F469503
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 616 | 276 | 616 | 215 |
Family's Representative Sequence
| Representative Sequence | 3300005327|Ga0070658_10002218|Ga0070658_100022187 |
| Length | 231 |
| Sequence | MSVNLPNAFTVGRIAVTPLIAWLPMAPNTALRLTAFVLFVVAAVTDYVDGRLARSRKQETDLGRLLDPLADKLLLVATVVPMFLLMRPSLHSSQGWPAKALDNVLPFRTPFGDVALAWWIIAVVLGRELFMTVFRQAAARRGVVIAAIGPAKWKTGFQSVWVGSAYFWFFAATLAATRGWKTPAWNAFAMFNGSVGVLTMIGAVGLTLYSLVLYLRAYGRVFSGAPVRGRG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 59 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 62 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 63 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 65 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 66 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 67 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 68 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 69 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 70 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 71 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 72 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 73 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 74 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 75 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 77 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 78 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 79 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 80 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 81 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Metagenome | Rhizosphere |
| 95 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 107 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 174 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 175 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 176 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 177 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 178 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 179 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 180 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 181 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 182 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 183 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 184 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 185 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 186 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 187 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 188 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 189 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 190 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 191 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 192 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 193 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 194 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 195 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 196 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 197 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 198 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 199 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 200 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 238 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 239 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 240 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 241 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 242 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 243 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 244 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 245 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 250 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 251 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 252 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 253 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 254 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 255 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 256 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 257 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 258 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 259 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 260 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 261 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 262 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 263 | 3300049757 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control | Metagenome | Rhizosphere |
| 264 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 265 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 266 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 267 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 268 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 269 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 270 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 272 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 273 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 274 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 2.27 |
| Rhizosphere | 97.56 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.16 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_10986866 | 2162886012 | Unclassified | 2855 |
| 2 | MBSR1b_contig_545708 | 2162886012 | Bacteria | 2111 |
| 3 | LJQas_1008542 | 3300000549 | Bacteria | 1244 |
| 4 | JGI24737J22298_10028029 | 3300001990 | Unclassified | 1773 |
| 5 | Ga0065715_10094902 | 3300005293 | Bacteria | 4215 |
| 6 | Ga0065715_10095089 | 3300005293 | Bacteria | 4169 |
| 7 | Ga0065715_10252904 | 3300005293 | Bacteria | 1161 |
| 8 | Ga0065715_10296232 | 3300005293 | Bacteria | 1052 |
| 9 | Ga0070658_10002218 | 3300005327 | Bacteria | 16306 |
| 10 | Ga0070658_10015518 | 3300005327 | Bacteria | 6092 |
| 11 | Ga0070658_10022112 | 3300005327 | Bacteria | 5102 |
| 12 | Ga0070658_10176763 | 3300005327 | Bacteria | 1795 |
| 13 | Ga0070658_10316322 | 3300005327 | Bacteria | 1332 |
| 14 | Ga0070658_10392659 | 3300005327 | Bacteria | 1191 |
| 15 | Ga0070658_10519911 | 3300005327 | Bacteria | 1029 |
| 16 | Ga0070676_10015406 | 3300005328 | Bacteria | 4217 |
| 17 | Ga0070676_10019953 | 3300005328 | Bacteria | 3735 |
| 18 | Ga0070676_10241265 | 3300005328 | Unclassified | 1202 |
| 19 | Ga0070683_100000588 | 3300005329 | Bacteria | 25968 |
| 20 | Ga0070683_100006454 | 3300005329 | Bacteria | 9841 |
| 21 | Ga0070683_100009728 | 3300005329 | Bacteria | 8234 |
| 22 | Ga0070683_100038843 | 3300005329 | Bacteria | 4366 |
| 23 | Ga0070683_100052156 | 3300005329 | Bacteria | 3788 |
| 24 | Ga0070683_100063261 | 3300005329 | Bacteria | 3442 |
| 25 | Ga0070683_100088528 | 3300005329 | Bacteria | 2905 |
| 26 | Ga0070683_100094528 | 3300005329 | Bacteria | 2809 |
| 27 | Ga0070683_100136769 | 3300005329 | Bacteria | 2320 |
| 28 | Ga0070683_100349132 | 3300005329 | Bacteria | 1409 |
| 29 | Ga0070683_100563781 | 3300005329 | Bacteria | 1089 |
| 30 | Ga0070683_100835170 | 3300005329 | Bacteria | 883 |
| 31 | Ga0070690_100041687 | 3300005330 | Bacteria | 2907 |
| 32 | Ga0070690_100068051 | 3300005330 | Bacteria | 2309 |
| 33 | Ga0070690_100215801 | 3300005330 | Unclassified | 1342 |
| 34 | Ga0070670_100165303 | 3300005331 | Bacteria | 1918 |
| 35 | Ga0068869_100387468 | 3300005334 | Bacteria | 1147 |
| 36 | Ga0068869_100539574 | 3300005334 | Bacteria | 978 |
| 37 | Ga0070666_10214304 | 3300005335 | Bacteria | 1357 |
| 38 | Ga0070680_100000354 | 3300005336 | Bacteria | 30834 |
| 39 | Ga0070680_100000489 | 3300005336 | Bacteria | 27191 |
| 40 | Ga0070680_100020720 | 3300005336 | Bacteria | 5217 |
| 41 | Ga0070680_100078840 | 3300005336 | Bacteria | 2714 |
| 42 | Ga0070680_100091843 | 3300005336 | Bacteria | 2513 |
| 43 | Ga0070680_100200121 | 3300005336 | Bacteria | 1684 |
| 44 | Ga0070680_100409236 | 3300005336 | Bacteria | 1157 |
| 45 | Ga0070682_100000492 | 3300005337 | Bacteria | 24800 |
| 46 | Ga0070682_100008751 | 3300005337 | Bacteria | 5712 |
| 47 | Ga0070682_100091994 | 3300005337 | Bacteria | 1986 |
| 48 | Ga0068868_100564684 | 3300005338 | Bacteria | 1004 |
| 49 | Ga0070660_100009663 | 3300005339 | Bacteria | 6794 |
| 50 | Ga0070689_100023872 | 3300005340 | Bacteria | 4583 |
| 51 | Ga0070689_100043551 | 3300005340 | Bacteria | 3450 |
| 52 | Ga0070691_10118175 | 3300005341 | Bacteria | 1332 |
| 53 | Ga0070687_100022298 | 3300005343 | Bacteria | 2992 |
| 54 | Ga0070687_100123057 | 3300005343 | Bacteria | 1487 |
| 55 | Ga0070661_100021690 | 3300005344 | Bacteria | 4592 |
| 56 | Ga0070661_100052197 | 3300005344 | Bacteria | 2992 |
| 57 | Ga0070661_100309970 | 3300005344 | Bacteria | 1230 |
| 58 | Ga0070661_100310497 | 3300005344 | Unclassified | 1229 |
| 59 | Ga0070692_10014399 | 3300005345 | Bacteria | 3715 |
| 60 | Ga0070668_100107142 | 3300005347 | Bacteria | 2221 |
| 61 | Ga0070668_100189791 | 3300005347 | Bacteria | 1683 |
| 62 | Ga0070669_100044637 | 3300005353 | Bacteria | 3229 |
| 63 | Ga0070669_100069804 | 3300005353 | Bacteria | 2595 |
| 64 | Ga0070669_100173467 | 3300005353 | Bacteria | 1683 |
| 65 | Ga0070675_100032135 | 3300005354 | Bacteria | 4245 |
| 66 | Ga0070675_100130588 | 3300005354 | Bacteria | 2140 |
| 67 | Ga0070675_100739478 | 3300005354 | Bacteria | 897 |
| 68 | Ga0070671_100016066 | 3300005355 | Bacteria | 6050 |
| 69 | Ga0070671_100025904 | 3300005355 | Bacteria | 4816 |
| 70 | Ga0070671_100271195 | 3300005355 | Unclassified | 1442 |
| 71 | Ga0070674_100061989 | 3300005356 | Bacteria | 2612 |
| 72 | Ga0070673_100024766 | 3300005364 | Bacteria | 4405 |
| 73 | Ga0070673_100032682 | 3300005364 | Bacteria | 3922 |
| 74 | Ga0070673_100059989 | 3300005364 | Bacteria | 3013 |
| 75 | Ga0070673_100181023 | 3300005364 | Unclassified | 1804 |
| 76 | Ga0070688_100005659 | 3300005365 | Bacteria | 6598 |
| 77 | Ga0070659_100025729 | 3300005366 | Bacteria | 4524 |
| 78 | Ga0070659_100292106 | 3300005366 | Bacteria | 1358 |
| 79 | Ga0070667_100059416 | 3300005367 | Bacteria | 3234 |
| 80 | Ga0070667_100121474 | 3300005367 | Bacteria | 2272 |
| 81 | Ga0070709_10017799 | 3300005434 | Bacteria | 4083 |
| 82 | Ga0070709_10039769 | 3300005434 | Bacteria | 2887 |
| 83 | Ga0070709_10109269 | 3300005434 | Bacteria | 1856 |
| 84 | Ga0070714_100001803 | 3300005435 | Bacteria | 15572 |
| 85 | Ga0070713_100004812 | 3300005436 | Bacteria | 9146 |
| 86 | Ga0070710_10076722 | 3300005437 | Bacteria | 1940 |
| 87 | Ga0070711_100039252 | 3300005439 | Bacteria | 3187 |
| 88 | Ga0070711_100651224 | 3300005439 | Unclassified | 883 |
| 89 | Ga0070700_100008003 | 3300005441 | Bacteria | 5741 |
| 90 | Ga0070694_100009796 | 3300005444 | Bacteria | 5886 |
| 91 | Ga0070694_100117332 | 3300005444 | Bacteria | 1905 |
| 92 | Ga0070708_100000038 | 3300005445 | Bacteria | 85764 |
| 93 | Ga0070708_100000557 | 3300005445 | Bacteria | 27909 |
| 94 | Ga0070708_100116120 | 3300005445 | Bacteria | 2464 |
| 95 | Ga0070663_100000657 | 3300005455 | Bacteria | 18567 |
| 96 | Ga0070663_100403621 | 3300005455 | Bacteria | 1118 |
| 97 | Ga0070678_100223904 | 3300005456 | Bacteria | 1565 |
| 98 | Ga0070678_100659745 | 3300005456 | Bacteria | 939 |
| 99 | Ga0070662_100006003 | 3300005457 | Bacteria | 7791 |
| 100 | Ga0070662_100682475 | 3300005457 | Bacteria | 868 |
| 101 | Ga0070681_10003610 | 3300005458 | Bacteria | 14508 |
| 102 | Ga0070681_10042879 | 3300005458 | Bacteria | 4533 |
| 103 | Ga0070681_10249922 | 3300005458 | Bacteria | 1686 |
| 104 | Ga0070681_10273188 | 3300005458 | Unclassified | 1601 |
| 105 | Ga0070681_10364929 | 3300005458 | Bacteria | 1354 |
| 106 | Ga0070681_10524503 | 3300005458 | Bacteria | 1098 |
| 107 | Ga0070681_10545691 | 3300005458 | Bacteria | 1073 |
| 108 | Ga0068867_100005743 | 3300005459 | Bacteria | 8802 |
| 109 | Ga0068867_100127351 | 3300005459 | Bacteria | 1975 |
| 110 | Ga0070685_10010783 | 3300005466 | Bacteria | 4760 |
| 111 | Ga0070685_10147704 | 3300005466 | Bacteria | 1487 |
| 112 | Ga0070706_100050717 | 3300005467 | Bacteria | 3829 |
| 113 | Ga0070706_100170498 | 3300005467 | Bacteria | 2032 |
| 114 | Ga0070707_100017092 | 3300005468 | Bacteria | 6812 |
| 115 | Ga0070707_100024874 | 3300005468 | Bacteria | 5676 |
| 116 | Ga0070698_100009782 | 3300005471 | Bacteria | 10251 |
| 117 | Ga0070698_100010089 | 3300005471 | Bacteria | 10090 |
| 118 | Ga0070698_100021929 | 3300005471 | Bacteria | 6687 |
| 119 | Ga0070699_100007723 | 3300005518 | Bacteria | 9351 |
| 120 | Ga0070699_100149293 | 3300005518 | Bacteria | 2066 |
| 121 | Ga0070699_100241147 | 3300005518 | Bacteria | 1614 |
| 122 | Ga0070699_100251550 | 3300005518 | Bacteria | 1579 |
| 123 | Ga0070699_100796857 | 3300005518 | Bacteria | 865 |
| 124 | Ga0070679_100000377 | 3300005530 | Bacteria | 37955 |
| 125 | Ga0070679_100061707 | 3300005530 | Bacteria | 3737 |
| 126 | Ga0070679_100075909 | 3300005530 | Bacteria | 3350 |
| 127 | Ga0070679_100143239 | 3300005530 | Bacteria | 2369 |
| 128 | Ga0070679_100224971 | 3300005530 | Unclassified | 1836 |
| 129 | Ga0070679_100422142 | 3300005530 | Bacteria | 1279 |
| 130 | Ga0070679_100463033 | 3300005530 | Bacteria | 1212 |
| 131 | Ga0070679_100480877 | 3300005530 | Unclassified | 1186 |
| 132 | Ga0070684_100021184 | 3300005535 | Bacteria | 5403 |
| 133 | Ga0070684_100035542 | 3300005535 | Bacteria | 4265 |
| 134 | Ga0070684_100041085 | 3300005535 | Bacteria | 3986 |
| 135 | Ga0070684_100066524 | 3300005535 | Bacteria | 3164 |
| 136 | Ga0070684_100110796 | 3300005535 | Bacteria | 2461 |
| 137 | Ga0070684_100130366 | 3300005535 | Bacteria | 2268 |
| 138 | Ga0070684_100130803 | 3300005535 | Bacteria | 2264 |
| 139 | Ga0070684_100136839 | 3300005535 | Bacteria | 2213 |
| 140 | Ga0070684_100156666 | 3300005535 | Bacteria | 2065 |
| 141 | Ga0070684_100527022 | 3300005535 | Bacteria | 1095 |
| 142 | Ga0070697_100059204 | 3300005536 | Bacteria | 3118 |
| 143 | Ga0070697_100202703 | 3300005536 | Bacteria | 1686 |
| 144 | Ga0070697_100758748 | 3300005536 | Bacteria | 857 |
| 145 | Ga0068853_100035824 | 3300005539 | Bacteria | 4217 |
| 146 | Ga0068853_100049978 | 3300005539 | Bacteria | 3596 |
| 147 | Ga0068853_100317927 | 3300005539 | Bacteria | 1443 |
| 148 | Ga0070672_100036869 | 3300005543 | Bacteria | 3728 |
| 149 | Ga0070672_100083943 | 3300005543 | Bacteria | 2557 |
| 150 | Ga0070672_100177964 | 3300005543 | Bacteria | 1771 |
| 151 | Ga0070672_100267632 | 3300005543 | Bacteria | 1442 |
| 152 | Ga0070686_100014767 | 3300005544 | Bacteria | 4506 |
| 153 | Ga0070686_100077205 | 3300005544 | Bacteria | 2195 |
| 154 | Ga0070686_100455048 | 3300005544 | Bacteria | 985 |
| 155 | Ga0070695_100007270 | 3300005545 | Bacteria | 6564 |
| 156 | Ga0070696_100003340 | 3300005546 | Bacteria | 10719 |
| 157 | Ga0070696_100012630 | 3300005546 | Bacteria | 5670 |
| 158 | Ga0070696_100199997 | 3300005546 | Bacteria | 1491 |
| 159 | Ga0070693_100001724 | 3300005547 | Bacteria | 9944 |
| 160 | Ga0070665_100089358 | 3300005548 | Bacteria | 3086 |
| 161 | Ga0068855_100007038 | 3300005563 | Bacteria | 13645 |
| 162 | Ga0068855_100029666 | 3300005563 | Bacteria | 6539 |
| 163 | Ga0068855_100054011 | 3300005563 | Bacteria | 4725 |
| 164 | Ga0068855_100121690 | 3300005563 | Bacteria | 2986 |
| 165 | Ga0068855_100189635 | 3300005563 | Bacteria | 2320 |
| 166 | Ga0070664_100026438 | 3300005564 | Bacteria | 4814 |
| 167 | Ga0070664_100035049 | 3300005564 | Bacteria | 4212 |
| 168 | Ga0070664_100209682 | 3300005564 | Bacteria | 1741 |
| 169 | Ga0070664_100219014 | 3300005564 | Bacteria | 1703 |
| 170 | Ga0070664_100223454 | 3300005564 | Bacteria | 1685 |
| 171 | Ga0070664_100478304 | 3300005564 | Bacteria | 1146 |
| 172 | Ga0070664_100759312 | 3300005564 | Bacteria | 905 |
| 173 | Ga0068857_100027095 | 3300005577 | Bacteria | 5055 |
| 174 | Ga0068854_100005726 | 3300005578 | Bacteria | 7857 |
| 175 | Ga0068856_100010080 | 3300005614 | Bacteria | 9184 |
| 176 | Ga0070702_100196560 | 3300005615 | Bacteria | 1331 |
| 177 | Ga0070702_100219806 | 3300005615 | Bacteria | 1270 |
| 178 | Ga0068852_100005268 | 3300005616 | Bacteria | 9231 |
| 179 | Ga0068852_100043124 | 3300005616 | Bacteria | 3825 |
| 180 | Ga0068852_100085174 | 3300005616 | Bacteria | 2815 |
| 181 | Ga0068852_100101700 | 3300005616 | Bacteria | 2596 |
| 182 | Ga0068859_100051195 | 3300005617 | Bacteria | 4150 |
| 183 | Ga0068859_100059676 | 3300005617 | Bacteria | 3843 |
| 184 | Ga0068859_100135973 | 3300005617 | Bacteria | 2531 |
| 185 | Ga0068864_100323383 | 3300005618 | Bacteria | 1449 |
| 186 | Ga0068864_100441775 | 3300005618 | Bacteria | 1243 |
| 187 | Ga0068866_10071650 | 3300005718 | Bacteria | 1834 |
| 188 | Ga0068866_10096017 | 3300005718 | Bacteria | 1625 |
| 189 | Ga0068861_100034167 | 3300005719 | Bacteria | 3759 |
| 190 | Ga0068861_100252421 | 3300005719 | Bacteria | 1506 |
| 191 | Ga0068861_100637188 | 3300005719 | Bacteria | 983 |
| 192 | Ga0068851_10040153 | 3300005834 | Bacteria | 2351 |
| 193 | Ga0068870_10003341 | 3300005840 | Bacteria | 6783 |
| 194 | Ga0068870_10308709 | 3300005840 | Unclassified | 1001 |
| 195 | Ga0068863_100634106 | 3300005841 | Bacteria | 1059 |
| 196 | Ga0068858_100290965 | 3300005842 | Bacteria | 1557 |
| 197 | Ga0068860_100210819 | 3300005843 | Bacteria | 1885 |
| 198 | Ga0068860_100602908 | 3300005843 | Bacteria | 1104 |
| 199 | Ga0068860_100662927 | 3300005843 | Bacteria | 1052 |
| 200 | Ga0068862_100044188 | 3300005844 | Bacteria | 3800 |
| 201 | Ga0070712_100288105 | 3300006175 | Bacteria | 1325 |
| 202 | Ga0070712_100496929 | 3300006175 | Bacteria | 1022 |
| 203 | Ga0068871_100119934 | 3300006358 | Bacteria | 2221 |
| 204 | Ga0068871_100338775 | 3300006358 | Bacteria | 1328 |
| 205 | Ga0075433_10007884 | 3300006852 | Bacteria | 8469 |
| 206 | Ga0075434_100028012 | 3300006871 | Bacteria | 5532 |
| 207 | Ga0068865_100006993 | 3300006881 | Bacteria | 6921 |
| 208 | Ga0068865_100073262 | 3300006881 | Bacteria | 2435 |
| 209 | Ga0075436_100225073 | 3300006914 | Bacteria | 1332 |
| 210 | Ga0097620_100051195 | 3300006931 | Bacteria | 4150 |
| 211 | Ga0097620_100059675 | 3300006931 | Bacteria | 3843 |
| 212 | Ga0097620_100135973 | 3300006931 | Bacteria | 2531 |
| 213 | Ga0105240_10001901 | 3300009093 | Bacteria | 34675 |
| 214 | Ga0105240_10003398 | 3300009093 | Bacteria | 24750 |
| 215 | Ga0105240_10038998 | 3300009093 | Bacteria | 6088 |
| 216 | Ga0105240_10056687 | 3300009093 | Bacteria | 4902 |
| 217 | Ga0105240_10210645 | 3300009093 | Bacteria | 2271 |
| 218 | Ga0105240_10754736 | 3300009093 | Bacteria | 1057 |
| 219 | Ga0111539_10035036 | 3300009094 | Bacteria | 6078 |
| 220 | Ga0111539_11256563 | 3300009094 | Bacteria | 860 |
| 221 | Ga0105245_10048971 | 3300009098 | Unclassified | 3782 |
| 222 | Ga0105245_10070103 | 3300009098 | Bacteria | 3180 |
| 223 | Ga0105245_10164684 | 3300009098 | Bacteria | 2107 |
| 224 | Ga0105245_11029221 | 3300009098 | Bacteria | 868 |
| 225 | Ga0114129_10186370 | 3300009147 | Bacteria | 2820 |
| 226 | Ga0105243_10160545 | 3300009148 | Bacteria | 1938 |
| 227 | Ga0105243_10242652 | 3300009148 | Bacteria | 1604 |
| 228 | Ga0105243_10313800 | 3300009148 | Bacteria | 1426 |
| 229 | Ga0105243_10917581 | 3300009148 | Bacteria | 872 |
| 230 | Ga0105241_10276886 | 3300009174 | Bacteria | 1431 |
| 231 | Ga0105242_10003515 | 3300009176 | Bacteria | 12176 |
| 232 | Ga0105242_10269899 | 3300009176 | Bacteria | 1540 |
| 233 | Ga0105248_10046791 | 3300009177 | Bacteria | 4851 |
| 234 | Ga0105248_10193270 | 3300009177 | Bacteria | 2293 |
| 235 | Ga0105237_10007185 | 3300009545 | Bacteria | 12230 |
| 236 | Ga0105238_10037867 | 3300009551 | Bacteria | 4901 |
| 237 | Ga0105238_10114565 | 3300009551 | Bacteria | 2675 |
| 238 | Ga0105249_10047289 | 3300009553 | Bacteria | 3920 |
| 239 | Ga0105239_10376615 | 3300010375 | Bacteria | 1604 |
| 240 | Ga0157316_1005936 | 3300012510 | Bacteria | 983 |
| 241 | Ga0157373_10000902 | 3300013100 | Bacteria | 23019 |
| 242 | Ga0157373_10034536 | 3300013100 | Bacteria | 3632 |
| 243 | Ga0157373_10105675 | 3300013100 | Bacteria | 1980 |
| 244 | Ga0157371_10023342 | 3300013102 | Bacteria | 4524 |
| 245 | Ga0157371_10064836 | 3300013102 | Bacteria | 2588 |
| 246 | Ga0157371_10248033 | 3300013102 | Bacteria | 1281 |
| 247 | Ga0157370_10012699 | 3300013104 | Bacteria | 8716 |
| 248 | Ga0157370_10034666 | 3300013104 | Bacteria | 4911 |
| 249 | Ga0157370_10050158 | 3300013104 | Bacteria | 3991 |
| 250 | Ga0157370_10197619 | 3300013104 | Bacteria | 1866 |
| 251 | Ga0157370_10371493 | 3300013104 | Bacteria | 1318 |
| 252 | Ga0157370_10481097 | 3300013104 | Bacteria | 1141 |
| 253 | Ga0157369_10006735 | 3300013105 | Bacteria | 13258 |
| 254 | Ga0157369_10019497 | 3300013105 | Bacteria | 7590 |
| 255 | Ga0157369_10028815 | 3300013105 | Bacteria | 6141 |
| 256 | Ga0157369_10042377 | 3300013105 | Bacteria | 4966 |
| 257 | Ga0157369_10057459 | 3300013105 | Bacteria | 4198 |
| 258 | Ga0157369_10079689 | 3300013105 | Bacteria | 3507 |
| 259 | Ga0157369_10276582 | 3300013105 | Unclassified | 1749 |
| 260 | Ga0157369_10524047 | 3300013105 | Unclassified | 1226 |
| 261 | Ga0157369_10567122 | 3300013105 | Bacteria | 1173 |
| 262 | Ga0157374_10073752 | 3300013296 | Bacteria | 3221 |
| 263 | Ga0157378_10014701 | 3300013297 | Bacteria | 6857 |
| 264 | Ga0157378_10017905 | 3300013297 | Bacteria | 6218 |
| 265 | Ga0157378_10357593 | 3300013297 | Bacteria | 1428 |
| 266 | Ga0157378_10393404 | 3300013297 | Bacteria | 1364 |
| 267 | Ga0163162_10270155 | 3300013306 | Bacteria | 1832 |
| 268 | Ga0157372_10001161 | 3300013307 | Bacteria | 28502 |
| 269 | Ga0157372_10003116 | 3300013307 | Bacteria | 17881 |
| 270 | Ga0157372_10006551 | 3300013307 | Bacteria | 12388 |
| 271 | Ga0157372_10009434 | 3300013307 | Bacteria | 10382 |
| 272 | Ga0157372_10028273 | 3300013307 | Bacteria | 6119 |
| 273 | Ga0157372_10029216 | 3300013307 | Bacteria | 6018 |
| 274 | Ga0157372_10029467 | 3300013307 | Bacteria | 5994 |
| 275 | Ga0157372_10044752 | 3300013307 | Bacteria | 4906 |
| 276 | Ga0157372_10048350 | 3300013307 | Bacteria | 4728 |
| 277 | Ga0157372_10075622 | 3300013307 | Bacteria | 3800 |
| 278 | Ga0157372_10186834 | 3300013307 | Bacteria | 2400 |
| 279 | Ga0157372_10279321 | 3300013307 | Bacteria | 1941 |
| 280 | Ga0157372_10560779 | 3300013307 | Bacteria | 1331 |
| 281 | Ga0157372_10955000 | 3300013307 | Bacteria | 994 |
| 282 | Ga0157375_10011285 | 3300013308 | Bacteria | 7888 |
| 283 | Ga0157375_10013766 | 3300013308 | Bacteria | 7212 |
| 284 | Ga0157375_10021058 | 3300013308 | Bacteria | 5972 |
| 285 | Ga0157375_10031948 | 3300013308 | Bacteria | 4987 |
| 286 | Ga0157375_10542597 | 3300013308 | Bacteria | 1325 |
| 287 | Ga0163163_10535446 | 3300014325 | Bacteria | 1234 |
| 288 | Ga0157380_10101014 | 3300014326 | Bacteria | 2402 |
| 289 | Ga0182008_10212748 | 3300014497 | Bacteria | 987 |
| 290 | Ga0157377_10061235 | 3300014745 | Bacteria | 2150 |
| 291 | Ga0157379_10527192 | 3300014968 | Bacteria | 1097 |
| 292 | Ga0157376_10868371 | 3300014969 | Bacteria | 918 |
| 293 | Ga0207697_10016206 | 3300025315 | Bacteria | 3073 |
| 294 | Ga0207682_10005041 | 3300025893 | Bacteria | 5413 |
| 295 | Ga0207692_10159209 | 3300025898 | Unclassified | 1300 |
| 296 | Ga0207692_10246697 | 3300025898 | Bacteria | 1068 |
| 297 | Ga0207642_10005679 | 3300025899 | Bacteria | 4087 |
| 298 | Ga0207688_10079061 | 3300025901 | Bacteria | 1875 |
| 299 | Ga0207680_10202188 | 3300025903 | Bacteria | 1354 |
| 300 | Ga0207647_10139104 | 3300025904 | Bacteria | 1423 |
| 301 | Ga0207699_10031482 | 3300025906 | Bacteria | 2978 |
| 302 | Ga0207645_10010773 | 3300025907 | Bacteria | 6268 |
| 303 | Ga0207645_10090050 | 3300025907 | Bacteria | 1973 |
| 304 | Ga0207645_10192353 | 3300025907 | Unclassified | 1341 |
| 305 | Ga0207643_10041580 | 3300025908 | Bacteria | 2591 |
| 306 | Ga0207705_10005895 | 3300025909 | Bacteria | 9109 |
| 307 | Ga0207705_10036993 | 3300025909 | Bacteria | 3493 |
| 308 | Ga0207705_10055658 | 3300025909 | Bacteria | 2852 |
| 309 | Ga0207705_10103290 | 3300025909 | Bacteria | 2099 |
| 310 | Ga0207705_10248380 | 3300025909 | Bacteria | 1357 |
| 311 | Ga0207705_10257492 | 3300025909 | Bacteria | 1332 |
| 312 | Ga0207705_10371210 | 3300025909 | Bacteria | 1104 |
| 313 | Ga0207705_10681323 | 3300025909 | Bacteria | 799 |
| 314 | Ga0207684_10415187 | 3300025910 | Unclassified | 1156 |
| 315 | Ga0207707_10002464 | 3300025912 | Bacteria | 16657 |
| 316 | Ga0207707_10002797 | 3300025912 | Bacteria | 15562 |
| 317 | Ga0207707_10005608 | 3300025912 | Bacteria | 10982 |
| 318 | Ga0207707_10439668 | 3300025912 | Bacteria | 1117 |
| 319 | Ga0207707_10552243 | 3300025912 | Bacteria | 978 |
| 320 | Ga0207695_10001210 | 3300025913 | Bacteria | 44236 |
| 321 | Ga0207695_10006853 | 3300025913 | Bacteria | 14666 |
| 322 | Ga0207695_10007203 | 3300025913 | Bacteria | 14227 |
| 323 | Ga0207695_10013093 | 3300025913 | Bacteria | 9903 |
| 324 | Ga0207695_10023163 | 3300025913 | Bacteria | 7026 |
| 325 | Ga0207695_10105862 | 3300025913 | Bacteria | 2800 |
| 326 | Ga0207671_10026872 | 3300025914 | Bacteria | 4305 |
| 327 | Ga0207693_10054509 | 3300025915 | Bacteria | 3136 |
| 328 | Ga0207660_10000027 | 3300025917 | Bacteria | 68840 |
| 329 | Ga0207660_10002473 | 3300025917 | Bacteria | 12139 |
| 330 | Ga0207660_10014362 | 3300025917 | Bacteria | 5207 |
| 331 | Ga0207660_10057385 | 3300025917 | Bacteria | 2788 |
| 332 | Ga0207660_10384875 | 3300025917 | Bacteria | 1128 |
| 333 | Ga0207660_10480972 | 3300025917 | Bacteria | 1006 |
| 334 | Ga0207662_10011048 | 3300025918 | Bacteria | 4997 |
| 335 | Ga0207662_10014059 | 3300025918 | Bacteria | 4484 |
| 336 | Ga0207662_10018268 | 3300025918 | Bacteria | 3975 |
| 337 | Ga0207657_10001987 | 3300025919 | Bacteria | 22084 |
| 338 | Ga0207657_10041492 | 3300025919 | Bacteria | 4069 |
| 339 | Ga0207657_10159653 | 3300025919 | Bacteria | 1832 |
| 340 | Ga0207657_10184335 | 3300025919 | Bacteria | 1686 |
| 341 | Ga0207649_10013241 | 3300025920 | Bacteria | 4601 |
| 342 | Ga0207649_10069112 | 3300025920 | Bacteria | 2248 |
| 343 | Ga0207649_10156190 | 3300025920 | Bacteria | 1576 |
| 344 | Ga0207649_10230993 | 3300025920 | Unclassified | 1323 |
| 345 | Ga0207652_10000336 | 3300025921 | Bacteria | 48795 |
| 346 | Ga0207652_10035727 | 3300025921 | Bacteria | 4196 |
| 347 | Ga0207652_10076188 | 3300025921 | Bacteria | 2924 |
| 348 | Ga0207652_10209346 | 3300025921 | Unclassified | 1756 |
| 349 | Ga0207652_10257931 | 3300025921 | Bacteria | 1573 |
| 350 | Ga0207652_10391075 | 3300025921 | Bacteria | 1255 |
| 351 | Ga0207652_10564579 | 3300025921 | Bacteria | 1022 |
| 352 | Ga0207646_10266829 | 3300025922 | Bacteria | 1547 |
| 353 | Ga0207681_10018728 | 3300025923 | Bacteria | 4366 |
| 354 | Ga0207681_10123011 | 3300025923 | Bacteria | 1906 |
| 355 | Ga0207681_10361744 | 3300025923 | Unclassified | 1164 |
| 356 | Ga0207681_10495074 | 3300025923 | Bacteria | 1000 |
| 357 | Ga0207694_10011414 | 3300025924 | Bacteria | 6705 |
| 358 | Ga0207694_10073076 | 3300025924 | Bacteria | 2682 |
| 359 | Ga0207650_10338339 | 3300025925 | Bacteria | 1235 |
| 360 | Ga0207659_10037533 | 3300025926 | Bacteria | 3364 |
| 361 | Ga0207659_10155715 | 3300025926 | Bacteria | 1789 |
| 362 | Ga0207659_10175182 | 3300025926 | Bacteria | 1695 |
| 363 | Ga0207659_10235769 | 3300025926 | Bacteria | 1478 |
| 364 | Ga0207659_10326210 | 3300025926 | Unclassified | 1268 |
| 365 | Ga0207687_10049041 | 3300025927 | Bacteria | 2934 |
| 366 | Ga0207687_10580862 | 3300025927 | Bacteria | 943 |
| 367 | Ga0207700_10149008 | 3300025928 | Bacteria | 1932 |
| 368 | Ga0207700_10237857 | 3300025928 | Bacteria | 1551 |
| 369 | Ga0207664_10027237 | 3300025929 | Bacteria | 4331 |
| 370 | Ga0207664_10048992 | 3300025929 | Bacteria | 3324 |
| 371 | Ga0207644_10054987 | 3300025931 | Bacteria | 2868 |
| 372 | Ga0207644_10478627 | 3300025931 | Bacteria | 1025 |
| 373 | Ga0207690_10135233 | 3300025932 | Bacteria | 1809 |
| 374 | Ga0207706_10001172 | 3300025933 | Bacteria | 26572 |
| 375 | Ga0207706_10038760 | 3300025933 | Bacteria | 4227 |
| 376 | Ga0207686_10053607 | 3300025934 | Bacteria | 2522 |
| 377 | Ga0207686_10219486 | 3300025934 | Bacteria | 1372 |
| 378 | Ga0207686_10556820 | 3300025934 | Unclassified | 897 |
| 379 | Ga0207709_10118788 | 3300025935 | Bacteria | 1781 |
| 380 | Ga0207709_10170685 | 3300025935 | Bacteria | 1526 |
| 381 | Ga0207709_10204320 | 3300025935 | Bacteria | 1413 |
| 382 | Ga0207670_10024466 | 3300025936 | Bacteria | 3774 |
| 383 | Ga0207670_10058608 | 3300025936 | Bacteria | 2616 |
| 384 | Ga0207669_10439254 | 3300025937 | Bacteria | 1031 |
| 385 | Ga0207704_10515556 | 3300025938 | Bacteria | 966 |
| 386 | Ga0207691_10010422 | 3300025940 | Bacteria | 8920 |
| 387 | Ga0207691_10027451 | 3300025940 | Bacteria | 5336 |
| 388 | Ga0207691_10240106 | 3300025940 | Bacteria | 1567 |
| 389 | Ga0207691_10255244 | 3300025940 | Bacteria | 1512 |
| 390 | Ga0207691_10268403 | 3300025940 | Bacteria | 1470 |
| 391 | Ga0207691_10584936 | 3300025940 | Bacteria | 945 |
| 392 | Ga0207711_10041700 | 3300025941 | Bacteria | 3909 |
| 393 | Ga0207711_10118302 | 3300025941 | Bacteria | 2364 |
| 394 | Ga0207711_10124903 | 3300025941 | Bacteria | 2301 |
| 395 | Ga0207711_10406991 | 3300025941 | Bacteria | 1264 |
| 396 | Ga0207689_10045028 | 3300025942 | Bacteria | 3649 |
| 397 | Ga0207661_10002202 | 3300025944 | Bacteria | 13446 |
| 398 | Ga0207661_10002811 | 3300025944 | Bacteria | 12019 |
| 399 | Ga0207661_10010100 | 3300025944 | Bacteria | 6784 |
| 400 | Ga0207661_10033658 | 3300025944 | Bacteria | 3979 |
| 401 | Ga0207661_10034615 | 3300025944 | Bacteria | 3931 |
| 402 | Ga0207661_10036045 | 3300025944 | Bacteria | 3859 |
| 403 | Ga0207661_10068159 | 3300025944 | Bacteria | 2896 |
| 404 | Ga0207661_10126579 | 3300025944 | Bacteria | 2183 |
| 405 | Ga0207661_10243819 | 3300025944 | Unclassified | 1595 |
| 406 | Ga0207661_10292498 | 3300025944 | Bacteria | 1458 |
| 407 | Ga0207661_10353120 | 3300025944 | Bacteria | 1327 |
| 408 | Ga0207661_10512402 | 3300025944 | Bacteria | 1097 |
| 409 | Ga0207679_10138519 | 3300025945 | Bacteria | 1963 |
| 410 | Ga0207679_10501347 | 3300025945 | Bacteria | 1083 |
| 411 | Ga0207679_10772483 | 3300025945 | Unclassified | 875 |
| 412 | Ga0207667_10007411 | 3300025949 | Bacteria | 13189 |
| 413 | Ga0207667_10176585 | 3300025949 | Bacteria | 2194 |
| 414 | Ga0207667_10222990 | 3300025949 | Bacteria | 1931 |
| 415 | Ga0207651_10154936 | 3300025960 | Bacteria | 1788 |
| 416 | Ga0207651_10313173 | 3300025960 | Bacteria | 1309 |
| 417 | Ga0207651_10491610 | 3300025960 | Unclassified | 1059 |
| 418 | Ga0207712_10026939 | 3300025961 | Bacteria | 3835 |
| 419 | Ga0207668_10031879 | 3300025972 | Bacteria | 3476 |
| 420 | Ga0207668_10056201 | 3300025972 | Bacteria | 2740 |
| 421 | Ga0207668_10088226 | 3300025972 | Bacteria | 2271 |
| 422 | Ga0207668_10927067 | 3300025972 | Bacteria | 776 |
| 423 | Ga0207640_10002009 | 3300025981 | Bacteria | 10989 |
| 424 | Ga0207640_10032284 | 3300025981 | Bacteria | 3245 |
| 425 | Ga0207658_10089066 | 3300025986 | Bacteria | 2388 |
| 426 | Ga0207658_10275557 | 3300025986 | Bacteria | 1440 |
| 427 | Ga0207677_10097579 | 3300026023 | Bacteria | 2153 |
| 428 | Ga0207639_10037588 | 3300026041 | Bacteria | 3597 |
| 429 | Ga0207678_10000562 | 3300026067 | Bacteria | 33903 |
| 430 | Ga0207708_10049905 | 3300026075 | Bacteria | 3186 |
| 431 | Ga0207708_10327159 | 3300026075 | Bacteria | 1252 |
| 432 | Ga0207702_10218910 | 3300026078 | Bacteria | 1774 |
| 433 | Ga0207702_10252157 | 3300026078 | Bacteria | 1658 |
| 434 | Ga0207702_10433193 | 3300026078 | Bacteria | 1273 |
| 435 | Ga0207648_10014800 | 3300026089 | Bacteria | 7198 |
| 436 | Ga0207648_10054836 | 3300026089 | Bacteria | 3481 |
| 437 | Ga0207648_10154382 | 3300026089 | Bacteria | 2026 |
| 438 | Ga0207648_10231897 | 3300026089 | Bacteria | 1642 |
| 439 | Ga0207676_10385278 | 3300026095 | Bacteria | 1306 |
| 440 | Ga0207676_10534513 | 3300026095 | Bacteria | 1118 |
| 441 | Ga0207674_10015817 | 3300026116 | Bacteria | 8273 |
| 442 | Ga0207674_10033328 | 3300026116 | Bacteria | 5393 |
| 443 | Ga0207674_10169610 | 3300026116 | Bacteria | 2136 |
| 444 | Ga0207674_10396296 | 3300026116 | Bacteria | 1334 |
| 445 | Ga0207675_100290075 | 3300026118 | Bacteria | 1591 |
| 446 | Ga0207683_10065581 | 3300026121 | Bacteria | 3201 |
| 447 | Ga0207683_10098845 | 3300026121 | Bacteria | 2604 |
| 448 | Ga0207683_10210900 | 3300026121 | Bacteria | 1768 |
| 449 | Ga0207698_10274689 | 3300026142 | Bacteria | 1555 |
| 450 | Ga0209999_1002000 | 3300027543 | Bacteria | 3557 |
| 451 | Ga0209998_10000291 | 3300027717 | Bacteria | 15357 |
| 452 | Ga0268265_10020036 | 3300028380 | Bacteria | 4662 |
| 453 | Ga0268265_10295034 | 3300028380 | Bacteria | 1457 |
| 454 | Ga0268264_10194460 | 3300028381 | Bacteria | 1851 |
| 455 | Ga0268264_10376366 | 3300028381 | Bacteria | 1359 |
| 456 | Ga0307408_100181520 | 3300031548 | Unclassified | 1688 |
| 457 | Ga0307405_10015762 | 3300031731 | Bacteria | 4102 |
| 458 | Ga0307405_10088896 | 3300031731 | Bacteria | 2040 |
| 459 | Ga0307410_10046790 | 3300031852 | Bacteria | 2888 |
| 460 | Ga0307410_10065830 | 3300031852 | Unclassified | 2494 |
| 461 | Ga0307412_10061868 | 3300031911 | Unclassified | 2518 |
| 462 | Ga0307412_10390834 | 3300031911 | Bacteria | 1129 |
| 463 | Ga0307409_100063391 | 3300031995 | Bacteria | 2898 |
| 464 | Ga0307409_100080438 | 3300031995 | Bacteria | 2629 |
| 465 | Ga0307409_100292667 | 3300031995 | Bacteria | 1511 |
| 466 | Ga0307409_100300426 | 3300031995 | Unclassified | 1493 |
| 467 | Ga0307411_10048722 | 3300032005 | Unclassified | 2748 |
| 468 | Ga0307411_10148556 | 3300032005 | Bacteria | 1739 |
| 469 | Ga0307415_100105899 | 3300032126 | Bacteria | 2075 |
| 470 | Ga0307415_100181485 | 3300032126 | Unclassified | 1652 |
| 471 | Ga0307415_100392508 | 3300032126 | Unclassified | 1182 |
| 472 | Ga0307415_100438567 | 3300032126 | Bacteria | 1126 |
| 473 | Ga0373930_0043548 | 3300034816 | Bacteria | 963 |
| 474 | Ga0373959_0020063 | 3300034820 | Bacteria | 1272 |
| 475 | Ga0373936_0065852 | 3300035113 | Bacteria | 1487 |
| 476 | Ga0373939_0106399 | 3300035114 | Bacteria | 970 |
| 477 | Ga0373954_0060524 | 3300035118 | Bacteria | 1786 |
| 478 | Ga0373956_0031930 | 3300035119 | Bacteria | 2309 |
| 479 | Ga0373956_0057645 | 3300035119 | Bacteria | 1755 |
| 480 | Ga0373956_0235683 | 3300035119 | Bacteria | 869 |
| 481 | Ga0373957_0074667 | 3300035120 | Bacteria | 1331 |
| 482 | Ga0373957_0123320 | 3300035120 | Bacteria | 1050 |
| 483 | Ga0373943_0026246 | 3300035170 | Bacteria | 2729 |
| 484 | Ga0373943_0190096 | 3300035170 | Unclassified | 1132 |
| 485 | Ga0373955_0162463 | 3300035172 | Bacteria | 1319 |
| 486 | Ga0373935_0326761 | 3300035692 | Bacteria | 1089 |
| 487 | Ga0373927_0015471 | 3300035695 | Bacteria | 5040 |
| 488 | Ga0373947_0020600 | 3300035725 | Bacteria | 3809 |
| 489 | Ga0373947_0156653 | 3300035725 | Bacteria | 1470 |
| 490 | Ga0373937_0004555 | 3300036401 | Bacteria | 11766 |
| 491 | Ga0373937_0103166 | 3300036401 | Bacteria | 2648 |
| 492 | Ga0373925_0047451 | 3300037068 | Bacteria | 3197 |
| 493 | Ga0373925_0824896 | 3300037068 | Bacteria | 764 |
| 494 | Ga0242420_006728 | 3300038996 | Bacteria | 1823 |
| 495 | Ga0451853_3891242 | 3300041512 | Unclassified | 1593 |
| 496 | Ga0466966_0005999 | 3300044684 | Bacteria | 8020 |
| 497 | Ga0466966_0031561 | 3300044684 | Bacteria | 3435 |
| 498 | Ga0466959_0050845 | 3300045049 | Bacteria | 3042 |
| 499 | Ga0466959_0067153 | 3300045049 | Bacteria | 2600 |
| 500 | Ga0466958_0189269 | 3300045836 | Unclassified | 1308 |
| 501 | Ga0466967_0069433 | 3300045976 | Bacteria | 3149 |
| 502 | Ga0495603_0220631 | 3300046455 | Unclassified | 1094 |
| 503 | Ga0495629_0004819 | 3300046459 | Bacteria | 10121 |
| 504 | Ga0495629_0088832 | 3300046459 | Bacteria | 2156 |
| 505 | Ga0495629_0121697 | 3300046459 | Bacteria | 1818 |
| 506 | Ga0495651_0104696 | 3300046462 | Bacteria | 2100 |
| 507 | Ga0495651_0268724 | 3300046462 | Bacteria | 1157 |
| 508 | Ga0495653_0030536 | 3300046463 | Bacteria | 4291 |
| 509 | Ga0495653_0332604 | 3300046463 | Bacteria | 981 |
| 510 | Ga0495580_0012607 | 3300046472 | Bacteria | 6480 |
| 511 | Ga0495580_0121597 | 3300046472 | Bacteria | 1812 |
| 512 | Ga0495580_0366729 | 3300046472 | Unclassified | 974 |
| 513 | Ga0495582_0008245 | 3300046473 | Bacteria | 5749 |
| 514 | Ga0495582_0026893 | 3300046473 | Bacteria | 3153 |
| 515 | Ga0495664_0044737 | 3300046477 | Bacteria | 2624 |
| 516 | Ga0495664_0091613 | 3300046477 | Bacteria | 1828 |
| 517 | Ga0495594_0018810 | 3300046499 | Bacteria | 3664 |
| 518 | Ga0495608_0021338 | 3300046511 | Bacteria | 4445 |
| 519 | Ga0495618_0012828 | 3300046514 | Bacteria | 5093 |
| 520 | Ga0495628_0026155 | 3300046516 | Bacteria | 4764 |
| 521 | Ga0495630_0009308 | 3300046517 | Bacteria | 7063 |
| 522 | Ga0495630_0049865 | 3300046517 | Bacteria | 3133 |
| 523 | Ga0495666_0027256 | 3300046526 | Bacteria | 2813 |
| 524 | Ga0495652_0018708 | 3300046529 | Bacteria | 6174 |
| 525 | Ga0495652_0259875 | 3300046529 | Bacteria | 1282 |
| 526 | Ga0495665_0004906 | 3300046531 | Bacteria | 7211 |
| 527 | Ga0495665_0049891 | 3300046531 | Bacteria | 2219 |
| 528 | Ga0495665_0106417 | 3300046531 | Bacteria | 1472 |
| 529 | Ga0495640_0043573 | 3300046533 | Bacteria | 3124 |
| 530 | Ga0495640_0355819 | 3300046533 | Bacteria | 903 |
| 531 | Ga0495586_0045397 | 3300046535 | Bacteria | 2368 |
| 532 | Ga0495586_0050098 | 3300046535 | Bacteria | 2259 |
| 533 | Ga0495586_0692949 | 3300046535 | Bacteria | 588 |
| 534 | Ga0495587_0010256 | 3300046536 | Bacteria | 5972 |
| 535 | Ga0495587_0076668 | 3300046536 | Bacteria | 1941 |
| 536 | Ga0495645_0007759 | 3300046543 | Bacteria | 7462 |
| 537 | Ga0495645_0119225 | 3300046543 | Bacteria | 1859 |
| 538 | Ga0495667_0005908 | 3300046559 | Bacteria | 8284 |
| 539 | Ga0495667_0025081 | 3300046559 | Bacteria | 4019 |
| 540 | Ga0495635_0422407 | 3300046663 | Bacteria | 884 |
| 541 | Ga0495635_0425831 | 3300046663 | Bacteria | 879 |
| 542 | Ga0495588_0011470 | 3300046674 | Bacteria | 4162 |
| 543 | Ga0495657_0276685 | 3300046675 | Bacteria | 1005 |
| 544 | Ga0495599_0000646 | 3300046678 | Bacteria | 19723 |
| 545 | Ga0495599_0025164 | 3300046678 | Bacteria | 3725 |
| 546 | Ga0495623_0029027 | 3300046679 | Bacteria | 3560 |
| 547 | Ga0495646_0106855 | 3300046680 | Bacteria | 1597 |
| 548 | Ga0495658_0013031 | 3300046683 | Bacteria | 4226 |
| 549 | Ga0495658_0077588 | 3300046683 | Bacteria | 1943 |
| 550 | Ga0495658_0258580 | 3300046683 | Bacteria | 1096 |
| 551 | Ga0495658_0483505 | 3300046683 | Bacteria | 792 |
| 552 | Ga0495669_0194539 | 3300046684 | Bacteria | 968 |
| 553 | Ga0495613_0185861 | 3300046689 | Bacteria | 1470 |
| 554 | Ga0495613_0615034 | 3300046689 | Unclassified | 722 |
| 555 | Ga0495581_0061004 | 3300047315 | Bacteria | 2179 |
| 556 | Ga0495581_0118704 | 3300047315 | Unclassified | 1539 |
| 557 | Ga0495604_0006036 | 3300047317 | Bacteria | 9613 |
| 558 | Ga0495674_0176865 | 3300047319 | Bacteria | 1778 |
| 559 | Ga0495674_0177748 | 3300047319 | Unclassified | 1773 |
| 560 | Ga0495674_0497634 | 3300047319 | Bacteria | 975 |
| 561 | Ga0495672_0010420 | 3300047320 | Bacteria | 6620 |
| 562 | Ga0495675_0004413 | 3300047444 | Bacteria | 8511 |
| 563 | Ga0495675_0040545 | 3300047444 | Bacteria | 2967 |
| 564 | Ga0495675_0061497 | 3300047444 | Bacteria | 2378 |
| 565 | Ga0495675_0293117 | 3300047444 | Unclassified | 968 |
| 566 | Ga0495684_0069647 | 3300047471 | Bacteria | 2674 |
| 567 | Ga0495684_0142930 | 3300047471 | Bacteria | 1793 |
| 568 | Ga0495602_0043996 | 3300048088 | Bacteria | 4053 |
| 569 | Ga0495614_0075048 | 3300048089 | Bacteria | 1461 |
| 570 | Ga0496100_0093310 | 3300048903 | Bacteria | 2059 |
| 571 | Ga0496104_0033468 | 3300048907 | Bacteria | 4788 |
| 572 | Ga0496104_0050128 | 3300048907 | Bacteria | 3939 |
| 573 | Ga0496107_0105367 | 3300048910 | Bacteria | 2070 |
| 574 | Ga0496108_0205938 | 3300048911 | Bacteria | 1707 |
| 575 | Ga0496109_0153910 | 3300048912 | Bacteria | 2154 |
| 576 | Ga0496109_0181953 | 3300048912 | Bacteria | 1974 |
| 577 | Ga0496109_0451567 | 3300048912 | Bacteria | 1214 |
| 578 | Ga0496110_0256271 | 3300048913 | Bacteria | 1593 |
| 579 | Ga0496112_0028047 | 3300048915 | Bacteria | 5431 |
| 580 | Ga0496112_0188485 | 3300048915 | Bacteria | 2025 |
| 581 | Ga0496112_0331156 | 3300048915 | Bacteria | 1466 |
| 582 | Ga0496113_0048379 | 3300048916 | Bacteria | 3163 |
| 583 | Ga0496113_0089794 | 3300048916 | Bacteria | 2366 |
| 584 | Ga0501032_0081206 | 3300049569 | Bacteria | 2157 |
| 585 | Ga0501037_0054563 | 3300049573 | Bacteria | 2923 |
| 586 | Ga0501043_0012328 | 3300049579 | Bacteria | 6684 |
| 587 | Ga0501047_0003790 | 3300049581 | Bacteria | 14231 |
| 588 | Ga0501201_005583 | 3300049651 | Unclassified | 1179 |
| 589 | Ga0501202_011881 | 3300049652 | Bacteria | 1636 |
| 590 | Ga0501209_022180 | 3300049656 | Bacteria | 1520 |
| 591 | Ga0501216_000507 | 3300049660 | Bacteria | 4631 |
| 592 | Ga0501224_011773 | 3300049664 | Unclassified | 1287 |
| 593 | Ga0501227_001814 | 3300049665 | Bacteria | 4732 |
| 594 | Ga0501233_001266 | 3300049668 | Bacteria | 4311 |
| 595 | Ga0501235_000951 | 3300049669 | Bacteria | 5973 |
| 596 | Ga0501240_023143 | 3300049673 | Unclassified | 950 |
| 597 | Ga0501243_002882 | 3300049675 | Unclassified | 2533 |
| 598 | Ga0501250_013186 | 3300049680 | Unclassified | 988 |
| 599 | Ga0501259_002588 | 3300049688 | Bacteria | 2919 |
| 600 | Ga0501225_0008444 | 3300049705 | Bacteria | 2956 |
| 601 | Ga0501234_002610 | 3300049707 | Bacteria | 2838 |
| 602 | Ga0501232_027140 | 3300049757 | Unclassified | 775 |
| 603 | Ga0501263_006353 | 3300049760 | Unclassified | 1362 |
| 604 | Ga0501264_002675 | 3300049761 | Bacteria | 1643 |
| 605 | Ga0501266_000428 | 3300049763 | Bacteria | 5580 |
| 606 | Ga0501268_003987 | 3300049765 | Unclassified | 2057 |
| 607 | Ga0501270_002989 | 3300049767 | Unclassified | 1787 |
| 608 | Ga0501271_002764 | 3300049768 | Unclassified | 1588 |
| 609 | Ga0501044_0095276 | 3300049823 | Bacteria | 3000 |
| 610 | Ga0501044_0185691 | 3300049823 | Bacteria | 2044 |
| 611 | Ga0501212_024949 | 3300049851 | Unclassified | 942 |
| 612 | nmdc:mga08y16_51769_c1 | 3300050511 | Bacteria | 4296 |
| 613 | nmdc:mga0rr50_433008_c1 | 3300050513 | Bacteria | 1113 |
| 614 | nmdc:mga0a205_9732_c1 | 3300050515 | Bacteria | 8805 |
| 615 | Ga0495601_0260664 | 3300053077 | Bacteria | 1132 |
| 616 | Ga0495612_0032831 | 3300053078 | Bacteria | 2098 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046535 | Ga0495586_0692949 | Ga0495586_0692949_16_564 | 178 |
| 2 | 3300046689 | Ga0495613_0615034 | Ga0495613_0615034_147_695 | 178 |
| 3 | 3300026121 | Ga0207683_10210900 | Ga0207683_102109003 | 183 |
| 4 | 3300005336 | Ga0070680_100020720 | Ga0070680_1000207207 | 191 |
| 5 | 3300005530 | Ga0070679_100061707 | Ga0070679_1000617072 | 191 |
| 6 | 3300005547 | Ga0070693_100001724 | Ga0070693_1000017248 | 191 |
| 7 | 3300005456 | Ga0070678_100223904 | Ga0070678_1002239041 | 192 |
| 8 | 3300005615 | Ga0070702_100219806 | Ga0070702_1002198062 | 192 |
| 9 | 3300013297 | Ga0157378_10017905 | Ga0157378_100179053 | 192 |
| 10 | 3300026089 | Ga0207648_10054836 | Ga0207648_100548363 | 192 |
| 11 | 3300026121 | Ga0207683_10098845 | Ga0207683_100988455 | 192 |
| 12 | 3300047315 | Ga0495581_0061004 | Ga0495581_0061004_66_662 | 194 |
| 13 | 3300014326 | Ga0157380_10101014 | Ga0157380_101010142 | 197 |
| 14 | 3300025937 | Ga0207669_10439254 | Ga0207669_104392542 | 197 |
| 15 | 3300005334 | Ga0068869_100539574 | Ga0068869_1005395741 | 198 |
| 16 | 3300009098 | Ga0105245_10070103 | Ga0105245_100701032 | 198 |
| 17 | 3300025926 | Ga0207659_10326210 | Ga0207659_103262102 | 198 |
| 18 | 3300025927 | Ga0207687_10049041 | Ga0207687_100490415 | 198 |
| 19 | 3300005355 | Ga0070671_100016066 | Ga0070671_1000160663 | 199 |
| 20 | 3300005544 | Ga0070686_100455048 | Ga0070686_1004550482 | 199 |
| 21 | 3300012510 | Ga0157316_1005936 | Ga0157316_10059362 | 199 |
| 22 | 3300025938 | Ga0207704_10515556 | Ga0207704_105155561 | 199 |
| 23 | 3300001990 | JGI24737J22298_10028029 | JGI24737J22298_100280293 | 200 |
| 24 | 3300005327 | Ga0070658_10022112 | Ga0070658_100221125 | 200 |
| 25 | 3300005329 | Ga0070683_100835170 | Ga0070683_1008351701 | 200 |
| 26 | 3300005336 | Ga0070680_100409236 | Ga0070680_1004092362 | 200 |
| 27 | 3300005367 | Ga0070667_100059416 | Ga0070667_1000594161 | 200 |
| 28 | 3300005455 | Ga0070663_100403621 | Ga0070663_1004036212 | 200 |
| 29 | 3300005458 | Ga0070681_10524503 | Ga0070681_105245031 | 200 |
| 30 | 3300005459 | Ga0068867_100005743 | Ga0068867_1000057438 | 200 |
| 31 | 3300005535 | Ga0070684_100136839 | Ga0070684_1001368394 | 200 |
| 32 | 3300005539 | Ga0068853_100317927 | Ga0068853_1003179271 | 200 |
| 33 | 3300005543 | Ga0070672_100083943 | Ga0070672_1000839432 | 200 |
| 34 | 3300005564 | Ga0070664_100026438 | Ga0070664_1000264384 | 200 |
| 35 | 3300005564 | Ga0070664_100759312 | Ga0070664_1007593122 | 200 |
| 36 | 3300005719 | Ga0068861_100252421 | Ga0068861_1002524212 | 200 |
| 37 | 3300005834 | Ga0068851_10040153 | Ga0068851_100401533 | 200 |
| 38 | 3300006881 | Ga0068865_100006993 | Ga0068865_1000069935 | 200 |
| 39 | 3300009098 | Ga0105245_11029221 | Ga0105245_110292211 | 200 |
| 40 | 3300009148 | Ga0105243_10160545 | Ga0105243_101605452 | 200 |
| 41 | 3300009176 | Ga0105242_10003515 | Ga0105242_100035157 | 200 |
| 42 | 3300010375 | Ga0105239_10376615 | Ga0105239_103766152 | 200 |
| 43 | 3300013105 | Ga0157369_10567122 | Ga0157369_105671222 | 200 |
| 44 | 3300013307 | Ga0157372_10279321 | Ga0157372_102793212 | 200 |
| 45 | 3300013308 | Ga0157375_10542597 | Ga0157375_105425971 | 200 |
| 46 | 3300025904 | Ga0207647_10139104 | Ga0207647_101391042 | 200 |
| 47 | 3300025931 | Ga0207644_10478627 | Ga0207644_104786272 | 200 |
| 48 | 3300025934 | Ga0207686_10053607 | Ga0207686_100536072 | 200 |
| 49 | 3300025935 | Ga0207709_10204320 | Ga0207709_102043202 | 200 |
| 50 | 3300025940 | Ga0207691_10010422 | Ga0207691_100104222 | 200 |
| 51 | 3300025941 | Ga0207711_10041700 | Ga0207711_100417005 | 200 |
| 52 | 3300025944 | Ga0207661_10033658 | Ga0207661_100336582 | 200 |
| 53 | 3300025945 | Ga0207679_10772483 | Ga0207679_107724832 | 200 |
| 54 | 3300025972 | Ga0207668_10031879 | Ga0207668_100318792 | 200 |
| 55 | 3300026116 | Ga0207674_10015817 | Ga0207674_100158179 | 200 |
| 56 | 3300026118 | Ga0207675_100290075 | Ga0207675_1002900752 | 200 |
| 57 | 3300028381 | Ga0268264_10194460 | Ga0268264_101944602 | 200 |
| 58 | 3300045836 | Ga0466958_0189269 | Ga0466958_0189269_10_615 | 200 |
| 59 | 3300046684 | Ga0495669_0194539 | Ga0495669_0194539_146_838 | 200 |
| 60 | 3300048911 | Ga0496108_0205938 | Ga0496108_0205938_746_1438 | 200 |
| 61 | 3300048912 | Ga0496109_0181953 | Ga0496109_0181953_181_873 | 200 |
| 62 | 3300048915 | Ga0496112_0331156 | Ga0496112_0331156_53_745 | 200 |
| 63 | 3300048916 | Ga0496113_0048379 | Ga0496113_0048379_609_1301 | 200 |
| 64 | 3300005347 | Ga0070668_100189791 | Ga0070668_1001897912 | 201 |
| 65 | 3300005355 | Ga0070671_100025904 | Ga0070671_1000259045 | 201 |
| 66 | 3300005543 | Ga0070672_100177964 | Ga0070672_1001779642 | 201 |
| 67 | 3300005843 | Ga0068860_100602908 | Ga0068860_1006029082 | 201 |
| 68 | 3300006358 | Ga0068871_100119934 | Ga0068871_1001199343 | 201 |
| 69 | 3300013104 | Ga0157370_10371493 | Ga0157370_103714932 | 201 |
| 70 | 3300013306 | Ga0163162_10270155 | Ga0163162_102701552 | 201 |
| 71 | 3300025925 | Ga0207650_10338339 | Ga0207650_103383392 | 201 |
| 72 | 3300025927 | Ga0207687_10580862 | Ga0207687_105808622 | 201 |
| 73 | 3300025931 | Ga0207644_10054987 | Ga0207644_100549872 | 201 |
| 74 | 3300025933 | Ga0207706_10038760 | Ga0207706_100387604 | 201 |
| 75 | 3300025940 | Ga0207691_10584936 | Ga0207691_105849361 | 201 |
| 76 | 3300026023 | Ga0207677_10097579 | Ga0207677_100975792 | 201 |
| 77 | 3300048903 | Ga0496100_0093310 | Ga0496100_0093310_1234_1926 | 201 |
| 78 | 3300048910 | Ga0496107_0105367 | Ga0496107_0105367_1023_1715 | 201 |
| 79 | 3300048912 | Ga0496109_0451567 | Ga0496109_0451567_152_844 | 201 |
| 80 | 3300005455 | Ga0070663_100000657 | Ga0070663_10000065719 | 202 |
| 81 | 3300005530 | Ga0070679_100480877 | Ga0070679_1004808772 | 202 |
| 82 | 3300005535 | Ga0070684_100021184 | Ga0070684_1000211847 | 202 |
| 83 | 3300005616 | Ga0068852_100043124 | Ga0068852_1000431244 | 202 |
| 84 | 3300009093 | Ga0105240_10038998 | Ga0105240_100389984 | 202 |
| 85 | 3300009093 | Ga0105240_10754736 | Ga0105240_107547362 | 202 |
| 86 | 3300009551 | Ga0105238_10037867 | Ga0105238_100378674 | 202 |
| 87 | 3300013102 | Ga0157371_10023342 | Ga0157371_100233422 | 202 |
| 88 | 3300013104 | Ga0157370_10034666 | Ga0157370_100346662 | 202 |
| 89 | 3300013105 | Ga0157369_10028815 | Ga0157369_100288154 | 202 |
| 90 | 3300013105 | Ga0157369_10057459 | Ga0157369_100574592 | 202 |
| 91 | 3300013307 | Ga0157372_10075622 | Ga0157372_100756222 | 202 |
| 92 | 3300025909 | Ga0207705_10055658 | Ga0207705_100556584 | 202 |
| 93 | 3300025913 | Ga0207695_10007203 | Ga0207695_100072037 | 202 |
| 94 | 3300025920 | Ga0207649_10230993 | Ga0207649_102309931 | 202 |
| 95 | 3300025921 | Ga0207652_10257931 | Ga0207652_102579312 | 202 |
| 96 | 3300025924 | Ga0207694_10073076 | Ga0207694_100730761 | 202 |
| 97 | 3300025944 | Ga0207661_10126579 | Ga0207661_101265792 | 202 |
| 98 | 3300025949 | Ga0207667_10007411 | Ga0207667_100074119 | 202 |
| 99 | 3300025981 | Ga0207640_10032284 | Ga0207640_100322842 | 202 |
| 100 | 3300026067 | Ga0207678_10000562 | Ga0207678_1000056233 | 202 |
| 101 | 3300046663 | Ga0495635_0422407 | Ga0495635_0422407_88_780 | 202 |
| 102 | 3300046675 | Ga0495657_0276685 | Ga0495657_0276685_245_937 | 202 |
| 103 | 3300047444 | Ga0495675_0040545 | Ga0495675_0040545_878_1570 | 202 |
| 104 | 3300048907 | Ga0496104_0033468 | Ga0496104_0033468_1279_1971 | 202 |
| 105 | 3300048913 | Ga0496110_0256271 | Ga0496110_0256271_418_1110 | 202 |
| 106 | 3300013297 | Ga0157378_10393404 | Ga0157378_103934042 | 203 |
| 107 | 3300005331 | Ga0070670_100165303 | Ga0070670_1001653032 | 204 |
| 108 | 3300005354 | Ga0070675_100739478 | Ga0070675_1007394781 | 204 |
| 109 | 3300005366 | Ga0070659_100292106 | Ga0070659_1002921062 | 204 |
| 110 | 3300005564 | Ga0070664_100223454 | Ga0070664_1002234542 | 204 |
| 111 | 3300013308 | Ga0157375_10013766 | Ga0157375_1001376610 | 204 |
| 112 | 3300014325 | Ga0163163_10535446 | Ga0163163_105354462 | 204 |
| 113 | 3300025893 | Ga0207682_10005041 | Ga0207682_100050412 | 204 |
| 114 | 3300025923 | Ga0207681_10361744 | Ga0207681_103617442 | 204 |
| 115 | 3300025926 | Ga0207659_10175182 | Ga0207659_101751823 | 204 |
| 116 | 3300025940 | Ga0207691_10255244 | Ga0207691_102552442 | 204 |
| 117 | 3300026075 | Ga0207708_10327159 | Ga0207708_103271592 | 204 |
| 118 | 3300026089 | Ga0207648_10231897 | Ga0207648_102318972 | 204 |
| 119 | 3300026095 | Ga0207676_10534513 | Ga0207676_105345132 | 204 |
| 120 | 3300047320 | Ga0495672_0010420 | Ga0495672_0010420_3234_3866 | 204 |
| 121 | 3300005329 | Ga0070683_100000588 | Ga0070683_10000058824 | 206 |
| 122 | 3300005329 | Ga0070683_100006454 | Ga0070683_1000064547 | 206 |
| 123 | 3300005329 | Ga0070683_100038843 | Ga0070683_1000388436 | 206 |
| 124 | 3300005329 | Ga0070683_100088528 | Ga0070683_1000885283 | 206 |
| 125 | 3300005329 | Ga0070683_100349132 | Ga0070683_1003491322 | 206 |
| 126 | 3300005329 | Ga0070683_100563781 | Ga0070683_1005637812 | 206 |
| 127 | 3300005330 | Ga0070690_100041687 | Ga0070690_1000416872 | 206 |
| 128 | 3300005336 | Ga0070680_100000489 | Ga0070680_10000048923 | 206 |
| 129 | 3300005338 | Ga0068868_100564684 | Ga0068868_1005646841 | 206 |
| 130 | 3300005340 | Ga0070689_100043551 | Ga0070689_1000435513 | 206 |
| 131 | 3300005343 | Ga0070687_100022298 | Ga0070687_1000222983 | 206 |
| 132 | 3300005347 | Ga0070668_100107142 | Ga0070668_1001071421 | 206 |
| 133 | 3300005353 | Ga0070669_100173467 | Ga0070669_1001734671 | 206 |
| 134 | 3300005354 | Ga0070675_100032135 | Ga0070675_1000321353 | 206 |
| 135 | 3300005355 | Ga0070671_100271195 | Ga0070671_1002711952 | 206 |
| 136 | 3300005364 | Ga0070673_100059989 | Ga0070673_1000599895 | 206 |
| 137 | 3300005367 | Ga0070667_100121474 | Ga0070667_1001214742 | 206 |
| 138 | 3300005434 | Ga0070709_10017799 | Ga0070709_100177992 | 206 |
| 139 | 3300005436 | Ga0070713_100004812 | Ga0070713_1000048127 | 206 |
| 140 | 3300005439 | Ga0070711_100039252 | Ga0070711_1000392522 | 206 |
| 141 | 3300005445 | Ga0070708_100000038 | Ga0070708_10000003832 | 206 |
| 142 | 3300005456 | Ga0070678_100659745 | Ga0070678_1006597452 | 206 |
| 143 | 3300005458 | Ga0070681_10249922 | Ga0070681_102499221 | 206 |
| 144 | 3300005466 | Ga0070685_10147704 | Ga0070685_101477042 | 206 |
| 145 | 3300005467 | Ga0070706_100170498 | Ga0070706_1001704982 | 206 |
| 146 | 3300005471 | Ga0070698_100010089 | Ga0070698_1000100896 | 206 |
| 147 | 3300005535 | Ga0070684_100035542 | Ga0070684_1000355422 | 206 |
| 148 | 3300005535 | Ga0070684_100066524 | Ga0070684_1000665246 | 206 |
| 149 | 3300005535 | Ga0070684_100130366 | Ga0070684_1001303662 | 206 |
| 150 | 3300005535 | Ga0070684_100130803 | Ga0070684_1001308033 | 206 |
| 151 | 3300005543 | Ga0070672_100036869 | Ga0070672_1000368691 | 206 |
| 152 | 3300005544 | Ga0070686_100077205 | Ga0070686_1000772052 | 206 |
| 153 | 3300005546 | Ga0070696_100003340 | Ga0070696_1000033406 | 206 |
| 154 | 3300005548 | Ga0070665_100089358 | Ga0070665_1000893583 | 206 |
| 155 | 3300005563 | Ga0068855_100029666 | Ga0068855_1000296669 | 206 |
| 156 | 3300005564 | Ga0070664_100219014 | Ga0070664_1002190142 | 206 |
| 157 | 3300005564 | Ga0070664_100478304 | Ga0070664_1004783041 | 206 |
| 158 | 3300005614 | Ga0068856_100010080 | Ga0068856_10001008011 | 206 |
| 159 | 3300005615 | Ga0070702_100196560 | Ga0070702_1001965602 | 206 |
| 160 | 3300005617 | Ga0068859_100051195 | Ga0068859_1000511952 | 206 |
| 161 | 3300005617 | Ga0068859_100135973 | Ga0068859_1001359732 | 206 |
| 162 | 3300005618 | Ga0068864_100323383 | Ga0068864_1003233832 | 206 |
| 163 | 3300005618 | Ga0068864_100441775 | Ga0068864_1004417752 | 206 |
| 164 | 3300005718 | Ga0068866_10096017 | Ga0068866_100960172 | 206 |
| 165 | 3300005719 | Ga0068861_100637188 | Ga0068861_1006371882 | 206 |
| 166 | 3300005840 | Ga0068870_10308709 | Ga0068870_103087092 | 206 |
| 167 | 3300005841 | Ga0068863_100634106 | Ga0068863_1006341062 | 206 |
| 168 | 3300005842 | Ga0068858_100290965 | Ga0068858_1002909652 | 206 |
| 169 | 3300005843 | Ga0068860_100662927 | Ga0068860_1006629272 | 206 |
| 170 | 3300005844 | Ga0068862_100044188 | Ga0068862_1000441884 | 206 |
| 171 | 3300006175 | Ga0070712_100288105 | Ga0070712_1002881051 | 206 |
| 172 | 3300006175 | Ga0070712_100496929 | Ga0070712_1004969292 | 206 |
| 173 | 3300006358 | Ga0068871_100338775 | Ga0068871_1003387752 | 206 |
| 174 | 3300006931 | Ga0097620_100051195 | Ga0097620_1000511952 | 206 |
| 175 | 3300006931 | Ga0097620_100135973 | Ga0097620_1001359732 | 206 |
| 176 | 3300009094 | Ga0111539_11256563 | Ga0111539_112565631 | 206 |
| 177 | 3300009148 | Ga0105243_10242652 | Ga0105243_102426522 | 206 |
| 178 | 3300009148 | Ga0105243_10313800 | Ga0105243_103138002 | 206 |
| 179 | 3300009148 | Ga0105243_10917581 | Ga0105243_109175811 | 206 |
| 180 | 3300009176 | Ga0105242_10269899 | Ga0105242_102698991 | 206 |
| 181 | 3300009177 | Ga0105248_10046791 | Ga0105248_100467914 | 206 |
| 182 | 3300009177 | Ga0105248_10193270 | Ga0105248_101932702 | 206 |
| 183 | 3300009551 | Ga0105238_10114565 | Ga0105238_101145653 | 206 |
| 184 | 3300009553 | Ga0105249_10047289 | Ga0105249_100472894 | 206 |
| 185 | 3300013104 | Ga0157370_10012699 | Ga0157370_100126995 | 206 |
| 186 | 3300013104 | Ga0157370_10050158 | Ga0157370_100501582 | 206 |
| 187 | 3300013105 | Ga0157369_10019497 | Ga0157369_100194979 | 206 |
| 188 | 3300013297 | Ga0157378_10357593 | Ga0157378_103575932 | 206 |
| 189 | 3300013307 | Ga0157372_10003116 | Ga0157372_1000311616 | 206 |
| 190 | 3300013307 | Ga0157372_10048350 | Ga0157372_100483503 | 206 |
| 191 | 3300013307 | Ga0157372_10955000 | Ga0157372_109550002 | 206 |
| 192 | 3300013308 | Ga0157375_10011285 | Ga0157375_100112856 | 206 |
| 193 | 3300013308 | Ga0157375_10021058 | Ga0157375_100210587 | 206 |
| 194 | 3300014968 | Ga0157379_10527192 | Ga0157379_105271922 | 206 |
| 195 | 3300014969 | Ga0157376_10868371 | Ga0157376_108683712 | 206 |
| 196 | 3300025898 | Ga0207692_10246697 | Ga0207692_102466971 | 206 |
| 197 | 3300025906 | Ga0207699_10031482 | Ga0207699_100314822 | 206 |
| 198 | 3300025907 | Ga0207645_10090050 | Ga0207645_100900502 | 206 |
| 199 | 3300025910 | Ga0207684_10415187 | Ga0207684_104151872 | 206 |
| 200 | 3300025912 | Ga0207707_10439668 | Ga0207707_104396682 | 206 |
| 201 | 3300025913 | Ga0207695_10013093 | Ga0207695_100130933 | 206 |
| 202 | 3300025915 | Ga0207693_10054509 | Ga0207693_100545095 | 206 |
| 203 | 3300025917 | Ga0207660_10000027 | Ga0207660_1000002722 | 206 |
| 204 | 3300025918 | Ga0207662_10018268 | Ga0207662_100182683 | 206 |
| 205 | 3300025923 | Ga0207681_10123011 | Ga0207681_101230112 | 206 |
| 206 | 3300025924 | Ga0207694_10011414 | Ga0207694_100114144 | 206 |
| 207 | 3300025926 | Ga0207659_10155715 | Ga0207659_101557152 | 206 |
| 208 | 3300025926 | Ga0207659_10235769 | Ga0207659_102357692 | 206 |
| 209 | 3300025928 | Ga0207700_10149008 | Ga0207700_101490082 | 206 |
| 210 | 3300025934 | Ga0207686_10219486 | Ga0207686_102194862 | 206 |
| 211 | 3300025934 | Ga0207686_10556820 | Ga0207686_105568202 | 206 |
| 212 | 3300025935 | Ga0207709_10118788 | Ga0207709_101187882 | 206 |
| 213 | 3300025935 | Ga0207709_10170685 | Ga0207709_101706852 | 206 |
| 214 | 3300025936 | Ga0207670_10058608 | Ga0207670_100586084 | 206 |
| 215 | 3300025941 | Ga0207711_10124903 | Ga0207711_101249032 | 206 |
| 216 | 3300025941 | Ga0207711_10406991 | Ga0207711_104069911 | 206 |
| 217 | 3300025944 | Ga0207661_10034615 | Ga0207661_100346154 | 206 |
| 218 | 3300025944 | Ga0207661_10068159 | Ga0207661_100681593 | 206 |
| 219 | 3300025944 | Ga0207661_10243819 | Ga0207661_102438192 | 206 |
| 220 | 3300025944 | Ga0207661_10292498 | Ga0207661_102924982 | 206 |
| 221 | 3300025944 | Ga0207661_10353120 | Ga0207661_103531202 | 206 |
| 222 | 3300025960 | Ga0207651_10154936 | Ga0207651_101549363 | 206 |
| 223 | 3300025961 | Ga0207712_10026939 | Ga0207712_100269393 | 206 |
| 224 | 3300025972 | Ga0207668_10056201 | Ga0207668_100562015 | 206 |
| 225 | 3300025972 | Ga0207668_10927067 | Ga0207668_109270672 | 206 |
| 226 | 3300025986 | Ga0207658_10089066 | Ga0207658_100890663 | 206 |
| 227 | 3300026078 | Ga0207702_10218910 | Ga0207702_102189102 | 206 |
| 228 | 3300026078 | Ga0207702_10252157 | Ga0207702_102521571 | 206 |
| 229 | 3300026089 | Ga0207648_10014800 | Ga0207648_100148007 | 206 |
| 230 | 3300026095 | Ga0207676_10385278 | Ga0207676_103852782 | 206 |
| 231 | 3300026116 | Ga0207674_10169610 | Ga0207674_101696102 | 206 |
| 232 | 3300026116 | Ga0207674_10396296 | Ga0207674_103962961 | 206 |
| 233 | 3300026121 | Ga0207683_10065581 | Ga0207683_100655814 | 206 |
| 234 | 3300028380 | Ga0268265_10020036 | Ga0268265_100200366 | 206 |
| 235 | 3300028381 | Ga0268264_10376366 | Ga0268264_103763662 | 206 |
| 236 | 3300032126 | Ga0307415_100105899 | Ga0307415_1001058992 | 206 |
| 237 | 3300035113 | Ga0373936_0065852 | Ga0373936_0065852_531_1163 | 206 |
| 238 | 3300035118 | Ga0373954_0060524 | Ga0373954_0060524_655_1287 | 206 |
| 239 | 3300035119 | Ga0373956_0031930 | Ga0373956_0031930_1615_2247 | 206 |
| 240 | 3300035119 | Ga0373956_0057645 | Ga0373956_0057645_12_644 | 206 |
| 241 | 3300035119 | Ga0373956_0235683 | Ga0373956_0235683_114_746 | 206 |
| 242 | 3300035120 | Ga0373957_0074667 | Ga0373957_0074667_134_766 | 206 |
| 243 | 3300035120 | Ga0373957_0123320 | Ga0373957_0123320_69_701 | 206 |
| 244 | 3300035170 | Ga0373943_0190096 | Ga0373943_0190096_312_944 | 206 |
| 245 | 3300035172 | Ga0373955_0162463 | Ga0373955_0162463_304_936 | 206 |
| 246 | 3300035695 | Ga0373927_0015471 | Ga0373927_0015471_402_1034 | 206 |
| 247 | 3300035725 | Ga0373947_0020600 | Ga0373947_0020600_3109_3741 | 206 |
| 248 | 3300035725 | Ga0373947_0156653 | Ga0373947_0156653_15_647 | 206 |
| 249 | 3300036401 | Ga0373937_0004555 | Ga0373937_0004555_10677_11309 | 206 |
| 250 | 3300036401 | Ga0373937_0103166 | Ga0373937_0103166_1290_1922 | 206 |
| 251 | 3300037068 | Ga0373925_0047451 | Ga0373925_0047451_284_916 | 206 |
| 252 | 3300037068 | Ga0373925_0824896 | Ga0373925_0824896_50_682 | 206 |
| 253 | 3300045976 | Ga0466967_0069433 | Ga0466967_0069433_2072_2788 | 206 |
| 254 | 3300046455 | Ga0495603_0220631 | Ga0495603_0220631_327_959 | 206 |
| 255 | 3300046459 | Ga0495629_0004819 | Ga0495629_0004819_3858_4490 | 206 |
| 256 | 3300046459 | Ga0495629_0088832 | Ga0495629_0088832_83_715 | 206 |
| 257 | 3300046459 | Ga0495629_0121697 | Ga0495629_0121697_1135_1767 | 206 |
| 258 | 3300046462 | Ga0495651_0104696 | Ga0495651_0104696_688_1320 | 206 |
| 259 | 3300046462 | Ga0495651_0268724 | Ga0495651_0268724_126_758 | 206 |
| 260 | 3300046463 | Ga0495653_0030536 | Ga0495653_0030536_3425_4057 | 206 |
| 261 | 3300046463 | Ga0495653_0332604 | Ga0495653_0332604_40_672 | 206 |
| 262 | 3300046472 | Ga0495580_0012607 | Ga0495580_0012607_1455_2087 | 206 |
| 263 | 3300046472 | Ga0495580_0121597 | Ga0495580_0121597_739_1371 | 206 |
| 264 | 3300046472 | Ga0495580_0366729 | Ga0495580_0366729_83_715 | 206 |
| 265 | 3300046473 | Ga0495582_0008245 | Ga0495582_0008245_4679_5311 | 206 |
| 266 | 3300046473 | Ga0495582_0026893 | Ga0495582_0026893_2466_3098 | 206 |
| 267 | 3300046477 | Ga0495664_0044737 | Ga0495664_0044737_1528_2160 | 206 |
| 268 | 3300046477 | Ga0495664_0091613 | Ga0495664_0091613_865_1497 | 206 |
| 269 | 3300046499 | Ga0495594_0018810 | Ga0495594_0018810_2681_3313 | 206 |
| 270 | 3300046511 | Ga0495608_0021338 | Ga0495608_0021338_2358_2990 | 206 |
| 271 | 3300046514 | Ga0495618_0012828 | Ga0495618_0012828_3346_3978 | 206 |
| 272 | 3300046516 | Ga0495628_0026155 | Ga0495628_0026155_1749_2381 | 206 |
| 273 | 3300046517 | Ga0495630_0009308 | Ga0495630_0009308_5186_5818 | 206 |
| 274 | 3300046517 | Ga0495630_0049865 | Ga0495630_0049865_80_712 | 206 |
| 275 | 3300046526 | Ga0495666_0027256 | Ga0495666_0027256_1182_1814 | 206 |
| 276 | 3300046529 | Ga0495652_0018708 | Ga0495652_0018708_5378_6010 | 206 |
| 277 | 3300046529 | Ga0495652_0259875 | Ga0495652_0259875_599_1231 | 206 |
| 278 | 3300046531 | Ga0495665_0004906 | Ga0495665_0004906_4343_4975 | 206 |
| 279 | 3300046531 | Ga0495665_0049891 | Ga0495665_0049891_842_1474 | 206 |
| 280 | 3300046531 | Ga0495665_0106417 | Ga0495665_0106417_633_1265 | 206 |
| 281 | 3300046533 | Ga0495640_0043573 | Ga0495640_0043573_1066_1698 | 206 |
| 282 | 3300046533 | Ga0495640_0355819 | Ga0495640_0355819_241_873 | 206 |
| 283 | 3300046535 | Ga0495586_0045397 | Ga0495586_0045397_1557_2189 | 206 |
| 284 | 3300046535 | Ga0495586_0050098 | Ga0495586_0050098_1452_2084 | 206 |
| 285 | 3300046536 | Ga0495587_0010256 | Ga0495587_0010256_2956_3588 | 206 |
| 286 | 3300046536 | Ga0495587_0076668 | Ga0495587_0076668_1117_1749 | 206 |
| 287 | 3300046543 | Ga0495645_0007759 | Ga0495645_0007759_3032_3664 | 206 |
| 288 | 3300046543 | Ga0495645_0119225 | Ga0495645_0119225_1101_1733 | 206 |
| 289 | 3300046559 | Ga0495667_0005908 | Ga0495667_0005908_5973_6605 | 206 |
| 290 | 3300046559 | Ga0495667_0025081 | Ga0495667_0025081_820_1452 | 206 |
| 291 | 3300046663 | Ga0495635_0425831 | Ga0495635_0425831_49_681 | 206 |
| 292 | 3300046678 | Ga0495599_0000646 | Ga0495599_0000646_9922_10554 | 206 |
| 293 | 3300046678 | Ga0495599_0025164 | Ga0495599_0025164_832_1464 | 206 |
| 294 | 3300046679 | Ga0495623_0029027 | Ga0495623_0029027_2474_3106 | 206 |
| 295 | 3300046680 | Ga0495646_0106855 | Ga0495646_0106855_478_1110 | 206 |
| 296 | 3300046683 | Ga0495658_0013031 | Ga0495658_0013031_3343_3975 | 206 |
| 297 | 3300046683 | Ga0495658_0077588 | Ga0495658_0077588_218_850 | 206 |
| 298 | 3300046683 | Ga0495658_0258580 | Ga0495658_0258580_62_694 | 206 |
| 299 | 3300046683 | Ga0495658_0483505 | Ga0495658_0483505_35_664 | 206 |
| 300 | 3300046689 | Ga0495613_0185861 | Ga0495613_0185861_185_817 | 206 |
| 301 | 3300047315 | Ga0495581_0118704 | Ga0495581_0118704_614_1246 | 206 |
| 302 | 3300047317 | Ga0495604_0006036 | Ga0495604_0006036_38_670 | 206 |
| 303 | 3300047319 | Ga0495674_0176865 | Ga0495674_0176865_1081_1713 | 206 |
| 304 | 3300047319 | Ga0495674_0177748 | Ga0495674_0177748_188_820 | 206 |
| 305 | 3300047319 | Ga0495674_0497634 | Ga0495674_0497634_36_668 | 206 |
| 306 | 3300047444 | Ga0495675_0004413 | Ga0495675_0004413_7861_8493 | 206 |
| 307 | 3300047444 | Ga0495675_0061497 | Ga0495675_0061497_1140_1772 | 206 |
| 308 | 3300047444 | Ga0495675_0293117 | Ga0495675_0293117_247_879 | 206 |
| 309 | 3300047471 | Ga0495684_0069647 | Ga0495684_0069647_935_1567 | 206 |
| 310 | 3300047471 | Ga0495684_0142930 | Ga0495684_0142930_1132_1764 | 206 |
| 311 | 3300048088 | Ga0495602_0043996 | Ga0495602_0043996_2855_3487 | 206 |
| 312 | 3300048089 | Ga0495614_0075048 | Ga0495614_0075048_394_1026 | 206 |
| 313 | 3300048907 | Ga0496104_0050128 | Ga0496104_0050128_2662_3294 | 206 |
| 314 | 3300050513 | nmdc:mga0rr50_433008_c1 | nmdc:mga0rr50_433008_c1_181_813 | 206 |
| 315 | 3300053077 | Ga0495601_0260664 | Ga0495601_0260664_45_677 | 206 |
| 316 | 3300053078 | Ga0495612_0032831 | Ga0495612_0032831_392_1024 | 206 |
| 317 | 3300041512 | Ga0451853_3891242 | Ga0451853_3891242_496_1167 | 210 |
| 318 | 3300005434 | Ga0070709_10109269 | Ga0070709_101092692 | 211 |
| 319 | 3300005458 | Ga0070681_10042879 | Ga0070681_100428793 | 211 |
| 320 | 3300005530 | Ga0070679_100075909 | Ga0070679_1000759093 | 211 |
| 321 | 3300005535 | Ga0070684_100527022 | Ga0070684_1005270221 | 211 |
| 322 | 3300005546 | Ga0070696_100199997 | Ga0070696_1001999972 | 211 |
| 323 | 3300009093 | Ga0105240_10003398 | Ga0105240_100033983 | 211 |
| 324 | 3300009093 | Ga0105240_10056687 | Ga0105240_100566874 | 211 |
| 325 | 3300009093 | Ga0105240_10210645 | Ga0105240_102106452 | 211 |
| 326 | 3300013100 | Ga0157373_10034536 | Ga0157373_100345366 | 211 |
| 327 | 3300013105 | Ga0157369_10042377 | Ga0157369_100423773 | 211 |
| 328 | 3300013307 | Ga0157372_10029216 | Ga0157372_100292167 | 211 |
| 329 | 3300013307 | Ga0157372_10044752 | Ga0157372_100447526 | 211 |
| 330 | 3300014497 | Ga0182008_10212748 | Ga0182008_102127482 | 211 |
| 331 | 3300025913 | Ga0207695_10023163 | Ga0207695_100231637 | 211 |
| 332 | 3300025913 | Ga0207695_10105862 | Ga0207695_101058623 | 211 |
| 333 | 3300026078 | Ga0207702_10433193 | Ga0207702_104331932 | 211 |
| 334 | 3300049823 | Ga0501044_0095276 | Ga0501044_0095276_791_1453 | 211 |
| 335 | 3300005329 | Ga0070683_100052156 | Ga0070683_1000521564 | 212 |
| 336 | 3300005336 | Ga0070680_100200121 | Ga0070680_1002001212 | 212 |
| 337 | 3300005337 | Ga0070682_100091994 | Ga0070682_1000919943 | 212 |
| 338 | 3300005341 | Ga0070691_10118175 | Ga0070691_101181752 | 212 |
| 339 | 3300005344 | Ga0070661_100021690 | Ga0070661_1000216907 | 212 |
| 340 | 3300005458 | Ga0070681_10003610 | Ga0070681_1000361011 | 212 |
| 341 | 3300005458 | Ga0070681_10364929 | Ga0070681_103649291 | 212 |
| 342 | 3300005518 | Ga0070699_100007723 | Ga0070699_10000772310 | 212 |
| 343 | 3300005530 | Ga0070679_100143239 | Ga0070679_1001432392 | 212 |
| 344 | 3300005530 | Ga0070679_100463033 | Ga0070679_1004630332 | 212 |
| 345 | 3300005546 | Ga0070696_100012630 | Ga0070696_1000126306 | 212 |
| 346 | 3300005563 | Ga0068855_100121690 | Ga0068855_1001216903 | 212 |
| 347 | 3300005578 | Ga0068854_100005726 | Ga0068854_1000057267 | 212 |
| 348 | 3300005616 | Ga0068852_100085174 | Ga0068852_1000851743 | 212 |
| 349 | 3300009093 | Ga0105240_10001901 | Ga0105240_1000190111 | 212 |
| 350 | 3300013100 | Ga0157373_10000902 | Ga0157373_1000090220 | 212 |
| 351 | 3300013104 | Ga0157370_10197619 | Ga0157370_101976192 | 212 |
| 352 | 3300013307 | Ga0157372_10009434 | Ga0157372_100094346 | 212 |
| 353 | 3300013307 | Ga0157372_10028273 | Ga0157372_100282736 | 212 |
| 354 | 3300025912 | Ga0207707_10002797 | Ga0207707_100027976 | 212 |
| 355 | 3300025912 | Ga0207707_10005608 | Ga0207707_100056089 | 212 |
| 356 | 3300025913 | Ga0207695_10001210 | Ga0207695_1000121027 | 212 |
| 357 | 3300025913 | Ga0207695_10006853 | Ga0207695_100068532 | 212 |
| 358 | 3300025917 | Ga0207660_10002473 | Ga0207660_100024738 | 212 |
| 359 | 3300025917 | Ga0207660_10057385 | Ga0207660_100573852 | 212 |
| 360 | 3300025919 | Ga0207657_10184335 | Ga0207657_101843352 | 212 |
| 361 | 3300025920 | Ga0207649_10013241 | Ga0207649_100132414 | 212 |
| 362 | 3300025921 | Ga0207652_10000336 | Ga0207652_1000033627 | 212 |
| 363 | 3300025921 | Ga0207652_10035727 | Ga0207652_100357274 | 212 |
| 364 | 3300025944 | Ga0207661_10002202 | Ga0207661_100022028 | 212 |
| 365 | 3300025944 | Ga0207661_10010100 | Ga0207661_100101007 | 212 |
| 366 | 3300025981 | Ga0207640_10002009 | Ga0207640_100020098 | 212 |
| 367 | 3300026142 | Ga0207698_10274689 | Ga0207698_102746892 | 212 |
| 368 | 3300005353 | Ga0070669_100069804 | Ga0070669_1000698043 | 213 |
| 369 | 3300005459 | Ga0068867_100127351 | Ga0068867_1001273512 | 213 |
| 370 | 3300005718 | Ga0068866_10071650 | Ga0068866_100716502 | 213 |
| 371 | 3300025923 | Ga0207681_10495074 | Ga0207681_104950742 | 213 |
| 372 | 3300005328 | Ga0070676_10019953 | Ga0070676_100199532 | 214 |
| 373 | 3300005330 | Ga0070690_100068051 | Ga0070690_1000680512 | 214 |
| 374 | 3300005356 | Ga0070674_100061989 | Ga0070674_1000619893 | 214 |
| 375 | 3300005441 | Ga0070700_100008003 | Ga0070700_1000080035 | 214 |
| 376 | 3300005457 | Ga0070662_100006003 | Ga0070662_1000060034 | 214 |
| 377 | 3300005467 | Ga0070706_100050717 | Ga0070706_1000507173 | 214 |
| 378 | 3300005471 | Ga0070698_100021929 | Ga0070698_1000219297 | 214 |
| 379 | 3300005536 | Ga0070697_100758748 | Ga0070697_1007587481 | 214 |
| 380 | 3300005544 | Ga0070686_100014767 | Ga0070686_1000147674 | 214 |
| 381 | 3300005843 | Ga0068860_100210819 | Ga0068860_1002108192 | 214 |
| 382 | 3300006881 | Ga0068865_100073262 | Ga0068865_1000732622 | 214 |
| 383 | 3300009098 | Ga0105245_10164684 | Ga0105245_101646842 | 214 |
| 384 | 3300013297 | Ga0157378_10014701 | Ga0157378_100147016 | 214 |
| 385 | 3300025899 | Ga0207642_10005679 | Ga0207642_100056792 | 214 |
| 386 | 3300025907 | Ga0207645_10010773 | Ga0207645_100107732 | 214 |
| 387 | 3300025918 | Ga0207662_10014059 | Ga0207662_100140592 | 214 |
| 388 | 3300025922 | Ga0207646_10266829 | Ga0207646_102668292 | 214 |
| 389 | 3300025933 | Ga0207706_10001172 | Ga0207706_100011722 | 214 |
| 390 | 3300026075 | Ga0207708_10049905 | Ga0207708_100499055 | 214 |
| 391 | 3300026089 | Ga0207648_10154382 | Ga0207648_101543822 | 214 |
| 392 | 3300005329 | Ga0070683_100063261 | Ga0070683_1000632613 | 215 |
| 393 | 3300005330 | Ga0070690_100215801 | Ga0070690_1002158012 | 215 |
| 394 | 3300005336 | Ga0070680_100000354 | Ga0070680_1000003547 | 215 |
| 395 | 3300005337 | Ga0070682_100000492 | Ga0070682_1000004926 | 215 |
| 396 | 3300005345 | Ga0070692_10014399 | Ga0070692_100143992 | 215 |
| 397 | 3300005364 | Ga0070673_100032682 | Ga0070673_1000326822 | 215 |
| 398 | 3300005458 | Ga0070681_10273188 | Ga0070681_102731881 | 215 |
| 399 | 3300005518 | Ga0070699_100241147 | Ga0070699_1002411472 | 215 |
| 400 | 3300005530 | Ga0070679_100000377 | Ga0070679_10000037728 | 215 |
| 401 | 3300005536 | Ga0070697_100059204 | Ga0070697_1000592043 | 215 |
| 402 | 3300005539 | Ga0068853_100035824 | Ga0068853_1000358243 | 215 |
| 403 | 3300005563 | Ga0068855_100189635 | Ga0068855_1001896352 | 215 |
| 404 | 3300009147 | Ga0114129_10186370 | Ga0114129_101863704 | 215 |
| 405 | 3300013296 | Ga0157374_10073752 | Ga0157374_100737522 | 215 |
| 406 | 3300025912 | Ga0207707_10002464 | Ga0207707_1000246411 | 215 |
| 407 | 3300025917 | Ga0207660_10014362 | Ga0207660_100143627 | 215 |
| 408 | 3300025921 | Ga0207652_10076188 | Ga0207652_100761882 | 215 |
| 409 | 3300025941 | Ga0207711_10118302 | Ga0207711_101183022 | 215 |
| 410 | 3300025949 | Ga0207667_10176585 | Ga0207667_101765852 | 215 |
| 411 | 3300046674 | Ga0495588_0011470 | Ga0495588_0011470_1769_2440 | 215 |
| 412 | 3300048915 | Ga0496112_0188485 | Ga0496112_0188485_393_1064 | 215 |
| 413 | 2162886012 | MBSR1b_contig_545708 | MBSR1b_0282.00005150 | 217 |
| 414 | 3300005293 | Ga0065715_10094902 | Ga0065715_100949025 | 217 |
| 415 | 3300005445 | Ga0070708_100000557 | Ga0070708_1000005572 | 217 |
| 416 | 3300005445 | Ga0070708_100116120 | Ga0070708_1001161202 | 217 |
| 417 | 3300005468 | Ga0070707_100017092 | Ga0070707_1000170926 | 217 |
| 418 | 3300005518 | Ga0070699_100796857 | Ga0070699_1007968571 | 217 |
| 419 | 3300005536 | Ga0070697_100202703 | Ga0070697_1002027032 | 217 |
| 420 | 3300006852 | Ga0075433_10007884 | Ga0075433_100078849 | 217 |
| 421 | 3300006871 | Ga0075434_100028012 | Ga0075434_1000280129 | 217 |
| 422 | 3300006914 | Ga0075436_100225073 | Ga0075436_1002250732 | 217 |
| 423 | 3300009174 | Ga0105241_10276886 | Ga0105241_102768861 | 217 |
| 424 | 3300025914 | Ga0207671_10026872 | Ga0207671_100268722 | 217 |
| 425 | 3300034816 | Ga0373930_0043548 | Ga0373930_0043548_145_822 | 217 |
| 426 | 3300034820 | Ga0373959_0020063 | Ga0373959_0020063_454_1131 | 217 |
| 427 | 3300035114 | Ga0373939_0106399 | Ga0373939_0106399_204_881 | 217 |
| 428 | 3300038996 | Ga0242420_006728 | Ga0242420_006728_989_1666 | 217 |
| 429 | 3300048915 | Ga0496112_0028047 | Ga0496112_0028047_3758_4435 | 217 |
| 430 | 3300048916 | Ga0496113_0089794 | Ga0496113_0089794_620_1297 | 217 |
| 431 | 3300050515 | nmdc:mga0a205_9732_c1 | nmdc:mga0a205_9732_c1_3282_3959 | 217 |
| 432 | 3300025909 | Ga0207705_10257492 | Ga0207705_102574922 | 221 |
| 433 | 3300000549 | LJQas_1008542 | LJQas_10085422 | 222 |
| 434 | 3300005293 | Ga0065715_10296232 | Ga0065715_102962322 | 222 |
| 435 | 3300005327 | Ga0070658_10002218 | Ga0070658_100022187 | 222 |
| 436 | 3300005327 | Ga0070658_10015518 | Ga0070658_100155182 | 222 |
| 437 | 3300005327 | Ga0070658_10176763 | Ga0070658_101767632 | 222 |
| 438 | 3300005327 | Ga0070658_10316322 | Ga0070658_103163222 | 222 |
| 439 | 3300005327 | Ga0070658_10392659 | Ga0070658_103926592 | 222 |
| 440 | 3300005327 | Ga0070658_10519911 | Ga0070658_105199112 | 222 |
| 441 | 3300005328 | Ga0070676_10015406 | Ga0070676_100154063 | 222 |
| 442 | 3300005329 | Ga0070683_100094528 | Ga0070683_1000945283 | 222 |
| 443 | 3300005329 | Ga0070683_100136769 | Ga0070683_1001367692 | 222 |
| 444 | 3300005334 | Ga0068869_100387468 | Ga0068869_1003874681 | 222 |
| 445 | 3300005335 | Ga0070666_10214304 | Ga0070666_102143042 | 222 |
| 446 | 3300005336 | Ga0070680_100078840 | Ga0070680_1000788403 | 222 |
| 447 | 3300005339 | Ga0070660_100009663 | Ga0070660_1000096635 | 222 |
| 448 | 3300005340 | Ga0070689_100023872 | Ga0070689_1000238722 | 222 |
| 449 | 3300005343 | Ga0070687_100123057 | Ga0070687_1001230572 | 222 |
| 450 | 3300005344 | Ga0070661_100052197 | Ga0070661_1000521972 | 222 |
| 451 | 3300005344 | Ga0070661_100309970 | Ga0070661_1003099702 | 222 |
| 452 | 3300005344 | Ga0070661_100310497 | Ga0070661_1003104972 | 222 |
| 453 | 3300005353 | Ga0070669_100044637 | Ga0070669_1000446374 | 222 |
| 454 | 3300005354 | Ga0070675_100130588 | Ga0070675_1001305882 | 222 |
| 455 | 3300005364 | Ga0070673_100024766 | Ga0070673_1000247662 | 222 |
| 456 | 3300005364 | Ga0070673_100181023 | Ga0070673_1001810232 | 222 |
| 457 | 3300005365 | Ga0070688_100005659 | Ga0070688_1000056592 | 222 |
| 458 | 3300005366 | Ga0070659_100025729 | Ga0070659_1000257292 | 222 |
| 459 | 3300005435 | Ga0070714_100001803 | Ga0070714_1000018036 | 222 |
| 460 | 3300005437 | Ga0070710_10076722 | Ga0070710_100767222 | 222 |
| 461 | 3300005439 | Ga0070711_100651224 | Ga0070711_1006512242 | 222 |
| 462 | 3300005457 | Ga0070662_100682475 | Ga0070662_1006824751 | 222 |
| 463 | 3300005466 | Ga0070685_10010783 | Ga0070685_100107832 | 222 |
| 464 | 3300005518 | Ga0070699_100251550 | Ga0070699_1002515502 | 222 |
| 465 | 3300005530 | Ga0070679_100224971 | Ga0070679_1002249712 | 222 |
| 466 | 3300005530 | Ga0070679_100422142 | Ga0070679_1004221423 | 222 |
| 467 | 3300005535 | Ga0070684_100110796 | Ga0070684_1001107963 | 222 |
| 468 | 3300005535 | Ga0070684_100156666 | Ga0070684_1001566662 | 222 |
| 469 | 3300005539 | Ga0068853_100049978 | Ga0068853_1000499784 | 222 |
| 470 | 3300005543 | Ga0070672_100267632 | Ga0070672_1002676322 | 222 |
| 471 | 3300005563 | Ga0068855_100054011 | Ga0068855_1000540114 | 222 |
| 472 | 3300005564 | Ga0070664_100035049 | Ga0070664_1000350493 | 222 |
| 473 | 3300005564 | Ga0070664_100209682 | Ga0070664_1002096822 | 222 |
| 474 | 3300005577 | Ga0068857_100027095 | Ga0068857_1000270957 | 222 |
| 475 | 3300005616 | Ga0068852_100005268 | Ga0068852_1000052687 | 222 |
| 476 | 3300005616 | Ga0068852_100101700 | Ga0068852_1001017002 | 222 |
| 477 | 3300005617 | Ga0068859_100059676 | Ga0068859_1000596762 | 222 |
| 478 | 3300005719 | Ga0068861_100034167 | Ga0068861_1000341672 | 222 |
| 479 | 3300005840 | Ga0068870_10003341 | Ga0068870_100033416 | 222 |
| 480 | 3300006931 | Ga0097620_100059675 | Ga0097620_1000596752 | 222 |
| 481 | 3300009094 | Ga0111539_10035036 | Ga0111539_100350362 | 222 |
| 482 | 3300013100 | Ga0157373_10105675 | Ga0157373_101056752 | 222 |
| 483 | 3300013102 | Ga0157371_10248033 | Ga0157371_102480332 | 222 |
| 484 | 3300013105 | Ga0157369_10006735 | Ga0157369_100067358 | 222 |
| 485 | 3300013105 | Ga0157369_10276582 | Ga0157369_102765822 | 222 |
| 486 | 3300013307 | Ga0157372_10001161 | Ga0157372_1000116124 | 222 |
| 487 | 3300013307 | Ga0157372_10029467 | Ga0157372_100294672 | 222 |
| 488 | 3300013307 | Ga0157372_10186834 | Ga0157372_101868343 | 222 |
| 489 | 3300013307 | Ga0157372_10560779 | Ga0157372_105607792 | 222 |
| 490 | 3300013308 | Ga0157375_10031948 | Ga0157375_100319487 | 222 |
| 491 | 3300014745 | Ga0157377_10061235 | Ga0157377_100612352 | 222 |
| 492 | 3300025315 | Ga0207697_10016206 | Ga0207697_100162065 | 222 |
| 493 | 3300025898 | Ga0207692_10159209 | Ga0207692_101592092 | 222 |
| 494 | 3300025901 | Ga0207688_10079061 | Ga0207688_100790612 | 222 |
| 495 | 3300025903 | Ga0207680_10202188 | Ga0207680_102021881 | 222 |
| 496 | 3300025908 | Ga0207643_10041580 | Ga0207643_100415802 | 222 |
| 497 | 3300025909 | Ga0207705_10005895 | Ga0207705_100058958 | 222 |
| 498 | 3300025909 | Ga0207705_10036993 | Ga0207705_100369933 | 222 |
| 499 | 3300025909 | Ga0207705_10103290 | Ga0207705_101032903 | 222 |
| 500 | 3300025909 | Ga0207705_10248380 | Ga0207705_102483802 | 222 |
| 501 | 3300025909 | Ga0207705_10371210 | Ga0207705_103712101 | 222 |
| 502 | 3300025909 | Ga0207705_10681323 | Ga0207705_106813231 | 222 |
| 503 | 3300025918 | Ga0207662_10011048 | Ga0207662_100110482 | 222 |
| 504 | 3300025919 | Ga0207657_10001987 | Ga0207657_1000198720 | 222 |
| 505 | 3300025919 | Ga0207657_10159653 | Ga0207657_101596531 | 222 |
| 506 | 3300025920 | Ga0207649_10069112 | Ga0207649_100691122 | 222 |
| 507 | 3300025920 | Ga0207649_10156190 | Ga0207649_101561902 | 222 |
| 508 | 3300025921 | Ga0207652_10209346 | Ga0207652_102093462 | 222 |
| 509 | 3300025921 | Ga0207652_10391075 | Ga0207652_103910751 | 222 |
| 510 | 3300025923 | Ga0207681_10018728 | Ga0207681_100187283 | 222 |
| 511 | 3300025926 | Ga0207659_10037533 | Ga0207659_100375332 | 222 |
| 512 | 3300025928 | Ga0207700_10237857 | Ga0207700_102378572 | 222 |
| 513 | 3300025929 | Ga0207664_10027237 | Ga0207664_100272374 | 222 |
| 514 | 3300025932 | Ga0207690_10135233 | Ga0207690_101352332 | 222 |
| 515 | 3300025936 | Ga0207670_10024466 | Ga0207670_100244662 | 222 |
| 516 | 3300025940 | Ga0207691_10027451 | Ga0207691_100274517 | 222 |
| 517 | 3300025940 | Ga0207691_10240106 | Ga0207691_102401062 | 222 |
| 518 | 3300025940 | Ga0207691_10268403 | Ga0207691_102684032 | 222 |
| 519 | 3300025942 | Ga0207689_10045028 | Ga0207689_100450287 | 222 |
| 520 | 3300025944 | Ga0207661_10036045 | Ga0207661_100360454 | 222 |
| 521 | 3300025945 | Ga0207679_10138519 | Ga0207679_101385192 | 222 |
| 522 | 3300025945 | Ga0207679_10501347 | Ga0207679_105013472 | 222 |
| 523 | 3300025949 | Ga0207667_10222990 | Ga0207667_102229902 | 222 |
| 524 | 3300025960 | Ga0207651_10313173 | Ga0207651_103131731 | 222 |
| 525 | 3300025960 | Ga0207651_10491610 | Ga0207651_104916102 | 222 |
| 526 | 3300025972 | Ga0207668_10088226 | Ga0207668_100882262 | 222 |
| 527 | 3300025986 | Ga0207658_10275557 | Ga0207658_102755572 | 222 |
| 528 | 3300026041 | Ga0207639_10037588 | Ga0207639_100375884 | 222 |
| 529 | 3300026116 | Ga0207674_10033328 | Ga0207674_100333287 | 222 |
| 530 | 3300028380 | Ga0268265_10295034 | Ga0268265_102950342 | 222 |
| 531 | 3300031995 | Ga0307409_100300426 | Ga0307409_1003004262 | 222 |
| 532 | 3300032005 | Ga0307411_10148556 | Ga0307411_101485562 | 222 |
| 533 | 3300032126 | Ga0307415_100438567 | Ga0307415_1004385671 | 222 |
| 534 | 3300048912 | Ga0496109_0153910 | Ga0496109_0153910_139_831 | 222 |
| 535 | 3300049569 | Ga0501032_0081206 | Ga0501032_0081206_1200_1889 | 222 |
| 536 | 3300049573 | Ga0501037_0054563 | Ga0501037_0054563_508_1197 | 222 |
| 537 | 3300049579 | Ga0501043_0012328 | Ga0501043_0012328_1556_2245 | 222 |
| 538 | 3300049581 | Ga0501047_0003790 | Ga0501047_0003790_10558_11247 | 222 |
| 539 | 3300049823 | Ga0501044_0185691 | Ga0501044_0185691_746_1435 | 222 |
| 540 | 3300050511 | nmdc:mga08y16_51769_c1 | nmdc:mga08y16_51769_c1_2909_3601 | 222 |
| 541 | 2162886012 | MBSR1b_contig_10986866 | MBSR1b_0022.00002660 | 223 |
| 542 | 3300005293 | Ga0065715_10095089 | Ga0065715_100950894 | 223 |
| 543 | 3300005293 | Ga0065715_10252904 | Ga0065715_102529042 | 223 |
| 544 | 3300005328 | Ga0070676_10241265 | Ga0070676_102412652 | 223 |
| 545 | 3300005329 | Ga0070683_100009728 | Ga0070683_1000097285 | 223 |
| 546 | 3300005336 | Ga0070680_100091843 | Ga0070680_1000918431 | 223 |
| 547 | 3300005337 | Ga0070682_100008751 | Ga0070682_1000087514 | 223 |
| 548 | 3300005434 | Ga0070709_10039769 | Ga0070709_100397693 | 223 |
| 549 | 3300005444 | Ga0070694_100009796 | Ga0070694_1000097962 | 223 |
| 550 | 3300005444 | Ga0070694_100117332 | Ga0070694_1001173321 | 223 |
| 551 | 3300005458 | Ga0070681_10545691 | Ga0070681_105456911 | 223 |
| 552 | 3300005468 | Ga0070707_100024874 | Ga0070707_1000248743 | 223 |
| 553 | 3300005471 | Ga0070698_100009782 | Ga0070698_1000097822 | 223 |
| 554 | 3300005518 | Ga0070699_100149293 | Ga0070699_1001492934 | 223 |
| 555 | 3300005535 | Ga0070684_100041085 | Ga0070684_1000410853 | 223 |
| 556 | 3300005545 | Ga0070695_100007270 | Ga0070695_1000072706 | 223 |
| 557 | 3300005563 | Ga0068855_100007038 | Ga0068855_1000070385 | 223 |
| 558 | 3300009098 | Ga0105245_10048971 | Ga0105245_100489711 | 223 |
| 559 | 3300009545 | Ga0105237_10007185 | Ga0105237_100071852 | 223 |
| 560 | 3300013102 | Ga0157371_10064836 | Ga0157371_100648362 | 223 |
| 561 | 3300013104 | Ga0157370_10481097 | Ga0157370_104810972 | 223 |
| 562 | 3300013105 | Ga0157369_10079689 | Ga0157369_100796894 | 223 |
| 563 | 3300013105 | Ga0157369_10524047 | Ga0157369_105240472 | 223 |
| 564 | 3300013307 | Ga0157372_10006551 | Ga0157372_100065513 | 223 |
| 565 | 3300025907 | Ga0207645_10192353 | Ga0207645_101923532 | 223 |
| 566 | 3300025912 | Ga0207707_10552243 | Ga0207707_105522431 | 223 |
| 567 | 3300025917 | Ga0207660_10384875 | Ga0207660_103848752 | 223 |
| 568 | 3300025917 | Ga0207660_10480972 | Ga0207660_104809721 | 223 |
| 569 | 3300025919 | Ga0207657_10041492 | Ga0207657_100414922 | 223 |
| 570 | 3300025921 | Ga0207652_10564579 | Ga0207652_105645792 | 223 |
| 571 | 3300025929 | Ga0207664_10048992 | Ga0207664_100489924 | 223 |
| 572 | 3300025944 | Ga0207661_10002811 | Ga0207661_100028119 | 223 |
| 573 | 3300025944 | Ga0207661_10512402 | Ga0207661_105124022 | 223 |
| 574 | 3300027543 | Ga0209999_1002000 | Ga0209999_10020002 | 223 |
| 575 | 3300027717 | Ga0209998_10000291 | Ga0209998_1000029113 | 223 |
| 576 | 3300031548 | Ga0307408_100181520 | Ga0307408_1001815202 | 223 |
| 577 | 3300031731 | Ga0307405_10015762 | Ga0307405_100157625 | 223 |
| 578 | 3300031731 | Ga0307405_10088896 | Ga0307405_100888962 | 223 |
| 579 | 3300031852 | Ga0307410_10046790 | Ga0307410_100467905 | 223 |
| 580 | 3300031852 | Ga0307410_10065830 | Ga0307410_100658304 | 223 |
| 581 | 3300031911 | Ga0307412_10061868 | Ga0307412_100618682 | 223 |
| 582 | 3300031911 | Ga0307412_10390834 | Ga0307412_103908342 | 223 |
| 583 | 3300031995 | Ga0307409_100063391 | Ga0307409_1000633912 | 223 |
| 584 | 3300031995 | Ga0307409_100080438 | Ga0307409_1000804385 | 223 |
| 585 | 3300031995 | Ga0307409_100292667 | Ga0307409_1002926672 | 223 |
| 586 | 3300032005 | Ga0307411_10048722 | Ga0307411_100487225 | 223 |
| 587 | 3300032126 | Ga0307415_100181485 | Ga0307415_1001814852 | 223 |
| 588 | 3300032126 | Ga0307415_100392508 | Ga0307415_1003925081 | 223 |
| 589 | 3300035170 | Ga0373943_0026246 | Ga0373943_0026246_341_1012 | 223 |
| 590 | 3300035692 | Ga0373935_0326761 | Ga0373935_0326761_296_967 | 223 |
| 591 | 3300044684 | Ga0466966_0005999 | Ga0466966_0005999_4342_5013 | 223 |
| 592 | 3300044684 | Ga0466966_0031561 | Ga0466966_0031561_2222_2896 | 223 |
| 593 | 3300045049 | Ga0466959_0050845 | Ga0466959_0050845_1945_2619 | 223 |
| 594 | 3300045049 | Ga0466959_0067153 | Ga0466959_0067153_903_1574 | 223 |
| 595 | 3300049651 | Ga0501201_005583 | Ga0501201_005583_20_691 | 223 |
| 596 | 3300049652 | Ga0501202_011881 | Ga0501202_011881_189_860 | 223 |
| 597 | 3300049656 | Ga0501209_022180 | Ga0501209_022180_257_928 | 223 |
| 598 | 3300049660 | Ga0501216_000507 | Ga0501216_000507_2636_3307 | 223 |
| 599 | 3300049664 | Ga0501224_011773 | Ga0501224_011773_176_847 | 223 |
| 600 | 3300049665 | Ga0501227_001814 | Ga0501227_001814_2053_2724 | 223 |
| 601 | 3300049668 | Ga0501233_001266 | Ga0501233_001266_3089_3760 | 223 |
| 602 | 3300049669 | Ga0501235_000951 | Ga0501235_000951_2724_3395 | 223 |
| 603 | 3300049673 | Ga0501240_023143 | Ga0501240_023143_256_927 | 223 |
| 604 | 3300049675 | Ga0501243_002882 | Ga0501243_002882_104_775 | 223 |
| 605 | 3300049680 | Ga0501250_013186 | Ga0501250_013186_159_830 | 223 |
| 606 | 3300049688 | Ga0501259_002588 | Ga0501259_002588_1232_1903 | 223 |
| 607 | 3300049705 | Ga0501225_0008444 | Ga0501225_0008444_224_895 | 223 |
| 608 | 3300049707 | Ga0501234_002610 | Ga0501234_002610_247_918 | 223 |
| 609 | 3300049757 | Ga0501232_027140 | Ga0501232_027140_49_720 | 223 |
| 610 | 3300049760 | Ga0501263_006353 | Ga0501263_006353_305_976 | 223 |
| 611 | 3300049761 | Ga0501264_002675 | Ga0501264_002675_631_1302 | 223 |
| 612 | 3300049763 | Ga0501266_000428 | Ga0501266_000428_262_933 | 223 |
| 613 | 3300049765 | Ga0501268_003987 | Ga0501268_003987_610_1281 | 223 |
| 614 | 3300049767 | Ga0501270_002989 | Ga0501270_002989_1059_1730 | 223 |
| 615 | 3300049768 | Ga0501271_002764 | Ga0501271_002764_532_1203 | 223 |
| 616 | 3300049851 | Ga0501212_024949 | Ga0501212_024949_176_847 | 223 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7drk-assembly1.cif.gz_B | crystal structure of phosphatidylglycerol phosphate synthase in complex with cytidine diphosphate-diacylglycerol | 0.6229 | 1 | 206 |
| 7drk-assembly1.cif.gz_B | crystal structure of phosphatidylglycerol phosphate synthase in complex with cytidine diphosphate-diacylglycerol | 0.6173 | 1 | 206 |
| 8dz8-assembly8.cif.gz_H | neoleukin 4, a de novo designed il-4 mimetic | 0.5582 | 4 | 73 |
| 4q7c-assembly1.cif.gz_A | structure of af2299, a cdp-alcohol phosphotransferase | 0.5385 | 4 | 200 |
| 4o6m-assembly1.cif.gz_A | structure of af2299, a cdp-alcohol phosphotransferase (cmp-bound) | 0.5335 | 4 | 200 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WPG3_21_202_1.20.120.1760 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.8541 | 2 | 219 | 1.20.120.1760 |
| af_P9WPG3_21_202_1.20.120.1760 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.8193 | 2 | 219 | 1.20.120.1760 |
| af_P9WPG5_6_192_1.20.120.1760 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.8078 | 1 | 218 | 1.20.120.1760 |
| af_A0A1D6JYP0_117_317_1.20.120.1760 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.7794 | 1 | 219 | 1.20.120.1760 |
| af_P9WPG5_6_192_1.20.120.1760 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.7647 | 1 | 218 | 1.20.120.1760 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V7E918-F1-model_v4 | CinA-like protein | 0.9848 | 1 | 215 |
GO:0008654
GO:0016020 GO:0016780 |
| AF-A0A2V7JLN2-F1-model_v4 | CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase | 0.9765 | 2 | 220 |
GO:0016020
GO:0016780 GO:0046474 |
| AF-A0A2V7JLN2-F1-model_v4 | CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase | 0.9677 | 2 | 220 |
GO:0016020
GO:0016780 GO:0046474 |
| AF-A0A2V7E918-F1-model_v4 | CinA-like protein | 0.9584 | 1 | 215 |
GO:0008654
GO:0016020 GO:0016780 |
| AF-A0A2V7T0W3-F1-model_v4 | CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase | 0.9544 | 1 | 220 |
GO:0016020
GO:0016780 GO:0046474 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar