0013031 Ga0495658_0013031_3343_3975 206
297 3300046683 Ga0495658_0077588 Ga0495658_0077588_218_850 206
298 3300046683 Ga0495658_0258580 Ga0495658_0258580_62_694 206
299 3300046683 Ga0495658_0483505 Ga0495658_0483505_35_664 206
300 3300046689 Ga0495613_0185861 Ga0495613_0185861_185_817 206
301 3300047315 Ga0495581_0118704 Ga0495581_0118704_614_1246 206
302 3300047317 Ga0495604_0006036 Ga0495604_0006036_38_670 206
303 3300047319 Ga0495674_0176865 Ga0495674_0176865_1081_1713 206
304 3300047319 Ga0495674_0177748 Ga0495674_0177748_188_820 206
305 3300047319 Ga0495674_0497634 Ga0495674_0497634_36_668 206
306 3300047444 Ga0495675_0004413 Ga0495675_0004413_7861_8493 206
307 3300047444 Ga0495675_0061497 Ga0495675_0061497_1140_1772 206
308 3300047444 Ga0495675_0293117 Ga0495675_0293117_247_879 206
309 3300047471 Ga0495684_0069647 Ga0495684_0069647_935_1567 206
310 3300047471 Ga0495684_0142930 Ga0495684_0142930_1132_1764 206
311 3300048088 Ga0495602_0043996 Ga0495602_0043996_2855_3487 206
312 3300048089 Ga0495614_0075048 Ga0495614_0075048_394_1026 206
313 3300048907 Ga0496104_0050128 Ga0496104_0050128_2662_3294 206
314 3300050513 nmdc:mga0rr50_433008_c1 nmdc:mga0rr50_433008_c1_181_813 206
315 3300053077 Ga0495601_0260664 Ga0495601_0260664_45_677 206
316 3300053078 Ga0495612_0032831 Ga0495612_0032831_392_1024 206
317 3300041512 Ga0451853_3891242 Ga0451853_3891242_496_1167 210
318 3300005434 Ga0070709_10109269 Ga0070709_101092692 211
319 3300005458 Ga0070681_10042879 Ga0070681_100428793 211
320 3300005530 Ga0070679_100075909 Ga0070679_1000759093 211
321 3300005535 Ga0070684_100527022 Ga0070684_1005270221 211
322 3300005546 Ga0070696_100199997 Ga0070696_1001999972 211
323 3300009093 Ga0105240_10003398 Ga0105240_100033983 211
324 3300009093 Ga0105240_10056687 Ga0105240_100566874 211
325 3300009093 Ga0105240_10210645 Ga0105240_102106452 211
326 3300013100 Ga0157373_10034536 Ga0157373_100345366 211
327 3300013105 Ga0157369_10042377 Ga0157369_100423773 211
328 3300013307 Ga0157372_10029216 Ga0157372_100292167 211
329 3300013307 Ga0157372_10044752 Ga0157372_100447526 211
330 3300014497 Ga0182008_10212748 Ga0182008_102127482 211
331 3300025913 Ga0207695_10023163 Ga0207695_100231637 211
332 3300025913 Ga0207695_10105862 Ga0207695_101058623 211
333 3300026078 Ga0207702_10433193 Ga0207702_104331932 211
334 3300049823 Ga0501044_0095276 Ga0501044_0095276_791_1453 211
335 3300005329 Ga0070683_100052156 Ga0070683_1000521564 212
336 3300005336 Ga0070680_100200121 Ga0070680_1002001212 212
337 3300005337 Ga0070682_100091994 Ga0070682_1000919943 212
338 3300005341 Ga0070691_10118175 Ga0070691_101181752 212
339 3300005344 Ga0070661_100021690 Ga0070661_1000216907 212
340 3300005458 Ga0070681_10003610 Ga0070681_1000361011 212
341 3300005458 Ga0070681_10364929 Ga0070681_103649291 212
342 3300005518 Ga0070699_100007723 Ga0070699_10000772310 212
343 3300005530 Ga0070679_100143239 Ga0070679_1001432392 212
344 3300005530 Ga0070679_100463033 Ga0070679_1004630332 212
345 3300005546 Ga0070696_100012630 Ga0070696_1000126306 212
346 3300005563 Ga0068855_100121690 Ga0068855_1001216903 212
347 3300005578 Ga0068854_100005726 Ga0068854_1000057267 212
348 3300005616 Ga0068852_100085174 Ga0068852_1000851743 212
349 3300009093 Ga0105240_10001901 Ga0105240_1000190111 212
350 3300013100 Ga0157373_10000902 Ga0157373_1000090220 212
351 3300013104 Ga0157370_10197619 Ga0157370_101976192 212
352 3300013307 Ga0157372_10009434 Ga0157372_100094346 212
353 3300013307 Ga0157372_10028273 Ga0157372_100282736 212
354 3300025912 Ga0207707_10002797 Ga0207707_100027976 212
355 3300025912 Ga0207707_10005608 Ga0207707_100056089 212
356 3300025913 Ga0207695_10001210 Ga0207695_1000121027 212
357 3300025913 Ga0207695_10006853 Ga0207695_100068532 212
358 3300025917 Ga0207660_10002473 Ga0207660_100024738 212
359 3300025917 Ga0207660_10057385 Ga0207660_100573852 212
360 3300025919 Ga0207657_10184335 Ga0207657_101843352 212
361 3300025920 Ga0207649_10013241 Ga0207649_100132414 212
362 3300025921 Ga0207652_10000336 Ga0207652_1000033627 212
363 3300025921 Ga0207652_10035727 Ga0207652_100357274 212
364 3300025944 Ga0207661_10002202 Ga0207661_100022028 212
365 3300025944 Ga0207661_10010100 Ga0207661_100101007 212
366 3300025981 Ga0207640_10002009 Ga0207640_100020098 212
367 3300026142 Ga0207698_10274689 Ga0207698_102746892 212
368 3300005353 Ga0070669_100069804 Ga0070669_1000698043 213
369 3300005459 Ga0068867_100127351 Ga0068867_1001273512 213
370 3300005718 Ga0068866_10071650 Ga0068866_100716502 213
371 3300025923 Ga0207681_10495074 Ga0207681_104950742 213
372 3300005328 Ga0070676_10019953 Ga0070676_100199532 214
373 3300005330 Ga0070690_100068051 Ga0070690_1000680512 214
374 3300005356 Ga0070674_100061989 Ga0070674_1000619893 214
375 3300005441 Ga0070700_100008003 Ga0070700_1000080035 214
376 3300005457 Ga0070662_100006003 Ga0070662_1000060034 214
377 3300005467 Ga0070706_100050717 Ga0070706_1000507173 214
378 3300005471 Ga0070698_100021929 Ga0070698_1000219297 214
379 3300005536 Ga0070697_100758748 Ga0070697_1007587481 214
380 3300005544 Ga0070686_100014767 Ga0070686_1000147674 214
381 3300005843 Ga0068860_100210819 Ga0068860_1002108192 214
382 3300006881 Ga0068865_100073262 Ga0068865_1000732622 214
383 3300009098 Ga0105245_10164684 Ga0105245_101646842 214
384 3300013297 Ga0157378_10014701 Ga0157378_100147016 214
385 3300025899 Ga0207642_10005679 Ga0207642_100056792 214
386 3300025907 Ga0207645_10010773 Ga0207645_100107732 214
387 3300025918 Ga0207662_10014059 Ga0207662_100140592 214
388 3300025922 Ga0207646_10266829 Ga0207646_102668292 214
389 3300025933 Ga0207706_10001172 Ga0207706_100011722 214
390 3300026075 Ga0207708_10049905 Ga0207708_100499055 214
391 3300026089 Ga0207648_10154382 Ga0207648_101543822 214
392 3300005329 Ga0070683_100063261 Ga0070683_1000632613 215
393 3300005330 Ga0070690_100215801 Ga0070690_1002158012 215
394 3300005336 Ga0070680_100000354 Ga0070680_1000003547 215
395 3300005337 Ga0070682_100000492 Ga0070682_1000004926 215
396 3300005345 Ga0070692_10014399 Ga0070692_100143992 215
397 3300005364 Ga0070673_100032682 Ga0070673_1000326822 215
398 3300005458 Ga0070681_10273188 Ga0070681_102731881 215
399 3300005518 Ga0070699_100241147 Ga0070699_1002411472 215
400 3300005530 Ga0070679_100000377 Ga0070679_10000037728 215
401 3300005536 Ga0070697_100059204 Ga0070697_1000592043 215
402 3300005539 Ga0068853_100035824 Ga0068853_1000358243 215
403 3300005563 Ga0068855_100189635 Ga0068855_1001896352 215
404 3300009147 Ga0114129_10186370 Ga0114129_101863704 215
405 3300013296 Ga0157374_10073752 Ga0157374_100737522 215
406 3300025912 Ga0207707_10002464 Ga0207707_1000246411 215
407 3300025917 Ga0207660_10014362 Ga0207660_100143627 215
408 3300025921 Ga0207652_10076188 Ga0207652_100761882 215
409 3300025941 Ga0207711_10118302 Ga0207711_101183022 215
410 3300025949 Ga0207667_10176585 Ga0207667_101765852 215
411 3300046674 Ga0495588_0011470 Ga0495588_0011470_1769_2440 215
412 3300048915 Ga0496112_0188485 Ga0496112_0188485_393_1064 215
413 2162886012 MBSR1b_contig_545708 MBSR1b_0282.00005150 217
414 3300005293 Ga0065715_10094902 Ga0065715_100949025 217
415 3300005445 Ga0070708_100000557 Ga0070708_1000005572 217
416 3300005445 Ga0070708_100116120 Ga0070708_1001161202 217
417 3300005468 Ga0070707_100017092 Ga0070707_1000170926 217
418 3300005518 Ga0070699_100796857 Ga0070699_1007968571 217
419 3300005536 Ga0070697_100202703 Ga0070697_1002027032 217
420 3300006852 Ga0075433_10007884 Ga0075433_100078849 217
421 3300006871 Ga0075434_100028012 Ga0075434_1000280129 217
422 3300006914 Ga0075436_100225073 Ga0075436_1002250732 217
423 3300009174 Ga0105241_10276886 Ga0105241_102768861 217
424 3300025914 Ga0207671_10026872 Ga0207671_100268722 217
425 3300034816 Ga0373930_0043548 Ga0373930_0043548_145_822 217
426 3300034820 Ga0373959_0020063 Ga0373959_0020063_454_1131 217
427 3300035114 Ga0373939_0106399 Ga0373939_0106399_204_881 217
428 3300038996 Ga0242420_006728 Ga0242420_006728_989_1666 217
429 3300048915 Ga0496112_0028047 Ga0496112_0028047_3758_4435 217
430 3300048916 Ga0496113_0089794 Ga0496113_0089794_620_1297 217
431 3300050515 nmdc:mga0a205_9732_c1 nmdc:mga0a205_9732_c1_3282_3959 217
432 3300025909 Ga0207705_10257492 Ga0207705_102574922 221
433 3300000549 LJQas_1008542 LJQas_10085422 222
434 3300005293 Ga0065715_10296232 Ga0065715_102962322 222
435 3300005327 Ga0070658_10002218 Ga0070658_100022187 222
436 3300005327 Ga0070658_10015518 Ga0070658_100155182 222
437 3300005327 Ga0070658_10176763 Ga0070658_101767632 222
438 3300005327 Ga0070658_10316322 Ga0070658_103163222 222
439 3300005327 Ga0070658_10392659 Ga0070658_103926592 222
440 3300005327 Ga0070658_10519911 Ga0070658_105199112 222
441 3300005328 Ga0070676_10015406 Ga0070676_100154063 222
442 3300005329 Ga0070683_100094528 Ga0070683_1000945283 222
443 3300005329 Ga0070683_100136769 Ga0070683_1001367692 222
444 3300005334 Ga0068869_100387468 Ga0068869_1003874681 222
445 3300005335 Ga0070666_10214304 Ga0070666_102143042 222
446 3300005336 Ga0070680_100078840 Ga0070680_1000788403 222
447 3300005339 Ga0070660_100009663 Ga0070660_1000096635 222
448 3300005340 Ga0070689_100023872 Ga0070689_1000238722 222
449 3300005343 Ga0070687_100123057 Ga0070687_1001230572 222
450 3300005344 Ga0070661_100052197 Ga0070661_1000521972 222
451 3300005344 Ga0070661_100309970 Ga0070661_1003099702 222
452 3300005344 Ga0070661_100310497 Ga0070661_1003104972 222
453 3300005353 Ga0070669_100044637 Ga0070669_1000446374 222
454 3300005354 Ga0070675_100130588 Ga0070675_1001305882 222
455 3300005364 Ga0070673_100024766 Ga0070673_1000247662 222
456 3300005364 Ga0070673_100181023 Ga0070673_1001810232 222
457 3300005365 Ga0070688_100005659 Ga0070688_1000056592 222
458 3300005366 Ga0070659_100025729 Ga0070659_1000257292 222
459 3300005435 Ga0070714_100001803 Ga0070714_1000018036 222
460 3300005437 Ga0070710_10076722 Ga0070710_100767222 222
461 3300005439 Ga0070711_100651224 Ga0070711_1006512242 222
462 3300005457 Ga0070662_100682475 Ga0070662_1006824751 222
463 3300005466 Ga0070685_10010783 Ga0070685_100107832 222
464 3300005518 Ga0070699_100251550 Ga0070699_1002515502 222
465 3300005530 Ga0070679_100224971 Ga0070679_1002249712 222
466 3300005530 Ga0070679_100422142 Ga0070679_1004221423 222
467 3300005535 Ga0070684_100110796 Ga0070684_1001107963 222
468 3300005535 Ga0070684_100156666 Ga0070684_1001566662 222
469 3300005539 Ga0068853_100049978 Ga0068853_1000499784 222
470 3300005543 Ga0070672_100267632 Ga0070672_1002676322 222
471 3300005563 Ga0068855_100054011 Ga0068855_1000540114 222
472 3300005564 Ga0070664_100035049 Ga0070664_1000350493 222
473 3300005564 Ga0070664_100209682 Ga0070664_1002096822 222
474 3300005577 Ga0068857_100027095 Ga0068857_1000270957 222
475 3300005616 Ga0068852_100005268 Ga0068852_1000052687 222
476 3300005616 Ga0068852_100101700 Ga0068852_1001017002 222
477 3300005617 Ga0068859_100059676 Ga0068859_1000596762 222
478 3300005719 Ga0068861_100034167 Ga0068861_1000341672 222
479 3300005840 Ga0068870_10003341 Ga0068870_100033416 222
480 3300006931 Ga0097620_100059675 Ga0097620_1000596752 222
481 3300009094 Ga0111539_10035036 Ga0111539_100350362 222
482 3300013100 Ga0157373_10105675 Ga0157373_101056752 222
483 3300013102 Ga0157371_10248033 Ga0157371_102480332 222
484 3300013105 Ga0157369_10006735 Ga0157369_100067358 222
485 3300013105 Ga0157369_10276582 Ga0157369_102765822 222
486 3300013307 Ga0157372_10001161 Ga0157372_1000116124 222
487 3300013307 Ga0157372_10029467 Ga0157372_100294672 222
488 3300013307 Ga0157372_10186834 Ga0157372_101868343 222
489 3300013307 Ga0157372_10560779 Ga0157372_105607792 222
490 3300013308 Ga0157375_10031948 Ga0157375_100319487 222
491 3300014745 Ga0157377_10061235 Ga0157377_100612352 222
492 3300025315 Ga0207697_10016206 Ga0207697_100162065 222
493 3300025898 Ga0207692_10159209 Ga0207692_101592092 222
494 3300025901 Ga0207688_10079061 Ga0207688_100790612 222
495 3300025903 Ga0207680_10202188 Ga0207680_102021881 222
496 3300025908 Ga0207643_10041580 Ga0207643_100415802 222
497 3300025909 Ga0207705_10005895 Ga0207705_100058958 222
498 3300025909 Ga0207705_10036993 Ga0207705_100369933 222
499 3300025909 Ga0207705_10103290 Ga0207705_101032903 222
500 3300025909 Ga0207705_10248380 Ga0207705_102483802 222
501 3300025909 Ga0207705_10371210 Ga0207705_103712101 222
502 3300025909 Ga0207705_10681323 Ga0207705_106813231 222
503 3300025918 Ga0207662_10011048 Ga0207662_100110482 222
504 3300025919 Ga0207657_10001987 Ga0207657_1000198720 222
505 3300025919 Ga0207657_10159653 Ga0207657_101596531 222
506 3300025920 Ga0207649_10069112 Ga0207649_100691122 222
507 3300025920 Ga0207649_10156190 Ga0207649_101561902 222
508 3300025921 Ga0207652_10209346 Ga0207652_102093462 222
509 3300025921 Ga0207652_10391075 Ga0207652_103910751 222
510 3300025923 Ga0207681_10018728 Ga0207681_100187283 222
511 3300025926 Ga0207659_10037533 Ga0207659_100375332 222
512 3300025928 Ga0207700_10237857 Ga0207700_102378572 222
513 3300025929 Ga0207664_10027237 Ga0207664_100272374 222
514 3300025932 Ga0207690_10135233 Ga0207690_101352332 222
515 3300025936 Ga0207670_10024466 Ga0207670_100244662 222
516 3300025940 Ga0207691_10027451 Ga0207691_100274517 222
517 3300025940 Ga0207691_10240106 Ga0207691_102401062 222
518 3300025940 Ga0207691_10268403 Ga0207691_102684032 222
519 3300025942 Ga0207689_10045028 Ga0207689_100450287 222
520 3300025944 Ga0207661_10036045 Ga0207661_100360454 222
521 3300025945 Ga0207679_10138519 Ga0207679_101385192 222
522 3300025945 Ga0207679_10501347 Ga0207679_105013472 222
523 3300025949 Ga0207667_10222990 Ga0207667_102229902 222
524 3300025960 Ga0207651_10313173 Ga0207651_103131731 222
525 3300025960 Ga0207651_10491610 Ga0207651_104916102 222
526 3300025972 Ga0207668_10088226 Ga0207668_100882262 222
527 3300025986 Ga0207658_10275557 Ga0207658_102755572 222
528 3300026041 Ga0207639_10037588 Ga0207639_100375884 222
529 3300026116 Ga0207674_10033328 Ga0207674_100333287 222
530 3300028380 Ga0268265_10295034 Ga0268265_102950342 222
531 3300031995 Ga0307409_100300426 Ga0307409_1003004262 222
532 3300032005 Ga0307411_10148556 Ga0307411_101485562 222
533 3300032126 Ga0307415_100438567 Ga0307415_1004385671 222
534 3300048912 Ga0496109_0153910 Ga0496109_0153910_139_831 222
535 3300049569 Ga0501032_0081206 Ga0501032_0081206_1200_1889 222
536 3300049573 Ga0501037_0054563 Ga0501037_0054563_508_1197 222
537 3300049579 Ga0501043_0012328 Ga0501043_0012328_1556_2245 222
538 3300049581 Ga0501047_0003790 Ga0501047_0003790_10558_11247 222
539 3300049823 Ga0501044_0185691 Ga0501044_0185691_746_1435 222
540 3300050511 nmdc:mga08y16_51769_c1 nmdc:mga08y16_51769_c1_2909_3601 222
541 2162886012 MBSR1b_contig_10986866 MBSR1b_0022.00002660 223
542 3300005293 Ga0065715_10095089 Ga0065715_100950894 223
543 3300005293 Ga0065715_10252904 Ga0065715_102529042 223
544 3300005328 Ga0070676_10241265 Ga0070676_102412652 223
545 3300005329 Ga0070683_100009728 Ga0070683_1000097285 223
546 3300005336 Ga0070680_100091843 Ga0070680_1000918431 223
547 3300005337 Ga0070682_100008751 Ga0070682_1000087514 223
548 3300005434 Ga0070709_10039769 Ga0070709_100397693 223
549 3300005444 Ga0070694_100009796 Ga0070694_1000097962 223
550 3300005444 Ga0070694_100117332 Ga0070694_1001173321 223
551 3300005458 Ga0070681_10545691 Ga0070681_105456911 223
552 3300005468 Ga0070707_100024874 Ga0070707_1000248743 223
553 3300005471 Ga0070698_100009782 Ga0070698_1000097822 223
554 3300005518 Ga0070699_100149293 Ga0070699_1001492934 223
555 3300005535 Ga0070684_100041085 Ga0070684_1000410853 223
556 3300005545 Ga0070695_100007270 Ga0070695_1000072706 223
557 3300005563 Ga0068855_100007038 Ga0068855_1000070385 223
558 3300009098 Ga0105245_10048971 Ga0105245_100489711 223
559 3300009545 Ga0105237_10007185 Ga0105237_100071852 223
560 3300013102 Ga0157371_10064836 Ga0157371_100648362 223
561 3300013104 Ga0157370_10481097 Ga0157370_104810972 223
562 3300013105 Ga0157369_10079689 Ga0157369_100796894 223
563 3300013105 Ga0157369_10524047 Ga0157369_105240472 223
564 3300013307 Ga0157372_10006551 Ga0157372_100065513 223
565 3300025907 Ga0207645_10192353 Ga0207645_101923532 223
566 3300025912 Ga0207707_10552243 Ga0207707_105522431 223
567 3300025917 Ga0207660_10384875 Ga0207660_103848752 223
568 3300025917 Ga0207660_10480972 Ga0207660_104809721 223
569 3300025919 Ga0207657_10041492 Ga0207657_100414922 223
570 3300025921 Ga0207652_10564579 Ga0207652_105645792 223
571 3300025929 Ga0207664_10048992 Ga0207664_100489924 223
572 3300025944 Ga0207661_10002811 Ga0207661_100028119 223
573 3300025944 Ga0207661_10512402 Ga0207661_105124022 223
574 3300027543 Ga0209999_1002000 Ga0209999_10020002 223
575 3300027717 Ga0209998_10000291 Ga0209998_1000029113 223
576 3300031548 Ga0307408_100181520 Ga0307408_1001815202 223
577 3300031731 Ga0307405_10015762 Ga0307405_100157625 223
578 3300031731 Ga0307405_10088896 Ga0307405_100888962 223
579 3300031852 Ga0307410_10046790 Ga0307410_100467905 223
580 3300031852 Ga0307410_10065830 Ga0307410_100658304 223
581 3300031911 Ga0307412_10061868 Ga0307412_100618682 223
582 3300031911 Ga0307412_10390834 Ga0307412_103908342 223
583 3300031995 Ga0307409_100063391 Ga0307409_1000633912 223
584 3300031995 Ga0307409_100080438 Ga0307409_1000804385 223
585 3300031995 Ga0307409_100292667 Ga0307409_1002926672 223
586 3300032005 Ga0307411_10048722 Ga0307411_100487225 223
587 3300032126 Ga0307415_100181485 Ga0307415_1001814852 223
588 3300032126 Ga0307415_100392508 Ga0307415_1003925081 223
589 3300035170 Ga0373943_0026246 Ga0373943_0026246_341_1012 223
590 3300035692 Ga0373935_0326761 Ga0373935_0326761_296_967 223
591 3300044684 Ga0466966_0005999 Ga0466966_0005999_4342_5013 223
592 3300044684 Ga0466966_0031561 Ga0466966_0031561_2222_2896 223
593 3300045049 Ga0466959_0050845 Ga0466959_0050845_1945_2619 223
594 3300045049 Ga0466959_0067153 Ga0466959_0067153_903_1574 223
595 3300049651 Ga0501201_005583 Ga0501201_005583_20_691 223
596 3300049652 Ga0501202_011881 Ga0501202_011881_189_860 223
597 3300049656 Ga0501209_022180 Ga0501209_022180_257_928 223
598 3300049660 Ga0501216_000507 Ga0501216_000507_2636_3307 223
599 3300049664 Ga0501224_011773 Ga0501224_011773_176_847 223
600 3300049665 Ga0501227_001814 Ga0501227_001814_2053_2724 223
601 3300049668 Ga0501233_001266 Ga0501233_001266_3089_3760 223
602 3300049669 Ga0501235_000951 Ga0501235_000951_2724_3395 223
603 3300049673 Ga0501240_023143 Ga0501240_023143_256_927 223
604 3300049675 Ga0501243_002882 Ga0501243_002882_104_775 223
605 3300049680 Ga0501250_013186 Ga0501250_013186_159_830 223
606 3300049688 Ga0501259_002588 Ga0501259_002588_1232_1903 223
607 3300049705 Ga0501225_0008444 Ga0501225_0008444_224_895 223
608 3300049707 Ga0501234_002610 Ga0501234_002610_247_918 223
609 3300049757 Ga0501232_027140 Ga0501232_027140_49_720 223
610 3300049760 Ga0501263_006353 Ga0501263_006353_305_976 223
611 3300049761 Ga0501264_002675 Ga0501264_002675_631_1302 223
612 3300049763 Ga0501266_000428 Ga0501266_000428_262_933 223
613 3300049765 Ga0501268_003987 Ga0501268_003987_610_1281 223
614 3300049767 Ga0501270_002989 Ga0501270_002989_1059_1730 223
615 3300049768 Ga0501271_002764 Ga0501271_002764_532_1203 223
616 3300049851 Ga0501212_024949 Ga0501212_024949_176_847 223

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01066

CDP-OH_P_transf

CDP-alcohol phosphatidyltransferase

3

209

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
7drk-assembly1.cif.gz_B crystal structure of phosphatidylglycerol phosphate synthase in complex with cytidine diphosphate-diacylglycerol 0.6229 1 206
7drk-assembly1.cif.gz_B crystal structure of phosphatidylglycerol phosphate synthase in complex with cytidine diphosphate-diacylglycerol 0.6173 1 206
8dz8-assembly8.cif.gz_H neoleukin 4, a de novo designed il-4 mimetic 0.5582 4 73
4q7c-assembly1.cif.gz_A structure of af2299, a cdp-alcohol phosphotransferase 0.5385 4 200
4o6m-assembly1.cif.gz_A structure of af2299, a cdp-alcohol phosphotransferase (cmp-bound) 0.5335 4 200
ID Description Score Start End Superfamily
af_P9WPG3_21_202_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.8541 2 219 1.20.120.1760
af_P9WPG3_21_202_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.8193 2 219 1.20.120.1760
af_P9WPG5_6_192_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.8078 1 218 1.20.120.1760
af_A0A1D6JYP0_117_317_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.7794 1 219 1.20.120.1760
af_P9WPG5_6_192_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.7647 1 218 1.20.120.1760
ID Description Score Start End GO Terms
AF-A0A2V7E918-F1-model_v4 CinA-like protein 0.9848 1 215 GO:0008654
GO:0016020
GO:0016780
AF-A0A2V7JLN2-F1-model_v4 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 0.9765 2 220 GO:0016020
GO:0016780
GO:0046474
AF-A0A2V7JLN2-F1-model_v4 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 0.9677 2 220 GO:0016020
GO:0016780
GO:0046474
AF-A0A2V7E918-F1-model_v4 CinA-like protein 0.9584 1 215 GO:0008654
GO:0016020
GO:0016780
AF-A0A2V7T0W3-F1-model_v4 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 0.9544 1 220 GO:0016020
GO:0016780
GO:0046474

Feature Viewer

pLDDT pTM Quality
83.25 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map