F469573

General Info

Members Datasets Scaffolds Average Seq Length
616 368 566 326

Family's Representative Sequence

Representative Sequence 3300046476|Ga0495662_0004049|Ga0495662_0004049_5440_6549
Length 369
Sequence MLSTPDRLSPSLREEGTPMTSSPTTMRAVQLSAPGPVDNLRPATLPLPPERDGWVRIRVEAFGLNRSELKLRLGVSEGVSFPRVPGIEAAGTVDAAPADSGLVPGQKVVAMMGDMGRTYDGGYAEYTSVPLSQVIPVDTDLPWEVLGALPEMVQTAYGSLTVGLDLQPGQSVLIRGGTSSVGLAAAALATWRGATVLSTTRRPDRLALLKERGVDHPLLDTGEVAPAVRELYPSGVDAALDLVGTPTLPDTLRAVRVHGTACFGGSLSNQWTVRDFSPNEYLPRGVRLAGYFGDASDLSPAVFQEILDAVAAGQLAFPVDRVYDGLEQVPQAHDDMEHDRATGKLVVRVRHQHGGLERDAGGASASALA

Samples

Sample ID Description Type Environment
1 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
2 2558860280 Kutzneria sp. 744 Isolate Unclassified
3 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
4 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
5 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
6 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
7 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
8 2643221576 Nocardioides sp. Root614 Isolate Unclassified
9 2643221590 Nocardioides sp. Root682 Isolate Unclassified
10 2643221617 Nocardioides sp. Root79 Isolate Unclassified
11 2643221620 Nocardioides sp. Root240 Isolate Unclassified
12 2643221647 Streptomyces sp. Root369 Isolate Unclassified
13 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
14 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
15 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
16 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
17 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
18 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
19 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
20 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
21 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
22 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
23 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified
24 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
25 2867428634 Streptomyces sp. RP5T Isolate Unclassified
26 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
27 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
28 2922554459 Rhodococcus sp. 66b Isolate Unclassified
29 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere
30 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
31 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
32 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
33 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
34 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
35 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
36 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
37 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
38 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
39 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
40 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
41 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
42 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
43 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
44 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
45 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
46 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
47 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
48 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
49 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
50 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
51 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
52 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
53 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
54 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
55 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
56 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
57 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
58 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
59 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
60 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
61 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
62 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
63 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
64 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
65 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
66 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
67 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
68 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
69 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
70 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
71 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
72 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
73 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
74 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
75 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
76 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
77 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
78 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
79 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
80 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
81 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
82 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
83 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
84 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
85 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
86 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
87 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
88 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
89 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
90 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
91 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
92 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
93 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
94 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
95 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
96 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
97 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
98 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
99 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
100 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
101 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
102 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
103 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
104 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
105 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
106 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
107 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
109 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
110 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
111 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
112 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
113 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
114 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
115 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
116 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
117 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
118 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
119 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
120 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
121 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
122 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
123 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
124 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
125 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
126 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
127 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
128 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
129 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
131 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
132 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
133 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
134 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
183 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
187 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
188 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
189 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
190 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
191 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
192 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
193 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
194 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
195 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
196 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
197 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
198 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
199 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
200 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
201 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
202 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
203 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
204 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
205 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
206 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
207 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
208 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
209 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
210 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
211 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
212 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
213 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
214 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
215 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
216 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
217 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
218 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
219 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
220 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
221 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
222 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
223 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
224 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
225 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
226 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
227 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
228 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
229 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
230 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
231 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
232 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
233 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
234 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
235 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
236 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
237 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
238 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
239 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
240 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
241 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
242 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
243 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
244 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
245 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
246 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
247 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
248 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
249 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
250 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
251 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
252 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
253 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
254 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
255 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
256 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
257 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
258 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
259 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
260 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
261 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
262 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
263 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
264 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
265 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
266 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
267 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
268 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
269 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
270 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
271 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
272 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
273 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
274 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
275 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
276 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
277 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
278 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
279 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
280 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
281 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
282 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
283 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
284 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
285 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
286 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
287 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
288 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
289 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
290 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
291 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
292 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
293 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
294 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
295 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
296 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
297 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
298 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
299 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
300 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
301 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
302 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
303 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
304 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
305 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
306 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
307 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
308 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
309 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
310 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
311 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
312 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
313 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
314 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
315 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
318 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
320 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
321 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
323 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
324 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
325 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
326 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
327 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
328 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
329 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
330 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
331 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
332 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
333 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
334 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
335 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
336 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
337 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
338 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
339 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
340 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
341 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
342 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
343 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
344 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
345 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
346 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
347 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
348 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
349 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
350 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
351 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
352 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
353 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
354 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
355 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
356 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
357 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
358 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
359 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
360 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
361 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
362 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
363 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
364 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
365 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
366 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
367 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
368 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 91.56
Metatranscriptomes 0.32
Isolates 8.12

Biome Distribution

Category Percentage (%)
Aerial Root 0.16
Bulb 0
Endosphere 8.44
Nodule 0.32
Rhizoplane 8.44
Rhizosphere 71.27
Stem 0
Stem Tuber 0
Unclassified 11.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10049646 3300001990 Bacteria 1276
2 JGI25151J46595_10000769 3300003187 Bacteria 25987
3 rootH1_10053053 3300003316 Bacteria 4362
4 rootH1_10041438 3300003323 Bacteria 3359
5 Ga0070658_10089133 3300005327 Bacteria 2540
6 Ga0070676_10077517 3300005328 Bacteria 2009
7 Ga0070683_100248091 3300005329 Bacteria 1693
8 Ga0070670_100051560 3300005331 Bacteria 3533
9 Ga0068869_100009466 3300005334 Bacteria 6322
10 Ga0068869_100376377 3300005334 Bacteria 1163
11 Ga0070680_100021304 3300005336 Bacteria 5150
12 Ga0070680_100039866 3300005336 Bacteria 3801
13 Ga0070682_100123974 3300005337 Unclassified 1739
14 Ga0070660_100042237 3300005339 Bacteria 3479
15 Ga0070689_100044844 3300005340 Bacteria 3403
16 Ga0070691_10036013 3300005341 Bacteria 2332
17 Ga0070661_100042434 3300005344 Bacteria 3320
18 Ga0070692_10012861 3300005345 Bacteria 3887
19 Ga0070668_100013949 3300005347 Bacteria 6008
20 Ga0070668_100045665 3300005347 Bacteria 3361
21 Ga0070675_100013573 3300005354 Bacteria 6406
22 Ga0070671_100001046 3300005355 Bacteria 20386
23 Ga0070671_100018102 3300005355 Bacteria 5719
24 Ga0070709_10114926 3300005434 Bacteria 1814
25 Ga0070709_10134016 3300005434 Bacteria 1694
26 Ga0070714_100019448 3300005435 Bacteria 5534
27 Ga0070714_100029866 3300005435 Bacteria 4534
28 Ga0070714_100040151 3300005435 Bacteria 3943
29 Ga0070714_100094693 3300005435 Bacteria 2621
30 Ga0070714_100156243 3300005435 Bacteria 2059
31 Ga0070714_100221932 3300005435 Bacteria 1737
32 Ga0070714_100491348 3300005435 Bacteria 1169
33 Ga0070713_100012145 3300005436 Bacteria 6307
34 Ga0070713_100206272 3300005436 Bacteria 1777
35 Ga0070713_100303915 3300005436 Bacteria 1469
36 Ga0070713_100429742 3300005436 Bacteria 1237
37 Ga0070710_10021580 3300005437 Bacteria 3358
38 Ga0070710_10022589 3300005437 Bacteria 3293
39 Ga0070710_10024425 3300005437 Bacteria 3188
40 Ga0070710_10039256 3300005437 Bacteria 2604
41 Ga0070710_10043380 3300005437 Bacteria 2491
42 Ga0070710_10070421 3300005437 Bacteria 2014
43 Ga0070711_100043287 3300005439 Bacteria 3049
44 Ga0070708_100143684 3300005445 Bacteria 2214
45 Ga0070708_100179380 3300005445 Bacteria 1979
46 Ga0070663_100005950 3300005455 Bacteria 7301
47 Ga0070663_100009489 3300005455 Bacteria 6028
48 Ga0070663_100135328 3300005455 Bacteria 1876
49 Ga0070663_100255333 3300005455 Bacteria 1389
50 Ga0070678_100011405 3300005456 Bacteria 5481
51 Ga0070681_10022171 3300005458 Bacteria 6374
52 Ga0070681_10040295 3300005458 Bacteria 4680
53 Ga0070706_100003816 3300005467 Bacteria 14727
54 Ga0070706_100006313 3300005467 Bacteria 11197
55 Ga0070707_100047224 3300005468 Plasmid 4121
56 Ga0070698_100198624 3300005471 Bacteria 1941
57 Ga0070679_100093227 3300005530 Bacteria 2999
58 Ga0070672_100148946 3300005543 Bacteria 1935
59 Ga0070686_100118353 3300005544 Bacteria 1815
60 Ga0070686_100244121 3300005544 Bacteria 1309
61 Ga0070693_100002076 3300005547 Bacteria 9168
62 Ga0070665_100025406 3300005548 Bacteria 5969
63 Ga0070665_100080901 3300005548 Bacteria 3254
64 Ga0070665_100085505 3300005548 Bacteria 3159
65 Ga0070665_100299521 3300005548 Bacteria 1611
66 Ga0068855_100022930 3300005563 Bacteria 7482
67 Ga0068855_100269422 3300005563 Bacteria 1894
68 Ga0068857_100168394 3300005577 Bacteria 1991
69 Ga0068857_100169096 3300005577 Bacteria 1986
70 Ga0068854_100021103 3300005578 Bacteria 4416
71 Ga0068854_100036359 3300005578 Bacteria 3452
72 Ga0068856_100026135 3300005614 Bacteria 5692
73 Ga0068856_100133767 3300005614 Bacteria 2485
74 Ga0068856_100149698 3300005614 Bacteria 2343
75 Ga0068856_100414784 3300005614 Bacteria 1367
76 Ga0070702_100033876 3300005615 Bacteria 2811
77 Ga0068852_100011084 3300005616 Bacteria 6769
78 Ga0068852_100018355 3300005616 Bacteria 5510
79 Ga0068852_100043303 3300005616 Bacteria 3817
80 Ga0068859_100058411 3300005617 Bacteria 3886
81 Ga0068859_100471998 3300005617 Bacteria 1350
82 Ga0068864_100060920 3300005618 Bacteria 3268
83 Ga0068870_10012123 3300005840 Bacteria 4019
84 Ga0068870_10015112 3300005840 Bacteria 3656
85 Ga0068863_100091661 3300005841 Bacteria 2882
86 Ga0068858_100017388 3300005842 Bacteria 6746
87 Ga0068860_100207870 3300005843 Bacteria 1898
88 Ga0068860_100272859 3300005843 Bacteria 1651
89 Ga0068862_100554305 3300005844 Bacteria 1098
90 Ga0075365_10022559 3300006038 Bacteria 3946
91 Ga0075365_10036575 3300006038 Bacteria 3181
92 Ga0075365_10037810 3300006038 Bacteria 3134
93 Ga0075364_10032174 3300006051 Bacteria 3370
94 Ga0075367_10012007 3300006178 Bacteria 4601
95 Ga0075369_10003754 3300006186 Bacteria 5555
96 Ga0075369_10053157 3300006186 Bacteria 1757
97 Ga0075370_10010023 3300006353 Bacteria 4941
98 Ga0075370_10087778 3300006353 Bacteria 1792
99 Ga0068871_100287482 3300006358 Bacteria 1440
100 Ga0075430_100000153 3300006846 Bacteria 44870
101 Ga0075431_100003539 3300006847 Bacteria 15125
102 Ga0075429_100080704 3300006880 Bacteria 2836
103 Ga0075436_100089276 3300006914 Bacteria 2141
104 Ga0097620_100058410 3300006931 Bacteria 3886
105 Ga0097620_100472003 3300006931 Bacteria 1350
106 Ga0099794_10078094 3300007265 Bacteria 1630
107 Ga0105240_10034163 3300009093 Bacteria 6562
108 Ga0111539_10000053 3300009094 Bacteria 115976
109 Ga0111539_10027595 3300009094 Bacteria 6934
110 Ga0111539_10035413 3300009094 Bacteria 6044
111 Ga0105245_10048790 3300009098 Bacteria 3788
112 Ga0105245_10115652 3300009098 Bacteria 2500
113 Ga0105241_10143173 3300009174 Bacteria 1949
114 Ga0105248_10031176 3300009177 Bacteria 5959
115 Ga0105237_10019291 3300009545 Bacteria 7044
116 Ga0105237_10101540 3300009545 Bacteria 2868
117 Ga0105237_10248185 3300009545 Bacteria 1782
118 Ga0105238_10021125 3300009551 Bacteria 6634
119 Ga0105238_10053988 3300009551 Bacteria 4037
120 Ga0105238_10059219 3300009551 Bacteria 3837
121 Ga0105249_10178605 3300009553 Bacteria 2064
122 Ga0099796_10002604 3300010159 Bacteria 4004
123 Ga0105239_10127048 3300010375 Bacteria 2835
124 Ga0105246_10005389 3300011119 Bacteria 7788
125 Ga0157373_10024658 3300013100 Bacteria 4356
126 Ga0157371_10034782 3300013102 Bacteria 3613
127 Ga0157370_10039800 3300013104 Bacteria 4541
128 Ga0157370_10050565 3300013104 Bacteria 3972
129 Ga0157369_10102172 3300013105 Bacteria 3055
130 Ga0157374_10020541 3300013296 Bacteria 5861
131 Ga0157374_10060763 3300013296 Bacteria 3537
132 Ga0157374_10169788 3300013296 Bacteria 2127
133 Ga0163162_10205612 3300013306 Bacteria 2098
134 Ga0163162_10408358 3300013306 Bacteria 1491
135 Ga0157372_10094799 3300013307 Bacteria 3399
136 Ga0157372_10665523 3300013307 Unclassified 1212
137 Ga0157375_10164341 3300013308 Bacteria 2364
138 Ga0163163_10224422 3300014325 Bacteria 1928
139 Ga0157377_10017106 3300014745 Bacteria 3745
140 Ga0157379_10008747 3300014968 Bacteria 8824
141 Ga0157379_10121175 3300014968 Bacteria 2353
142 Ga0157379_10167057 3300014968 Bacteria 1986
143 Ga0157379_10224513 3300014968 Bacteria 1702
144 Ga0183367_1001 3300015688 Bacteria 1225545
145 Ga0206354_10846943 3300020081 Bacteria 1924
146 Ga0206353_10999702 3300020082 Bacteria 2340
147 Ga0213875_10119799 3300021388 Bacteria 1230
148 Ga0209129_1005596 3300025258 Bacteria 4374
149 Ga0209025_1000238 3300025294 Bacteria 128478
150 Ga0207692_10007199 3300025898 Bacteria 4547
151 Ga0207692_10020494 3300025898 Bacteria 3008
152 Ga0207692_10052261 3300025898 Bacteria 2076
153 Ga0207692_10096169 3300025898 Bacteria 1616
154 Ga0207710_10011014 3300025900 Bacteria 3809
155 Ga0207688_10004087 3300025901 Bacteria 7951
156 Ga0207647_10016829 3300025904 Bacteria 4982
157 Ga0207647_10030328 3300025904 Bacteria 3490
158 Ga0207685_10013593 3300025905 Bacteria 2523
159 Ga0207699_10047042 3300025906 Bacteria 2527
160 Ga0207643_10000320 3300025908 Bacteria 33014
161 Ga0207643_10018843 3300025908 Bacteria 3781
162 Ga0207705_10171379 3300025909 Bacteria 1634
163 Ga0207684_10000572 3300025910 Bacteria 44774
164 Ga0207684_10017279 3300025910 Bacteria 6188
165 Ga0207684_10336492 3300025910 Bacteria 1300
166 Ga0207654_10010884 3300025911 Bacteria 4630
167 Ga0207654_10018963 3300025911 Bacteria 3619
168 Ga0207707_10003499 3300025912 Bacteria 13902
169 Ga0207707_10132784 3300025912 Bacteria 2177
170 Ga0207695_10007844 3300025913 Bacteria 13497
171 Ga0207695_10084442 3300025913 Bacteria 3206
172 Ga0207695_10333529 3300025913 Bacteria 1405
173 Ga0207695_10371672 3300025913 Bacteria 1316
174 Ga0207671_10000128 3300025914 Bacteria 117836
175 Ga0207671_10004312 3300025914 Bacteria 13675
176 Ga0207671_10206507 3300025914 Bacteria 1535
177 Ga0207693_10033591 3300025915 Bacteria 4047
178 Ga0207693_10037038 3300025915 Bacteria 3845
179 Ga0207693_10045847 3300025915 Bacteria 3434
180 Ga0207693_10167531 3300025915 Bacteria 1730
181 Ga0207663_10027738 3300025916 Bacteria 3305
182 Ga0207663_10228053 3300025916 Bacteria 1359
183 Ga0207657_10212793 3300025919 Bacteria 1551
184 Ga0207649_10049456 3300025920 Bacteria 2597
185 Ga0207646_10018661 3300025922 Bacteria 6466
186 Ga0207646_10105726 3300025922 Bacteria 2524
187 Ga0207650_10030103 3300025925 Bacteria 3907
188 Ga0207659_10237032 3300025926 Bacteria 1474
189 Ga0207687_10020072 3300025927 Bacteria 4432
190 Ga0207700_10017397 3300025928 Bacteria 4801
191 Ga0207700_10121435 3300025928 Bacteria 2119
192 Ga0207700_10129643 3300025928 Bacteria 2057
193 Ga0207700_10185332 3300025928 Bacteria 1745
194 Ga0207664_10015710 3300025929 Bacteria 5504
195 Ga0207664_10025275 3300025929 Bacteria 4471
196 Ga0207664_10030369 3300025929 Bacteria 4126
197 Ga0207644_10000937 3300025931 Bacteria 18559
198 Ga0207644_10021755 3300025931 Bacteria 4373
199 Ga0207690_10020389 3300025932 Bacteria 4096
200 Ga0207706_10272702 3300025933 Bacteria 1476
201 Ga0207686_10213512 3300025934 Bacteria 1389
202 Ga0207665_10050991 3300025939 Bacteria 2784
203 Ga0207665_10141037 3300025939 Bacteria 1718
204 Ga0207691_10115416 3300025940 Bacteria 2384
205 Ga0207689_10018038 3300025942 Bacteria 5960
206 Ga0207661_10009547 3300025944 Bacteria 6964
207 Ga0207679_10006069 3300025945 Bacteria 7617
208 Ga0207667_10044156 3300025949 Bacteria 4724
209 Ga0207668_10037346 3300025972 Bacteria 3250
210 Ga0207640_10134746 3300025981 Bacteria 1791
211 Ga0207677_10004031 3300026023 Bacteria 7841
212 Ga0207703_10016168 3300026035 Bacteria 5816
213 Ga0207703_10074891 3300026035 Bacteria 2804
214 Ga0207703_10197546 3300026035 Bacteria 1785
215 Ga0207639_10319921 3300026041 Bacteria 1377
216 Ga0207678_10000094 3300026067 Bacteria 74360
217 Ga0207678_10075872 3300026067 Bacteria 2880
218 Ga0207708_10072017 3300026075 Bacteria 2648
219 Ga0207702_10013617 3300026078 Bacteria 6755
220 Ga0207702_10100318 3300026078 Bacteria 2554
221 Ga0207702_10156663 3300026078 Bacteria 2077
222 Ga0207641_10069736 3300026088 Bacteria 3020
223 Ga0207641_10128323 3300026088 Bacteria 2273
224 Ga0207641_10273869 3300026088 Unclassified 1585
225 Ga0207676_10039831 3300026095 Bacteria 3597
226 Ga0207676_10452349 3300026095 Bacteria 1211
227 Ga0207674_10166648 3300026116 Bacteria 2157
228 Ga0207674_10216035 3300026116 Bacteria 1866
229 Ga0207675_100472221 3300026118 Bacteria 1245
230 Ga0207683_10040447 3300026121 Bacteria 4068
231 Ga0207698_10083755 3300026142 Bacteria 2582
232 Ga0207698_10094713 3300026142 Bacteria 2456
233 Ga0207698_10250505 3300026142 Bacteria 1620
234 Ga0209179_1002691 3300027512 Bacteria 2447
235 Ga0207428_10000061 3300027907 Bacteria 155152
236 Ga0207428_10044090 3300027907 Bacteria 3599
237 Ga0268266_10101673 3300028379 Bacteria 2534
238 Ga0268266_10308046 3300028379 Bacteria 1479
239 Ga0268266_10446837 3300028379 Bacteria 1228
240 Ga0268265_10301100 3300028380 Bacteria 1444
241 Ga0268264_10174958 3300028381 Bacteria 1945
242 Ga0307517_10007075 3300028786 Bacteria 16452
243 Ga0307517_10062147 3300028786 Bacteria 3518
244 Ga0307517_10141210 3300028786 Bacteria 1690
245 Ga0307515_10000054 3300028794 Bacteria 265489
246 Ga0307515_10000506 3300028794 Bacteria 93172
247 Ga0265338_10018231 3300028800 Bacteria 7524
248 Ga0307511_10000238 3300030521 Bacteria 56455
249 Ga0307511_10000290 3300030521 Bacteria 52945
250 Ga0307511_10133628 3300030521 Bacteria 1485
251 Ga0316178_1058387 3300030735 Bacteria 2280
252 Ga0316182_1430484 3300030745 Bacteria 1781
253 Ga0307509_10044423 3300031507 Bacteria 4801
254 Ga0307509_10049988 3300031507 Bacteria 4479
255 Ga0307509_10109537 3300031507 Bacteria 2771
256 Ga0307408_100238547 3300031548 Bacteria 1493
257 Ga0307508_10001814 3300031616 Bacteria 23664
258 Ga0307508_10102062 3300031616 Bacteria 2465
259 Ga0307514_10033652 3300031649 Bacteria 4089
260 Ga0307516_10001002 3300031730 Bacteria 39096
261 Ga0307516_10015060 3300031730 Bacteria 8152
262 Ga0307413_10291866 3300031824 Bacteria 1232
263 Ga0307518_10017622 3300031838 Bacteria 5120
264 Ga0307518_10056347 3300031838 Bacteria 2855
265 Ga0307410_10007200 3300031852 Bacteria 6072
266 Ga0307410_10008780 3300031852 Bacteria 5629
267 Ga0326468_10001733 3300031889 Bacteria 1871
268 Ga0307406_10000031 3300031901 Bacteria 87391
269 Ga0307406_10012500 3300031901 Bacteria 4839
270 Ga0307406_10095206 3300031901 Bacteria 2014
271 Ga0307406_10118269 3300031901 Bacteria 1837
272 Ga0307409_100003063 3300031995 Bacteria 8943
273 Ga0307416_100071809 3300032002 Bacteria 2878
274 Ga0307416_100079778 3300032002 Bacteria 2760
275 Ga0307411_10003015 3300032005 Bacteria 7678
276 Ga0307507_10000008 3300033179 Bacteria 266336
277 Ga0307507_10032691 3300033179 Bacteria 5424
278 Ga0307507_10053330 3300033179 Bacteria 3864
279 Ga0307510_10048199 3300033180 Bacteria 4549
280 Ga0307510_10085969 3300033180 Bacteria 3018
281 Ga0307510_10248956 3300033180 Bacteria 1266
282 Ga0373934_0048507 3300035086 Bacteria 1681
283 Ga0373936_0055295 3300035113 Bacteria 1611
284 Ga0373954_0044835 3300035118 Bacteria 2065
285 Ga0373943_0073750 3300035170 Archaea 1734
286 Ga0373955_0031223 3300035172 Bacteria 2789
287 Ga0373924_0005353 3300035410 Bacteria 4539
288 Ga0373935_0045207 3300035692 Archaea 2778
289 Ga0373927_0147362 3300035695 Archaea 1541
290 Ga0373933_0046743 3300035724 Bacteria 2571
291 Ga0373937_0023231 3300036401 Bacteria 5582
292 Ga0373937_0109191 3300036401 Bacteria 2572
293 Ga0373937_0449116 3300036401 Bacteria 1224
294 Ga0373925_0001664 3300037068 Bacteria 18719
295 Ga0373925_0079338 3300037068 Archaea 2494
296 Ga0395900_0156704 3300037418 Bacteria 2326
297 Ga0395898_0046801 3300037466 Bacteria 4248
298 Ga0395898_0293107 3300037466 Bacteria 1552
299 Ga0436364_0439304 3300037853 Bacteria 6424
300 Ga0436364_1360742 3300037853 Unclassified 1329
301 Ga0395901_0094126 3300038443 Bacteria 3138
302 Ga0436361_0931125 3300039447 Bacteria 3524
303 Ga0451789_0538276 3300041443 Bacteria 2103
304 Ga0451793_1839129 3300041452 Bacteria 1082
305 Ga0451795_1077384 3300041456 Bacteria 2698
306 Ga0451833_0871186 3300041491 Bacteria 1343
307 Ga0451835_0730700 3300041492 Bacteria 1239
308 Ga0451853_0096543 3300041512 Bacteria 4047
309 Ga0451853_0677297 3300041512 Bacteria 2429
310 Ga0451853_3283600 3300041512 Bacteria 2278
311 Ga0439455_0007474 3300042012 Bacteria 2312
312 Ga0450903_002650 3300042138 Bacteria 3152
313 Ga0466970_0020206 3300044765 Bacteria 3458
314 Ga0495592_0017133 3300046454 Bacteria 5501
315 Ga0495592_0155514 3300046454 Bacteria 1578
316 Ga0495603_0014154 3300046455 Bacteria 4827
317 Ga0495603_0117531 3300046455 Bacteria 1550
318 Ga0495603_0176268 3300046455 Bacteria 1238
319 Ga0495590_0001720 3300046457 Bacteria 9307
320 Ga0495629_0076868 3300046459 Bacteria 2330
321 Ga0495629_0128739 3300046459 Bacteria 1763
322 Ga0495629_0178857 3300046459 Bacteria 1471
323 Ga0495638_0072207 3300046460 Bacteria 2110
324 Ga0495638_0083278 3300046460 Bacteria 1938
325 Ga0495638_0105316 3300046460 Bacteria 1681
326 Ga0495651_0000193 3300046462 Bacteria 45921
327 Ga0495651_0015837 3300046462 Bacteria 5836
328 Ga0495651_0086491 3300046462 Bacteria 2358
329 Ga0495653_0010123 3300046463 Bacteria 7715
330 Ga0495653_0043720 3300046463 Bacteria 3481
331 Ga0495653_0052292 3300046463 Bacteria 3131
332 Ga0495580_0155318 3300046472 Archaea 1585
333 Ga0495580_0222424 3300046472 Bacteria 1297
334 Ga0495582_0035575 3300046473 Bacteria 2739
335 Ga0495582_0081614 3300046473 Bacteria 1796
336 Ga0495582_0156392 3300046473 Bacteria 1295
337 Ga0495639_0067458 3300046475 Bacteria 1648
338 Ga0495662_0004049 3300046476 Bacteria 7382
339 Ga0495662_0013950 3300046476 Bacteria 3911
340 Ga0495662_0019331 3300046476 Bacteria 3294
341 Ga0495664_0002297 3300046477 Bacteria 10249
342 Ga0495664_0009794 3300046477 Bacteria 5373
343 Ga0495664_0039666 3300046477 Bacteria 2783
344 Ga0495664_0210241 3300046477 Bacteria 1178
345 Ga0495584_0210294 3300046491 Bacteria 989
346 Ga0495594_0049224 3300046499 Bacteria 2316
347 Ga0495607_0162228 3300046501 Bacteria 1135
348 Ga0495583_0029841 3300046506 Bacteria 2664
349 Ga0495608_0021626 3300046511 Bacteria 4414
350 Ga0495608_0051382 3300046511 Bacteria 2732
351 Ga0495618_0049259 3300046514 Bacteria 2660
352 Ga0495618_0122400 3300046514 Bacteria 1666
353 Ga0495620_0010421 3300046515 Bacteria 4906
354 Ga0495628_0034116 3300046516 Bacteria 4096
355 Ga0495628_0171425 3300046516 Bacteria 1645
356 Ga0495630_0052374 3300046517 Bacteria 3055
357 Ga0495630_0283345 3300046517 Bacteria 1266
358 Ga0495652_0006723 3300046529 Bacteria 10673
359 Ga0495652_0039169 3300046529 Bacteria 4099
360 Ga0495652_0186237 3300046529 Bacteria 1588
361 Ga0495665_0054965 3300046531 Bacteria 2103
362 Ga0495640_0008530 3300046533 Bacteria 8032
363 Ga0495586_0039866 3300046535 Bacteria 2525
364 Ga0495587_0001614 3300046536 Bacteria 15003
365 Ga0495587_0003615 3300046536 Bacteria 10289
366 Ga0495587_0055277 3300046536 Bacteria 2338
367 Ga0495645_0024742 3300046543 Bacteria 4357
368 Ga0495645_0027710 3300046543 Bacteria 4115
369 Ga0495645_0235717 3300046543 Bacteria 1223
370 Ga0495622_0051713 3300046557 Bacteria 1906
371 Ga0495667_0006676 3300046559 Bacteria 7831
372 Ga0495667_0023204 3300046559 Bacteria 4180
373 Ga0495667_0091484 3300046559 Bacteria 1970
374 Ga0495667_0154919 3300046559 Bacteria 1475
375 Ga0495667_0236302 3300046559 Bacteria 1165
376 Ga0495668_0028362 3300046616 Bacteria 3166
377 Ga0495634_0005177 3300046642 Bacteria 10076
378 Ga0495634_0055408 3300046642 Bacteria 2651
379 Ga0495625_0043674 3300046660 Bacteria 3249
380 Ga0495635_0005814 3300046663 Bacteria 8595
381 Ga0495635_0009154 3300046663 Bacteria 6911
382 Ga0495635_0009800 3300046663 Bacteria 6696
383 Ga0495635_0036314 3300046663 Bacteria 3416
384 Ga0495635_0053985 3300046663 Bacteria 2768
385 Ga0495588_0000623 3300046674 Bacteria 16590
386 Ga0495588_0047956 3300046674 Bacteria 2194
387 Ga0495657_0014840 3300046675 Bacteria 5715
388 Ga0495657_0050923 3300046675 Bacteria 2782
389 Ga0495599_0001737 3300046678 Bacteria 12601
390 Ga0495623_0025060 3300046679 Bacteria 3842
391 Ga0495623_0152428 3300046679 Bacteria 1365
392 Ga0495646_0019197 3300046680 Bacteria 4329
393 Ga0495658_0222782 3300046683 Bacteria 1181
394 Ga0495613_0017908 3300046689 Bacteria 5281
395 Ga0495613_0028743 3300046689 Bacteria 4135
396 Ga0495670_0107444 3300046691 Bacteria 1442
397 Ga0495671_0010375 3300046692 Bacteria 5163
398 Ga0495649_0169001 3300046694 Unclassified 1145
399 Ga0495600_0039370 3300046809 Bacteria 3078
400 Ga0495600_0104254 3300046809 Bacteria 1848
401 Ga0495581_0017169 3300047315 Bacteria 4206
402 Ga0495581_0119044 3300047315 Bacteria 1536
403 Ga0495581_0207345 3300047315 Bacteria 1146
404 Ga0495604_0001927 3300047317 Bacteria 16802
405 Ga0495604_0018550 3300047317 Bacteria 5574
406 Ga0495674_0041784 3300047319 Bacteria 4093
407 Ga0495674_0051365 3300047319 Bacteria 3635
408 Ga0495676_0006705 3300047321 Bacteria 10605
409 Ga0495676_0031236 3300047321 Bacteria 4507
410 Ga0495680_0011776 3300047322 Bacteria 7726
411 Ga0495680_0013422 3300047322 Bacteria 7148
412 Ga0495680_0031036 3300047322 Bacteria 4353
413 Ga0495687_028725 3300047443 Bacteria 2583
414 Ga0495687_047577 3300047443 Bacteria 1844
415 Ga0495675_0008564 3300047444 Bacteria 6340
416 Ga0495675_0079223 3300047444 Bacteria 2069
417 Ga0495675_0104275 3300047444 Bacteria 1772
418 Ga0495685_009411 3300047447 Bacteria 3262
419 Ga0495681_0003038 3300047470 Bacteria 11792
420 Ga0495684_0009851 3300047471 Bacteria 7375
421 Ga0495684_0036590 3300047471 Bacteria 3762
422 Ga0495684_0201420 3300047471 Bacteria 1467
423 Ga0495686_0051873 3300047472 Bacteria 2573
424 Ga0495593_0007930 3300047673 Bacteria 6187
425 Ga0495593_0011852 3300047673 Bacteria 4999
426 Ga0495593_0015508 3300047673 Bacteria 4315
427 Ga0495602_0015865 3300048088 Bacteria 7588
428 Ga0495602_0058210 3300048088 Bacteria 3385
429 Ga0495614_0008334 3300048089 Bacteria 4612
430 Ga0496100_0109768 3300048903 Bacteria 1914
431 Ga0496100_0140925 3300048903 Bacteria 1709
432 Ga0496100_0245086 3300048903 Bacteria 1324
433 Ga0496101_0010635 3300048904 Bacteria 6080
434 Ga0496101_0045780 3300048904 Bacteria 3135
435 Ga0496102_0001164 3300048905 Bacteria 24021
436 Ga0496102_0013298 3300048905 Bacteria 7128
437 Ga0496102_0018536 3300048905 Bacteria 6117
438 Ga0496102_0030678 3300048905 Bacteria 4812
439 Ga0496103_0023376 3300048906 Bacteria 3727
440 Ga0496103_0096014 3300048906 Bacteria 1873
441 Ga0496104_0003780 3300048907 Bacteria 13096
442 Ga0496104_0006354 3300048907 Bacteria 10393
443 Ga0496104_0025893 3300048907 Bacteria 5410
444 Ga0496104_0040093 3300048907 Bacteria 4388
445 Ga0496104_0068623 3300048907 Bacteria 3369
446 Ga0496105_0004557 3300048908 Bacteria 10435
447 Ga0496105_0004641 3300048908 Bacteria 10357
448 Ga0496105_0009355 3300048908 Bacteria 7660
449 Ga0496105_0009672 3300048908 Bacteria 7546
450 Ga0496105_0010073 3300048908 Bacteria 7419
451 Ga0496105_0379064 3300048908 Bacteria 1126
452 Ga0496106_0003460 3300048909 Bacteria 11762
453 Ga0496106_0030080 3300048909 Bacteria 4049
454 Ga0496107_0005163 3300048910 Bacteria 8913
455 Ga0496108_0009938 3300048911 Bacteria 7715
456 Ga0496108_0028166 3300048911 Bacteria 4647
457 Ga0496109_0018717 3300048912 Bacteria 6089
458 Ga0496109_0082248 3300048912 Bacteria 2967
459 Ga0496109_0186968 3300048912 Bacteria 1946
460 Ga0496109_0300446 3300048912 Bacteria 1514
461 Ga0496110_0015154 3300048913 Bacteria 6410
462 Ga0496110_0026626 3300048913 Bacteria 4951
463 Ga0496110_0068792 3300048913 Bacteria 3134
464 Ga0496111_0071682 3300048914 Bacteria 2522
465 Ga0496111_0100269 3300048914 Bacteria 2127
466 Ga0496112_0171370 3300048915 Bacteria 2135
467 Ga0496112_0410236 3300048915 Bacteria 1294
468 Ga0496113_0064126 3300048916 Bacteria 2777
469 Ga0496113_0080568 3300048916 Bacteria 2494
470 Ga0496114_0001749 3300048917 Bacteria 16473
471 Ga0496114_0016437 3300048917 Bacteria 5964
472 Ga0496114_0019655 3300048917 Bacteria 5474
473 Ga0496114_0118339 3300048917 Bacteria 2276
474 Ga0496114_0174745 3300048917 Unclassified 1874
475 Ga0496114_0382612 3300048917 Bacteria 1246
476 Ga0496115_0001869 3300048918 Bacteria 15067
477 Ga0496115_0084765 3300048918 Bacteria 2584
478 Ga0496115_0247680 3300048918 Bacteria 1468
479 Ga0496117_0000048 3300048920 Bacteria 295908
480 Ga0496117_0021466 3300048920 Bacteria 5221
481 Ga0496118_0001393 3300048921 Bacteria 36444
482 Ga0496119_0075350 3300048922 Bacteria 1961
483 Ga0496120_0077076 3300048923 Bacteria 1815
484 Ga0496122_0000978 3300048925 Bacteria 51309
485 Ga0496123_0000304 3300048926 Bacteria 95535
486 Ga0496123_0110174 3300048926 Bacteria 1576
487 Ga0496124_0000040 3300048927 Bacteria 307061
488 Ga0496124_0001775 3300048927 Bacteria 30001
489 Ga0496124_0008784 3300048927 Bacteria 10494
490 Ga0496124_0158177 3300048927 Bacteria 1769
491 Ga0496125_0201723 3300048928 Bacteria 1301
492 Ga0496126_0013732 3300048929 Bacteria 8214
493 Ga0501031_0003529 3300049568 Bacteria 10038
494 Ga0501031_0115679 3300049568 Bacteria 1752
495 Ga0501032_0006366 3300049569 Bacteria 8702
496 Ga0501033_0000714 3300049570 Bacteria 30480
497 Ga0501034_0006870 3300049571 Bacteria 12167
498 Ga0501036_0005945 3300049572 Bacteria 9889
499 Ga0501037_0004508 3300049573 Bacteria 10122
500 Ga0501038_0000681 3300049574 Bacteria 30246
501 Ga0501039_0013729 3300049575 Bacteria 6196
502 Ga0501043_0005753 3300049579 Bacteria 9988
503 Ga0501046_0006461 3300049580 Bacteria 10370
504 Ga0501047_0000063 3300049581 Bacteria 136761
505 Ga0501047_0150550 3300049581 Bacteria 2203
506 Ga0501047_0167823 3300049581 Bacteria 2065
507 Ga0501048_0000390 3300049582 Bacteria 30459
508 Ga0501069_0017460 3300049585 Bacteria 3862
509 Ga0501070_0001914 3300049586 Bacteria 18377
510 Ga0501073_0015719 3300049589 Bacteria 5486
511 Ga0501079_0010050 3300049741 Bacteria 7185
512 Ga0501083_0004350 3300049744 Bacteria 9976
513 Ga0501035_0000963 3300049822 Bacteria 30420
514 Ga0501044_0009798 3300049823 Bacteria 10417
515 nmdc:mga03683_10910_c1 3300050489 Bacteria 3270
516 nmdc:mga00v17_33297_c2 3300050491 Bacteria 2221
517 nmdc:mga0yw44_103141_c1 3300050492 Bacteria 1819
518 nmdc:mga0yw44_157562_c1 3300050492 Bacteria 1485
519 nmdc:mga0yw44_23683_c1 3300050492 Bacteria 3463
520 nmdc:mga06z11_3390_c1 3300050494 Bacteria 6162
521 nmdc:mga04h51_97873_c1 3300050495 Bacteria 1065
522 nmdc:mga07m45_111166_c1 3300050496 Bacteria 1578
523 nmdc:mga07m45_3811_c1 3300050496 Bacteria 7296
524 nmdc:mga09592_131420_c1 3300050508 Bacteria 2154
525 nmdc:mga0qj67_8720_c1 3300050509 Bacteria 7531
526 nmdc:mga06r32_1258_c1 3300050510 Bacteria 22755
527 nmdc:mga08y16_22589_c1 3300050511 Bacteria 6642
528 nmdc:mga08y16_4_c1 3300050511 Bacteria 916963
529 nmdc:mga0n895_52304_c1 3300050512 Bacteria 4009
530 Ga0495601_0102646 3300053077 Bacteria 1848
531 Ga0495595_0003631 3300053084 Bacteria 6132
532 Ga0495595_0120426 3300053084 Bacteria 1278
533 Ga0495619_0029192 3300053085 Bacteria 3562
534 Ga0495619_0259782 3300053085 Bacteria 1204
535 Ga0500643_000297 3300053087 Bacteria 41873
536 Ga0500643_006632 3300053087 Bacteria 4809
537 Ga0500644_0000803 3300053088 Bacteria 10659
538 Ga0500644_0003115 3300053088 Bacteria 4105
539 Ga0500556_0000008 3300053104 Bacteria 304943
540 Ga0500556_0016034 3300053104 Bacteria 2324
541 Ga0500560_005526 3300053107 Bacteria 2807
542 Ga0500560_057400 3300053107 Bacteria 1262
543 Ga0500608_024034 3300053122 Bacteria 2842
544 Ga0500658_0020324 3300053134 Bacteria 2506
545 Ga0500559_0000577 3300053136 Bacteria 25137
546 Ga0500559_0000811 3300053136 Bacteria 20360
547 Ga0500559_0034668 3300053136 Bacteria 2177
548 Ga0500568_0000003 3300053139 Bacteria 863587
549 Ga0500573_0000014 3300053140 Bacteria 193353
550 Ga0500573_0000043 3300053140 Bacteria 101932
551 Ga0500573_0001248 3300053140 Bacteria 11994
552 Ga0500573_0003828 3300053140 Bacteria 7845
553 Ga0500573_0010149 3300053140 Bacteria 5248
554 Ga0500573_0066731 3300053140 Bacteria 2057
555 Ga0500573_0075799 3300053140 Bacteria 1914
556 Ga0500577_0005536 3300053142 Bacteria 3413
557 Ga0500577_0005586 3300053142 Bacteria 3403
558 Ga0500577_0022950 3300053142 Bacteria 2078
559 Ga0500616_0000079 3300053153 Bacteria 200717
560 Ga0500616_0002030 3300053153 Bacteria 17854
561 Ga0500622_0000037 3300053156 Bacteria 179427
562 Ga0500624_001146 3300053157 Bacteria 4855
563 Ga0500636_0002710 3300053177 Bacteria 9848
564 Ga0500611_001596 3300053727 Bacteria 2538
565 Ga0500645_012648 3300053730 Bacteria 2725
566 Ga0501082_0009145 3300060353 Bacteria 8543

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005437 Ga0070710_10070421 Ga0070710_100704212 263
2 3300050495 nmdc:mga04h51_97873_c1 nmdc:mga04h51_97873_c1_94_975 278
3 3300050496 nmdc:mga07m45_111166_c1 nmdc:mga07m45_111166_c1_38_919 278
4 3300035170 Ga0373943_0073750 Ga0373943_0073750_123_992 279
5 3300003187 JGI25151J46595_10000769 JGI25151J46595_100007698 287
6 3300006353 Ga0075370_10010023 Ga0075370_100100233 287
7 3300025258 Ga0209129_1005596 Ga0209129_10055963 287
8 3300025294 Ga0209025_1000238 Ga0209025_100023868 287
9 3300009098 Ga0105245_10115652 Ga0105245_101156522 288
10 3300037068 Ga0373925_0001664 Ga0373925_0001664_5193_6068 290
11 3300041452 Ga0451793_1839129 Ga0451793_1839129_178_1059 292
12 3300046559 Ga0495667_0154919 Ga0495667_0154919_454_1335 292
13 3300048908 Ga0496105_0379064 Ga0496105_0379064_19_900 292
14 3300048912 Ga0496109_0300446 Ga0496109_0300446_32_913 292
15 3300048913 Ga0496110_0068792 Ga0496110_0068792_2180_3061 292
16 3300050496 nmdc:mga07m45_3811_c1 nmdc:mga07m45_3811_c1_6193_7218 294
17 3300041512 Ga0451853_0677297 Ga0451853_0677297_643_1536 296
18 3300048905 Ga0496102_0030678 Ga0496102_0030678_3684_4652 296
19 3300048916 Ga0496113_0064126 Ga0496113_0064126_891_1859 296
20 3300025911 Ga0207654_10018963 Ga0207654_100189632 298
21 3300031616 Ga0307508_10001814 Ga0307508_100018144 299
22 3300031649 Ga0307514_10033652 Ga0307514_100336524 299
23 3300028786 Ga0307517_10062147 Ga0307517_100621474 300
24 3300050492 nmdc:mga0yw44_103141_c1 nmdc:mga0yw44_103141_c1_87_1070 301
25 3300037466 Ga0395898_0046801 Ga0395898_0046801_1385_2293 302
26 3300053084 Ga0495595_0120426 Ga0495595_0120426_279_1190 302
27 3300048927 Ga0496124_0008784 Ga0496124_0008784_6638_7621 303
28 3300049568 Ga0501031_0115679 Ga0501031_0115679_51_1022 303
29 3300006178 Ga0075367_10012007 Ga0075367_100120073 304
30 3300046515 Ga0495620_0010421 Ga0495620_0010421_2108_3025 304
31 3300050494 nmdc:mga06z11_3390_c1 nmdc:mga06z11_3390_c1_992_1975 304
32 3300046557 Ga0495622_0051713 Ga0495622_0051713_405_1412 305
33 3300005467 Ga0070706_100003816 Ga0070706_1000038165 306
34 3300006038 Ga0075365_10036575 Ga0075365_100365754 306
35 3300046491 Ga0495584_0210294 Ga0495584_0210294_44_967 306
36 3300050492 nmdc:mga0yw44_23683_c1 nmdc:mga0yw44_23683_c1_1219_2196 306
37 3300005329 Ga0070683_100248091 Ga0070683_1002480911 307
38 3300042012 Ga0439455_0007474 Ga0439455_0007474_383_1399 307
39 3300042138 Ga0450903_002650 Ga0450903_002650_759_1775 307
40 3300005327 Ga0070658_10089133 Ga0070658_100891334 309
41 3300005328 Ga0070676_10077517 Ga0070676_100775173 309
42 3300005331 Ga0070670_100051560 Ga0070670_1000515603 309
43 3300005334 Ga0068869_100009466 Ga0068869_1000094664 309
44 3300005336 Ga0070680_100021304 Ga0070680_1000213045 309
45 3300005339 Ga0070660_100042237 Ga0070660_1000422374 309
46 3300005340 Ga0070689_100044844 Ga0070689_1000448442 309
47 3300005341 Ga0070691_10036013 Ga0070691_100360131 309
48 3300005344 Ga0070661_100042434 Ga0070661_1000424343 309
49 3300005345 Ga0070692_10012861 Ga0070692_100128611 309
50 3300005354 Ga0070675_100013573 Ga0070675_1000135734 309
51 3300005434 Ga0070709_10134016 Ga0070709_101340161 309
52 3300005435 Ga0070714_100221932 Ga0070714_1002219322 309
53 3300005436 Ga0070713_100303915 Ga0070713_1003039151 309
54 3300005455 Ga0070663_100005950 Ga0070663_1000059505 309
55 3300005456 Ga0070678_100011405 Ga0070678_1000114055 309
56 3300005458 Ga0070681_10022171 Ga0070681_100221715 309
57 3300005530 Ga0070679_100093227 Ga0070679_1000932274 309
58 3300005543 Ga0070672_100148946 Ga0070672_1001489463 309
59 3300005547 Ga0070693_100002076 Ga0070693_1000020765 309
60 3300005548 Ga0070665_100085505 Ga0070665_1000855053 309
61 3300005563 Ga0068855_100269422 Ga0068855_1002694222 309
62 3300005577 Ga0068857_100169096 Ga0068857_1001690963 309
63 3300005578 Ga0068854_100021103 Ga0068854_1000211036 309
64 3300005615 Ga0070702_100033876 Ga0070702_1000338764 309
65 3300005616 Ga0068852_100018355 Ga0068852_1000183557 309
66 3300005617 Ga0068859_100058411 Ga0068859_1000584115 309
67 3300005618 Ga0068864_100060920 Ga0068864_1000609204 309
68 3300005840 Ga0068870_10012123 Ga0068870_100121234 309
69 3300005841 Ga0068863_100091661 Ga0068863_1000916614 309
70 3300005842 Ga0068858_100017388 Ga0068858_1000173883 309
71 3300005843 Ga0068860_100272859 Ga0068860_1002728592 309
72 3300006358 Ga0068871_100287482 Ga0068871_1002874821 309
73 3300006914 Ga0075436_100089276 Ga0075436_1000892764 309
74 3300006931 Ga0097620_100058410 Ga0097620_1000584101 309
75 3300009098 Ga0105245_10048790 Ga0105245_100487902 309
76 3300009177 Ga0105248_10031176 Ga0105248_100311764 309
77 3300009545 Ga0105237_10019291 Ga0105237_100192915 309
78 3300009545 Ga0105237_10248185 Ga0105237_102481852 309
79 3300009551 Ga0105238_10059219 Ga0105238_100592191 309
80 3300010375 Ga0105239_10127048 Ga0105239_101270484 309
81 3300011119 Ga0105246_10005389 Ga0105246_100053891 309
82 3300013100 Ga0157373_10024658 Ga0157373_100246582 309
83 3300013102 Ga0157371_10034782 Ga0157371_100347822 309
84 3300013104 Ga0157370_10039800 Ga0157370_100398004 309
85 3300013105 Ga0157369_10102172 Ga0157369_101021722 309
86 3300013296 Ga0157374_10060763 Ga0157374_100607633 309
87 3300013306 Ga0163162_10205612 Ga0163162_102056122 309
88 3300013307 Ga0157372_10094799 Ga0157372_100947994 309
89 3300014325 Ga0163163_10224422 Ga0163163_102244222 309
90 3300014745 Ga0157377_10017106 Ga0157377_100171064 309
91 3300014968 Ga0157379_10121175 Ga0157379_101211751 309
92 3300014968 Ga0157379_10167057 Ga0157379_101670572 309
93 3300020082 Ga0206353_10999702 Ga0206353_109997024 309
94 3300025901 Ga0207688_10004087 Ga0207688_100040875 309
95 3300025908 Ga0207643_10000320 Ga0207643_1000032030 309
96 3300025909 Ga0207705_10171379 Ga0207705_101713792 309
97 3300025912 Ga0207707_10132784 Ga0207707_101327841 309
98 3300025913 Ga0207695_10371672 Ga0207695_103716722 309
99 3300025914 Ga0207671_10206507 Ga0207671_102065071 309
100 3300025919 Ga0207657_10212793 Ga0207657_102127931 309
101 3300025920 Ga0207649_10049456 Ga0207649_100494563 309
102 3300025925 Ga0207650_10030103 Ga0207650_100301034 309
103 3300025927 Ga0207687_10020072 Ga0207687_100200722 309
104 3300025928 Ga0207700_10121435 Ga0207700_101214352 309
105 3300025933 Ga0207706_10272702 Ga0207706_102727021 309
106 3300025940 Ga0207691_10115416 Ga0207691_101154164 309
107 3300025942 Ga0207689_10018038 Ga0207689_100180388 309
108 3300025944 Ga0207661_10009547 Ga0207661_100095476 309
109 3300025945 Ga0207679_10006069 Ga0207679_100060696 309
110 3300025981 Ga0207640_10134746 Ga0207640_101347461 309
111 3300026023 Ga0207677_10004031 Ga0207677_100040318 309
112 3300026035 Ga0207703_10016168 Ga0207703_100161685 309
113 3300026041 Ga0207639_10319921 Ga0207639_103199211 309
114 3300026067 Ga0207678_10000094 Ga0207678_1000009451 309
115 3300026075 Ga0207708_10072017 Ga0207708_100720174 309
116 3300026078 Ga0207702_10013617 Ga0207702_100136175 309
117 3300026088 Ga0207641_10128323 Ga0207641_101283231 309
118 3300026095 Ga0207676_10039831 Ga0207676_100398313 309
119 3300026116 Ga0207674_10166648 Ga0207674_101666482 309
120 3300026121 Ga0207683_10040447 Ga0207683_100404471 309
121 3300026142 Ga0207698_10250505 Ga0207698_102505052 309
122 3300027907 Ga0207428_10044090 Ga0207428_100440904 309
123 3300028379 Ga0268266_10446837 Ga0268266_104468371 309
124 3300028381 Ga0268264_10174958 Ga0268264_101749582 309
125 3300041491 Ga0451833_0871186 Ga0451833_0871186_70_1059 309
126 3300048906 Ga0496103_0023376 Ga0496103_0023376_2161_3162 309
127 3300048907 Ga0496104_0025893 Ga0496104_0025893_1568_2569 309
128 3300048908 Ga0496105_0009355 Ga0496105_0009355_3889_4890 309
129 3300048909 Ga0496106_0030080 Ga0496106_0030080_288_1289 309
130 3300048912 Ga0496109_0018717 Ga0496109_0018717_411_1412 309
131 3300048915 Ga0496112_0171370 Ga0496112_0171370_161_1162 309
132 3300048918 Ga0496115_0084765 Ga0496115_0084765_137_1138 309
133 3300050511 nmdc:mga08y16_22589_c1 nmdc:mga08y16_22589_c1_4201_5202 309
134 3300050512 nmdc:mga0n895_52304_c1 nmdc:mga0n895_52304_c1_1322_2323 309
135 3300025913 Ga0207695_10333529 Ga0207695_103335291 310
136 3300026118 Ga0207675_100472221 Ga0207675_1004722211 310
137 3300031889 Ga0326468_10001733 Ga0326468_100017332 312
138 3300053730 Ga0500645_012648 Ga0500645_012648_398_1402 312
139 iso_pu_bacteria 2558860280 2559423251 312
140 3300005355 Ga0070671_100001046 Ga0070671_1000010465 313
141 3300025931 Ga0207644_10000937 Ga0207644_1000093713 313
142 3300031730 Ga0307516_10015060 Ga0307516_100150602 313
143 3300047443 Ga0495687_028725 Ga0495687_028725_551_1561 313
144 3300005435 Ga0070714_100019448 Ga0070714_1000194489 314
145 3300005437 Ga0070710_10021580 Ga0070710_100215802 314
146 3300025898 Ga0207692_10007199 Ga0207692_100071995 314
147 3300025905 Ga0207685_10013593 Ga0207685_100135932 314
148 3300025929 Ga0207664_10015710 Ga0207664_100157102 314
149 3300025939 Ga0207665_10050991 Ga0207665_100509913 314
150 3300036401 Ga0373937_0449116 Ga0373937_0449116_250_1197 314
151 3300046683 Ga0495658_0222782 Ga0495658_0222782_21_1022 314
152 iso_pu_bacteria 8003314358 8003319993 314
153 3300030521 Ga0307511_10000290 Ga0307511_1000029038 315
154 3300005455 Ga0070663_100009489 Ga0070663_1000094895 316
155 3300053142 Ga0500577_0005536 Ga0500577_0005536_1220_2191 316
156 3300013308 Ga0157375_10164341 Ga0157375_101643412 317
157 3300025934 Ga0207686_10213512 Ga0207686_102135122 317
158 3300031616 Ga0307508_10102062 Ga0307508_101020622 317
159 3300031852 Ga0307410_10008780 Ga0307410_100087803 317
160 3300031901 Ga0307406_10095206 Ga0307406_100952063 317
161 3300031995 Ga0307409_100003063 Ga0307409_1000030633 317
162 3300032002 Ga0307416_100079778 Ga0307416_1000797784 317
163 3300037466 Ga0395898_0293107 Ga0395898_0293107_411_1388 317
164 3300048903 Ga0496100_0140925 Ga0496100_0140925_683_1660 317
165 3300048905 Ga0496102_0001164 Ga0496102_0001164_6021_6998 317
166 3300048907 Ga0496104_0040093 Ga0496104_0040093_853_1830 317
167 3300048908 Ga0496105_0004557 Ga0496105_0004557_4561_5538 317
168 3300048911 Ga0496108_0028166 Ga0496108_0028166_1111_2088 317
169 3300048917 Ga0496114_0019655 Ga0496114_0019655_1100_2077 317
170 3300049581 Ga0501047_0167823 Ga0501047_0167823_509_1474 317
171 3300053142 Ga0500577_0005586 Ga0500577_0005586_1352_2323 317
172 3300053727 Ga0500611_001596 Ga0500611_001596_1264_2226 317
173 iso_pu_bacteria 2643221694 2644524208 317
174 iso_pu_bacteria 2643221722 2644668306 317
175 3300046674 Ga0495588_0000623 Ga0495588_0000623_3241_4206 318
176 3300053157 Ga0500624_001146 Ga0500624_001146_386_1351 318
177 iso_pu_bacteria 2582581280 2585154929 318
178 3300046694 Ga0495649_0169001 Ga0495649_0169001_115_1089 319
179 3300049568 Ga0501031_0003529 Ga0501031_0003529_4651_5628 319
180 3300049569 Ga0501032_0006366 Ga0501032_0006366_3195_4172 319
181 3300049570 Ga0501033_0000714 Ga0501033_0000714_4560_5537 319
182 3300049571 Ga0501034_0006870 Ga0501034_0006870_8559_9536 319
183 3300049572 Ga0501036_0005945 Ga0501036_0005945_4587_5564 319
184 3300049573 Ga0501037_0004508 Ga0501037_0004508_4589_5566 319
185 3300049574 Ga0501038_0000681 Ga0501038_0000681_4408_5385 319
186 3300049575 Ga0501039_0013729 Ga0501039_0013729_4548_5525 319
187 3300049579 Ga0501043_0005753 Ga0501043_0005753_4429_5406 319
188 3300049580 Ga0501046_0006461 Ga0501046_0006461_4394_5371 319
189 3300049581 Ga0501047_0000063 Ga0501047_0000063_24891_25868 319
190 3300049582 Ga0501048_0000390 Ga0501048_0000390_4355_5332 319
191 3300049585 Ga0501069_0017460 Ga0501069_0017460_2605_3582 319
192 3300049586 Ga0501070_0001914 Ga0501070_0001914_4450_5427 319
193 3300049589 Ga0501073_0015719 Ga0501073_0015719_4368_5345 319
194 3300049741 Ga0501079_0010050 Ga0501079_0010050_1854_2831 319
195 3300049744 Ga0501083_0004350 Ga0501083_0004350_4585_5562 319
196 3300049822 Ga0501035_0000963 Ga0501035_0000963_4551_5528 319
197 3300049823 Ga0501044_0009798 Ga0501044_0009798_4421_5398 319
198 3300053140 Ga0500573_0001248 Ga0500573_0001248_1271_2233 319
199 3300053140 Ga0500573_0066731 Ga0500573_0066731_69_1031 319
200 3300060353 Ga0501082_0009145 Ga0501082_0009145_4268_5245 319
201 3300005467 Ga0070706_100006313 Ga0070706_1000063132 320
202 3300006846 Ga0075430_100000153 Ga0075430_10000015335 320
203 3300025910 Ga0207684_10017279 Ga0207684_100172792 320
204 3300048912 Ga0496109_0186968 Ga0496109_0186968_580_1545 320
205 3300050509 nmdc:mga0qj67_8720_c1 nmdc:mga0qj67_8720_c1_834_1814 320
206 3300005544 Ga0070686_100118353 Ga0070686_1001183532 321
207 3300006186 Ga0075369_10053157 Ga0075369_100531572 321
208 3300026088 Ga0207641_10273869 Ga0207641_102738692 321
209 3300031548 Ga0307408_100238547 Ga0307408_1002385471 321
210 3300031852 Ga0307410_10007200 Ga0307410_100072003 321
211 3300046455 Ga0495603_0117531 Ga0495603_0117531_236_1204 321
212 3300046459 Ga0495629_0178857 Ga0495629_0178857_232_1200 321
213 3300046460 Ga0495638_0072207 Ga0495638_0072207_1063_2031 321
214 3300046463 Ga0495653_0043720 Ga0495653_0043720_1012_1980 321
215 3300046473 Ga0495582_0035575 Ga0495582_0035575_622_1590 321
216 3300046476 Ga0495662_0019331 Ga0495662_0019331_1152_2120 321
217 3300046477 Ga0495664_0210241 Ga0495664_0210241_140_1108 321
218 3300046501 Ga0495607_0162228 Ga0495607_0162228_111_1079 321
219 3300046531 Ga0495665_0054965 Ga0495665_0054965_870_1838 321
220 3300046535 Ga0495586_0039866 Ga0495586_0039866_811_1779 321
221 3300046536 Ga0495587_0055277 Ga0495587_0055277_108_1076 321
222 3300046543 Ga0495645_0235717 Ga0495645_0235717_28_996 321
223 3300046559 Ga0495667_0091484 Ga0495667_0091484_497_1465 321
224 3300046616 Ga0495668_0028362 Ga0495668_0028362_409_1377 321
225 3300046674 Ga0495588_0047956 Ga0495588_0047956_765_1733 321
226 3300046691 Ga0495670_0107444 Ga0495670_0107444_112_1080 321
227 3300047444 Ga0495675_0104275 Ga0495675_0104275_449_1417 321
228 3300048903 Ga0496100_0245086 Ga0496100_0245086_156_1124 321
229 3300048907 Ga0496104_0068623 Ga0496104_0068623_2158_3126 321
230 3300048908 Ga0496105_0004641 Ga0496105_0004641_4834_5802 321
231 3300048917 Ga0496114_0001749 Ga0496114_0001749_8025_8993 321
232 3300048927 Ga0496124_0001775 Ga0496124_0001775_9075_10049 321
233 3300048928 Ga0496125_0201723 Ga0496125_0201723_76_1044 321
234 3300053087 Ga0500643_000297 Ga0500643_000297_2186_3154 321
235 3300053087 Ga0500643_006632 Ga0500643_006632_3287_4255 321
236 3300053088 Ga0500644_0000803 Ga0500644_0000803_2708_3676 321
237 3300053104 Ga0500556_0016034 Ga0500556_0016034_458_1426 321
238 3300053122 Ga0500608_024034 Ga0500608_024034_1411_2379 321
239 3300053140 Ga0500573_0000014 Ga0500573_0000014_116918_117886 321
240 3300053156 Ga0500622_0000037 Ga0500622_0000037_75162_76130 321
241 iso_pu_bacteria 2565956761 2566994103 321
242 iso_pu_bacteria 2585428157 2588107095 321
243 iso_pu_bacteria 2643221961 2645720467 321
244 iso_pu_bacteria 2643221962 2645723393 321
245 iso_pu_bacteria 2904535858 2904539871 321
246 iso_pu_bacteria 2922554459 2922560441 321
247 3300035692 Ga0373935_0045207 Ga0373935_0045207_529_1527 322
248 3300035695 Ga0373927_0147362 Ga0373927_0147362_33_1031 322
249 3300037068 Ga0373925_0079338 Ga0373925_0079338_968_1966 322
250 3300046457 Ga0495590_0001720 Ga0495590_0001720_2652_3623 322
251 3300046472 Ga0495580_0155318 Ga0495580_0155318_156_1154 322
252 3300053140 Ga0500573_0000043 Ga0500573_0000043_24229_25200 322
253 3300053140 Ga0500573_0010149 Ga0500573_0010149_3860_4831 322
254 3300053140 Ga0500573_0075799 Ga0500573_0075799_431_1402 322
255 iso_pu_bacteria 2738541272 2738695549 322
256 iso_pu_bacteria 2738543027 2739326307 322
257 iso_pu_bacteria 2811994880 2812363358 322
258 iso_pu_bacteria 2939657138 2939660787 322
259 iso_pu_bacteria 2946041624 2946042016 322
260 3300005445 Ga0070708_100179380 Ga0070708_1001793802 323
261 3300005840 Ga0068870_10015112 Ga0068870_100151121 323
262 3300006847 Ga0075431_100003539 Ga0075431_1000035399 323
263 3300009094 Ga0111539_10000053 Ga0111539_1000005320 323
264 3300027907 Ga0207428_10000061 Ga0207428_1000006141 323
265 3300028794 Ga0307515_10000506 Ga0307515_1000050619 323
266 3300031824 Ga0307413_10291866 Ga0307413_102918661 323
267 3300037853 Ga0436364_0439304 Ga0436364_0439304_2316_3290 323
268 3300039447 Ga0436361_0931125 Ga0436361_0931125_2413_3387 323
269 3300044765 Ga0466970_0020206 Ga0466970_0020206_1244_2236 323
270 3300050508 nmdc:mga09592_131420_c1 nmdc:mga09592_131420_c1_197_1177 323
271 3300050510 nmdc:mga06r32_1258_c1 nmdc:mga06r32_1258_c1_20772_21752 323
272 3300050511 nmdc:mga08y16_4_c1 nmdc:mga08y16_4_c1_20927_21904 323
273 3300053136 Ga0500559_0034668 Ga0500559_0034668_52_1026 323
274 3300053142 Ga0500577_0022950 Ga0500577_0022950_193_1167 323
275 iso_pu_bacteria 2731639228 2731908802 323
276 iso_pu_bacteria 2919042368 2919042565 323
277 iso_pu_bacteria 2928104781 2928104881 323
278 iso_pu_bacteria 2984551494 2984555155 323
279 3300006038 Ga0075365_10037810 Ga0075365_100378105 324
280 3300006880 Ga0075429_100080704 Ga0075429_1000807041 324
281 3300009094 Ga0111539_10027595 Ga0111539_100275954 324
282 3300026095 Ga0207676_10452349 Ga0207676_104523491 324
283 3300048903 Ga0496100_0109768 Ga0496100_0109768_641_1621 324
284 3300048904 Ga0496101_0045780 Ga0496101_0045780_1129_2109 324
285 3300048905 Ga0496102_0013298 Ga0496102_0013298_4539_5519 324
286 3300048909 Ga0496106_0003460 Ga0496106_0003460_202_1182 324
287 3300048910 Ga0496107_0005163 Ga0496107_0005163_4641_5621 324
288 3300048917 Ga0496114_0118339 Ga0496114_0118339_234_1214 324
289 3300048918 Ga0496115_0001869 Ga0496115_0001869_5871_6851 324
290 3300048920 Ga0496117_0000048 Ga0496117_0000048_24375_25370 324
291 3300048925 Ga0496122_0000978 Ga0496122_0000978_36270_37253 324
292 3300048926 Ga0496123_0000304 Ga0496123_0000304_26524_27507 324
293 3300005337 Ga0070682_100123974 Ga0070682_1001239742 325
294 3300005435 Ga0070714_100040151 Ga0070714_1000401512 325
295 3300005436 Ga0070713_100429742 Ga0070713_1004297421 325
296 3300005437 Ga0070710_10022589 Ga0070710_100225895 325
297 3300005439 Ga0070711_100043287 Ga0070711_1000432874 325
298 3300005455 Ga0070663_100135328 Ga0070663_1001353282 325
299 3300005455 Ga0070663_100255333 Ga0070663_1002553331 325
300 3300005544 Ga0070686_100244121 Ga0070686_1002441211 325
301 3300005548 Ga0070665_100080901 Ga0070665_1000809013 325
302 3300005578 Ga0068854_100036359 Ga0068854_1000363593 325
303 3300005616 Ga0068852_100011084 Ga0068852_1000110844 325
304 3300006038 Ga0075365_10022559 Ga0075365_100225594 325
305 3300006051 Ga0075364_10032174 Ga0075364_100321742 325
306 3300006186 Ga0075369_10003754 Ga0075369_100037542 325
307 3300006353 Ga0075370_10087778 Ga0075370_100877782 325
308 3300010159 Ga0099796_10002604 Ga0099796_100026044 325
309 3300020081 Ga0206354_10846943 Ga0206354_108469433 325
310 3300025904 Ga0207647_10016829 Ga0207647_100168292 325
311 3300025910 Ga0207684_10000572 Ga0207684_1000057240 325
312 3300025913 Ga0207695_10084442 Ga0207695_100844423 325
313 3300025914 Ga0207671_10004312 Ga0207671_100043127 325
314 3300025915 Ga0207693_10167531 Ga0207693_101675311 325
315 3300025929 Ga0207664_10025275 Ga0207664_100252752 325
316 3300026067 Ga0207678_10075872 Ga0207678_100758722 325
317 3300026142 Ga0207698_10083755 Ga0207698_100837551 325
318 3300027512 Ga0209179_1002691 Ga0209179_10026912 325
319 3300028786 Ga0307517_10007075 Ga0307517_100070757 325
320 3300028800 Ga0265338_10018231 Ga0265338_100182315 325
321 3300031507 Ga0307509_10049988 Ga0307509_100499882 325
322 3300031901 Ga0307406_10012500 Ga0307406_100125002 325
323 3300031901 Ga0307406_10118269 Ga0307406_101182692 325
324 3300035086 Ga0373934_0048507 Ga0373934_0048507_491_1471 325
325 3300035113 Ga0373936_0055295 Ga0373936_0055295_573_1553 325
326 3300035118 Ga0373954_0044835 Ga0373954_0044835_479_1459 325
327 3300035172 Ga0373955_0031223 Ga0373955_0031223_272_1252 325
328 3300035724 Ga0373933_0046743 Ga0373933_0046743_1354_2334 325
329 3300036401 Ga0373937_0109191 Ga0373937_0109191_272_1252 325
330 3300037418 Ga0395900_0156704 Ga0395900_0156704_154_1134 325
331 3300038443 Ga0395901_0094126 Ga0395901_0094126_383_1363 325
332 3300041443 Ga0451789_0538276 Ga0451789_0538276_18_998 325
333 3300041456 Ga0451795_1077384 Ga0451795_1077384_351_1346 325
334 3300046455 Ga0495603_0176268 Ga0495603_0176268_75_1055 325
335 3300046459 Ga0495629_0076868 Ga0495629_0076868_56_1036 325
336 3300046460 Ga0495638_0083278 Ga0495638_0083278_674_1654 325
337 3300046462 Ga0495651_0086491 Ga0495651_0086491_422_1402 325
338 3300046463 Ga0495653_0052292 Ga0495653_0052292_400_1380 325
339 3300046472 Ga0495580_0222424 Ga0495580_0222424_292_1272 325
340 3300046473 Ga0495582_0156392 Ga0495582_0156392_38_1018 325
341 3300046499 Ga0495594_0049224 Ga0495594_0049224_628_1608 325
342 3300046516 Ga0495628_0171425 Ga0495628_0171425_223_1203 325
343 3300046517 Ga0495630_0283345 Ga0495630_0283345_128_1108 325
344 3300046529 Ga0495652_0186237 Ga0495652_0186237_64_1044 325
345 3300046559 Ga0495667_0006676 Ga0495667_0006676_6661_7641 325
346 3300046559 Ga0495667_0236302 Ga0495667_0236302_23_1003 325
347 3300046663 Ga0495635_0009800 Ga0495635_0009800_1283_2263 325
348 3300046663 Ga0495635_0053985 Ga0495635_0053985_290_1270 325
349 3300046809 Ga0495600_0039370 Ga0495600_0039370_1807_2787 325
350 3300046809 Ga0495600_0104254 Ga0495600_0104254_149_1129 325
351 3300047315 Ga0495581_0119044 Ga0495581_0119044_388_1368 325
352 3300047315 Ga0495581_0207345 Ga0495581_0207345_107_1087 325
353 3300047319 Ga0495674_0051365 Ga0495674_0051365_1208_2188 325
354 3300047322 Ga0495680_0013422 Ga0495680_0013422_3846_4826 325
355 3300047443 Ga0495687_047577 Ga0495687_047577_695_1675 325
356 3300047447 Ga0495685_009411 Ga0495685_009411_1308_2288 325
357 3300047471 Ga0495684_0009851 Ga0495684_0009851_788_1768 325
358 3300047471 Ga0495684_0201420 Ga0495684_0201420_274_1254 325
359 3300047673 Ga0495593_0015508 Ga0495593_0015508_1609_2589 325
360 3300048088 Ga0495602_0058210 Ga0495602_0058210_999_1979 325
361 3300048904 Ga0496101_0010635 Ga0496101_0010635_2068_3048 325
362 3300048905 Ga0496102_0018536 Ga0496102_0018536_883_1863 325
363 3300048906 Ga0496103_0096014 Ga0496103_0096014_280_1260 325
364 3300048911 Ga0496108_0009938 Ga0496108_0009938_1229_2209 325
365 3300048912 Ga0496109_0082248 Ga0496109_0082248_999_1979 325
366 3300048917 Ga0496114_0174745 Ga0496114_0174745_751_1731 325
367 3300048917 Ga0496114_0382612 Ga0496114_0382612_253_1233 325
368 3300048918 Ga0496115_0247680 Ga0496115_0247680_15_1007 325
369 3300048929 Ga0496126_0013732 Ga0496126_0013732_6230_7210 325
370 3300050491 nmdc:mga00v17_33297_c2 nmdc:mga00v17_33297_c2_683_1663 325
371 3300050492 nmdc:mga0yw44_157562_c1 nmdc:mga0yw44_157562_c1_483_1463 325
372 iso_pu_bacteria 2643221576 2643891132 325
373 iso_pu_bacteria 2643221590 2643960188 325
374 3300014968 Ga0157379_10224513 Ga0157379_102245132 326
375 3300031901 Ga0307406_10000031 Ga0307406_1000003128 326
376 3300037853 Ga0436364_1360742 Ga0436364_1360742_70_1071 326
377 3300041512 Ga0451853_0096543 Ga0451853_0096543_1408_2388 326
378 3300046454 Ga0495592_0155514 Ga0495592_0155514_561_1541 326
379 3300046511 Ga0495608_0051382 Ga0495608_0051382_1561_2541 326
380 3300046514 Ga0495618_0122400 Ga0495618_0122400_504_1484 326
381 3300046663 Ga0495635_0036314 Ga0495635_0036314_122_1102 326
382 3300046679 Ga0495623_0152428 Ga0495623_0152428_75_1055 326
383 3300046689 Ga0495613_0017908 Ga0495613_0017908_1511_2491 326
384 3300047322 Ga0495680_0011776 Ga0495680_0011776_3796_4776 326
385 3300047444 Ga0495675_0079223 Ga0495675_0079223_774_1754 326
386 3300047472 Ga0495686_0051873 Ga0495686_0051873_634_1617 326
387 3300053077 Ga0495601_0102646 Ga0495601_0102646_481_1461 326
388 3300053136 Ga0500559_0000577 Ga0500559_0000577_21165_22148 326
389 3300053136 Ga0500559_0000811 Ga0500559_0000811_18884_19867 326
390 3300053140 Ga0500573_0003828 Ga0500573_0003828_3988_4971 326
391 3300053153 Ga0500616_0000079 Ga0500616_0000079_60016_60999 326
392 3300053153 Ga0500616_0002030 Ga0500616_0002030_14807_15790 326
393 iso_pu_bacteria 2551306166 2552112291 326
394 3300005435 Ga0070714_100094693 Ga0070714_1000946933 327
395 3300005437 Ga0070710_10039256 Ga0070710_100392562 327
396 3300005445 Ga0070708_100143684 Ga0070708_1001436842 327
397 3300005468 Ga0070707_100047224 Ga0070707_1000472244 327
398 3300013307 Ga0157372_10665523 Ga0157372_106655232 327
399 3300025898 Ga0207692_10096169 Ga0207692_100961691 327
400 3300025915 Ga0207693_10033591 Ga0207693_100335912 327
401 3300025922 Ga0207646_10018661 Ga0207646_100186612 327
402 3300025928 Ga0207700_10017397 Ga0207700_100173972 327
403 3300025939 Ga0207665_10141037 Ga0207665_101410371 327
404 3300048920 Ga0496117_0021466 Ga0496117_0021466_3530_4531 327
405 3300048921 Ga0496118_0001393 Ga0496118_0001393_16102_17103 327
406 3300048922 Ga0496119_0075350 Ga0496119_0075350_402_1403 327
407 3300048923 Ga0496120_0077076 Ga0496120_0077076_521_1522 327
408 3300048926 Ga0496123_0110174 Ga0496123_0110174_511_1512 327
409 3300048927 Ga0496124_0000040 Ga0496124_0000040_272693_273694 327
410 3300048927 Ga0496124_0158177 Ga0496124_0158177_68_1069 327
411 3300053104 Ga0500556_0000008 Ga0500556_0000008_113514_114506 327
412 3300053134 Ga0500658_0020324 Ga0500658_0020324_872_1897 327
413 3300053139 Ga0500568_0000003 Ga0500568_0000003_194145_195137 327
414 3300046462 Ga0495651_0000193 Ga0495651_0000193_33664_34665 328
415 3300046529 Ga0495652_0006723 Ga0495652_0006723_5413_6414 328
416 3300053085 Ga0495619_0259782 Ga0495619_0259782_70_1056 328
417 3300053177 Ga0500636_0002710 Ga0500636_0002710_3060_4133 328
418 iso_pu_bacteria 2582581313 2585303084 328
419 iso_pu_bacteria 2643221647 2644266967 328
420 iso_pu_bacteria 2786546132 2786674157 328
421 iso_pu_bacteria 2867428634 2867428977 328
422 iso_pu_bacteria 2954380949 2954381785 328
423 iso_pu_bacteria 2954673503 2954681254 328
424 iso_pu_bacteria 2954682443 2954682904 328
425 iso_pu_bacteria 2954691527 2954692601 328
426 iso_pu_bacteria 2954701450 2954707674 328
427 iso_pu_bacteria 2954711539 2954712262 328
428 iso_pu_bacteria 2954721474 2954722207 328
429 iso_pu_bacteria 2954731030 2954739642 328
430 iso_pu_bacteria 2954740390 2954741097 328
431 iso_pu_bacteria 2954749733 2954758469 328
432 iso_pu_bacteria 2954759201 2954760108 328
433 iso_pu_bacteria 8053945823 8053947708 328
434 iso_pu_bacteria 8055066027 8055067701 328
435 3300046473 Ga0495582_0081614 Ga0495582_0081614_374_1366 329
436 3300048908 Ga0496105_0009672 Ga0496105_0009672_3838_4830 329
437 3300048913 Ga0496110_0026626 Ga0496110_0026626_1193_2185 329
438 3300048914 Ga0496111_0071682 Ga0496111_0071682_1272_2264 329
439 3300048916 Ga0496113_0080568 Ga0496113_0080568_359_1351 329
440 3300048917 Ga0496114_0016437 Ga0496114_0016437_3497_4489 329
441 3300050489 nmdc:mga03683_10910_c1 nmdc:mga03683_10910_c1_1570_2619 329
442 3300005334 Ga0068869_100376377 Ga0068869_1003763771 331
443 3300005336 Ga0070680_100039866 Ga0070680_1000398665 331
444 3300005355 Ga0070671_100018102 Ga0070671_1000181024 331
445 3300005434 Ga0070709_10114926 Ga0070709_101149261 331
446 3300005435 Ga0070714_100029866 Ga0070714_1000298664 331
447 3300005435 Ga0070714_100156243 Ga0070714_1001562432 331
448 3300005435 Ga0070714_100491348 Ga0070714_1004913481 331
449 3300005436 Ga0070713_100012145 Ga0070713_1000121456 331
450 3300005437 Ga0070710_10024425 Ga0070710_100244252 331
451 3300005437 Ga0070710_10043380 Ga0070710_100433802 331
452 3300005458 Ga0070681_10040295 Ga0070681_100402952 331
453 3300005548 Ga0070665_100025406 Ga0070665_1000254065 331
454 3300005548 Ga0070665_100299521 Ga0070665_1002995212 331
455 3300005563 Ga0068855_100022930 Ga0068855_1000229305 331
456 3300005577 Ga0068857_100168394 Ga0068857_1001683942 331
457 3300005614 Ga0068856_100026135 Ga0068856_1000261352 331
458 3300005614 Ga0068856_100133767 Ga0068856_1001337673 331
459 3300005614 Ga0068856_100149698 Ga0068856_1001496983 331
460 3300005614 Ga0068856_100414784 Ga0068856_1004147842 331
461 3300005616 Ga0068852_100043303 Ga0068852_1000433032 331
462 3300005617 Ga0068859_100471998 Ga0068859_1004719982 331
463 3300005844 Ga0068862_100554305 Ga0068862_1005543051 331
464 3300006931 Ga0097620_100472003 Ga0097620_1004720032 331
465 3300007265 Ga0099794_10078094 Ga0099794_100780941 331
466 3300009093 Ga0105240_10034163 Ga0105240_100341633 331
467 3300009094 Ga0111539_10035413 Ga0111539_100354135 331
468 3300009174 Ga0105241_10143173 Ga0105241_101431731 331
469 3300009545 Ga0105237_10101540 Ga0105237_101015403 331
470 3300009551 Ga0105238_10021125 Ga0105238_100211253 331
471 3300009551 Ga0105238_10053988 Ga0105238_100539884 331
472 3300009553 Ga0105249_10178605 Ga0105249_101786053 331
473 3300013104 Ga0157370_10050565 Ga0157370_100505654 331
474 3300013296 Ga0157374_10020541 Ga0157374_100205414 331
475 3300013296 Ga0157374_10169788 Ga0157374_101697882 331
476 3300013306 Ga0163162_10408358 Ga0163162_104083582 331
477 3300014968 Ga0157379_10008747 Ga0157379_100087479 331
478 3300021388 Ga0213875_10119799 Ga0213875_101197991 331
479 3300025898 Ga0207692_10020494 Ga0207692_100204944 331
480 3300025898 Ga0207692_10052261 Ga0207692_100522612 331
481 3300025900 Ga0207710_10011014 Ga0207710_100110142 331
482 3300025906 Ga0207699_10047042 Ga0207699_100470422 331
483 3300025910 Ga0207684_10336492 Ga0207684_103364921 331
484 3300025911 Ga0207654_10010884 Ga0207654_100108842 331
485 3300025912 Ga0207707_10003499 Ga0207707_1000349910 331
486 3300025913 Ga0207695_10007844 Ga0207695_100078447 331
487 3300025914 Ga0207671_10000128 Ga0207671_10000128118 331
488 3300025915 Ga0207693_10037038 Ga0207693_100370384 331
489 3300025915 Ga0207693_10045847 Ga0207693_100458475 331
490 3300025916 Ga0207663_10027738 Ga0207663_100277381 331
491 3300025916 Ga0207663_10228053 Ga0207663_102280531 331
492 3300025922 Ga0207646_10105726 Ga0207646_101057262 331
493 3300025926 Ga0207659_10237032 Ga0207659_102370321 331
494 3300025928 Ga0207700_10129643 Ga0207700_101296432 331
495 3300025928 Ga0207700_10185332 Ga0207700_101853322 331
496 3300025929 Ga0207664_10030369 Ga0207664_100303693 331
497 3300025931 Ga0207644_10021755 Ga0207644_100217553 331
498 3300025932 Ga0207690_10020389 Ga0207690_100203894 331
499 3300025949 Ga0207667_10044156 Ga0207667_100441565 331
500 3300026035 Ga0207703_10197546 Ga0207703_101975462 331
501 3300026078 Ga0207702_10100318 Ga0207702_101003183 331
502 3300026078 Ga0207702_10156663 Ga0207702_101566632 331
503 3300026116 Ga0207674_10216035 Ga0207674_102160352 331
504 3300026142 Ga0207698_10094713 Ga0207698_100947132 331
505 3300028379 Ga0268266_10101673 Ga0268266_101016732 331
506 3300028379 Ga0268266_10308046 Ga0268266_103080462 331
507 3300028786 Ga0307517_10141210 Ga0307517_101412103 331
508 3300030521 Ga0307511_10000238 Ga0307511_1000023853 331
509 3300031507 Ga0307509_10044423 Ga0307509_100444232 331
510 3300031507 Ga0307509_10109537 Ga0307509_101095372 331
511 3300031838 Ga0307518_10017622 Ga0307518_100176221 331
512 3300031838 Ga0307518_10056347 Ga0307518_100563472 331
513 3300033179 Ga0307507_10000008 Ga0307507_10000008167 331
514 3300033179 Ga0307507_10053330 Ga0307507_100533301 331
515 3300033180 Ga0307510_10085969 Ga0307510_100859693 331
516 3300033180 Ga0307510_10248956 Ga0307510_102489562 331
517 3300035410 Ga0373924_0005353 Ga0373924_0005353_1488_2489 331
518 3300036401 Ga0373937_0023231 Ga0373937_0023231_1575_2576 331
519 3300046454 Ga0495592_0017133 Ga0495592_0017133_211_1212 331
520 3300046455 Ga0495603_0014154 Ga0495603_0014154_2311_3312 331
521 3300046460 Ga0495638_0105316 Ga0495638_0105316_565_1566 331
522 3300046462 Ga0495651_0015837 Ga0495651_0015837_3365_4366 331
523 3300046463 Ga0495653_0010123 Ga0495653_0010123_222_1223 331
524 3300046477 Ga0495664_0002297 Ga0495664_0002297_979_1980 331
525 3300046506 Ga0495583_0029841 Ga0495583_0029841_999_2000 331
526 3300046511 Ga0495608_0021626 Ga0495608_0021626_3239_4240 331
527 3300046516 Ga0495628_0034116 Ga0495628_0034116_200_1201 331
528 3300046517 Ga0495630_0052374 Ga0495630_0052374_1833_2834 331
529 3300046529 Ga0495652_0039169 Ga0495652_0039169_1630_2631 331
530 3300046533 Ga0495640_0008530 Ga0495640_0008530_4350_5351 331
531 3300046536 Ga0495587_0001614 Ga0495587_0001614_12532_13533 331
532 3300046543 Ga0495645_0024742 Ga0495645_0024742_3041_4042 331
533 3300046543 Ga0495645_0027710 Ga0495645_0027710_2893_3894 331
534 3300046559 Ga0495667_0023204 Ga0495667_0023204_222_1223 331
535 3300046663 Ga0495635_0009154 Ga0495635_0009154_3752_4753 331
536 3300046675 Ga0495657_0050923 Ga0495657_0050923_1575_2576 331
537 3300046678 Ga0495599_0001737 Ga0495599_0001737_1592_2593 331
538 3300046679 Ga0495623_0025060 Ga0495623_0025060_236_1237 331
539 3300046680 Ga0495646_0019197 Ga0495646_0019197_3112_4113 331
540 3300047317 Ga0495604_0018550 Ga0495604_0018550_2842_3843 331
541 3300047319 Ga0495674_0041784 Ga0495674_0041784_220_1221 331
542 3300047322 Ga0495680_0031036 Ga0495680_0031036_222_1223 331
543 3300047444 Ga0495675_0008564 Ga0495675_0008564_4176_5177 331
544 3300047471 Ga0495684_0036590 Ga0495684_0036590_194_1195 331
545 3300048088 Ga0495602_0015865 Ga0495602_0015865_206_1207 331
546 3300048907 Ga0496104_0003780 Ga0496104_0003780_7089_8090 331
547 3300048907 Ga0496104_0006354 Ga0496104_0006354_3236_4237 331
548 3300048908 Ga0496105_0010073 Ga0496105_0010073_877_1878 331
549 3300048913 Ga0496110_0015154 Ga0496110_0015154_2058_3059 331
550 3300048914 Ga0496111_0100269 Ga0496111_0100269_480_1481 331
551 3300048915 Ga0496112_0410236 Ga0496112_0410236_158_1171 331
552 3300049581 Ga0501047_0150550 Ga0501047_0150550_420_1421 331
553 3300053084 Ga0495595_0003631 Ga0495595_0003631_1571_2572 331
554 3300053085 Ga0495619_0029192 Ga0495619_0029192_393_1394 331
555 3300053088 Ga0500644_0003115 Ga0500644_0003115_1645_2646 331
556 3300053107 Ga0500560_057400 Ga0500560_057400_157_1158 331
557 3300030735 Ga0316178_1058387 Ga0316178_10583872 334
558 3300030745 Ga0316182_1430484 Ga0316182_14304842 334
559 3300005436 Ga0070713_100206272 Ga0070713_1002062721 335
560 3300005471 Ga0070698_100198624 Ga0070698_1001986241 335
561 3300028794 Ga0307515_10000054 Ga0307515_1000005494 335
562 3300030521 Ga0307511_10133628 Ga0307511_101336282 335
563 3300033179 Ga0307507_10032691 Ga0307507_100326913 335
564 3300033180 Ga0307510_10048199 Ga0307510_100481992 335
565 3300046459 Ga0495629_0128739 Ga0495629_0128739_362_1450 335
566 3300046660 Ga0495625_0043674 Ga0495625_0043674_1734_2780 335
567 3300046692 Ga0495671_0010375 Ga0495671_0010375_3414_4460 335
568 3300047470 Ga0495681_0003038 Ga0495681_0003038_4734_5780 335
569 3300053107 Ga0500560_005526 Ga0500560_005526_718_1764 335
570 iso_pu_bacteria 2990059506 2990064035 335
571 iso_pu_bacteria 2643221647 2644269081 336
572 iso_pu_bacteria 2751185782 2753267016 336
573 iso_pu_bacteria 2784746768 2785365640 336
574 iso_pu_bacteria 2862382967 2862387964 336
575 iso_pu_bacteria 2954701450 2954704123 336
576 iso_pu_bacteria 8008558824 8008560020 336
577 3300025908 Ga0207643_10018843 Ga0207643_100188433 337
578 3300046475 Ga0495639_0067458 Ga0495639_0067458_371_1420 339
579 3300046476 Ga0495662_0004049 Ga0495662_0004049_5440_6549 339
580 3300046477 Ga0495664_0009794 Ga0495664_0009794_3694_4803 339
581 3300046514 Ga0495618_0049259 Ga0495618_0049259_961_2070 339
582 3300046536 Ga0495587_0003615 Ga0495587_0003615_5246_6355 339
583 3300046642 Ga0495634_0005177 Ga0495634_0005177_3397_4506 339
584 3300046663 Ga0495635_0005814 Ga0495635_0005814_3867_4976 339
585 3300046675 Ga0495657_0014840 Ga0495657_0014840_4008_5117 339
586 3300046689 Ga0495613_0028743 Ga0495613_0028743_2966_4075 339
587 3300047315 Ga0495581_0017169 Ga0495581_0017169_3030_4139 339
588 3300047317 Ga0495604_0001927 Ga0495604_0001927_15266_16375 339
589 3300047321 Ga0495676_0031236 Ga0495676_0031236_2828_3937 339
590 3300047673 Ga0495593_0011852 Ga0495593_0011852_759_1868 339
591 3300001990 JGI24737J22298_10049646 JGI24737J22298_100496462 340
592 3300003316 rootH1_10053053 rootH1_100530532 340
593 3300003323 rootH1_10041438 rootH1_100414382 340
594 3300005347 Ga0070668_100013949 Ga0070668_1000139492 340
595 3300005347 Ga0070668_100045665 Ga0070668_1000456652 340
596 3300005843 Ga0068860_100207870 Ga0068860_1002078702 340
597 3300015688 Ga0183367_1001 Ga0183367_1001520 340
598 3300025904 Ga0207647_10030328 Ga0207647_100303282 340
599 3300025972 Ga0207668_10037346 Ga0207668_100373463 340
600 3300026035 Ga0207703_10074891 Ga0207703_100748911 340
601 3300026088 Ga0207641_10069736 Ga0207641_100697362 340
602 3300028380 Ga0268265_10301100 Ga0268265_103011002 340
603 3300031730 Ga0307516_10001002 Ga0307516_1000100230 340
604 3300032002 Ga0307416_100071809 Ga0307416_1000718092 340
605 3300032005 Ga0307411_10003015 Ga0307411_100030159 340
606 3300041492 Ga0451835_0730700 Ga0451835_0730700_130_1209 340
607 3300041512 Ga0451853_3283600 Ga0451853_3283600_363_1385 340
608 3300046476 Ga0495662_0013950 Ga0495662_0013950_463_1485 340
609 3300046477 Ga0495664_0039666 Ga0495664_0039666_1487_2509 340
610 3300046642 Ga0495634_0055408 Ga0495634_0055408_160_1182 340
611 3300047321 Ga0495676_0006705 Ga0495676_0006705_123_1145 340
612 3300047673 Ga0495593_0007930 Ga0495593_0007930_1251_2273 340
613 3300048089 Ga0495614_0008334 Ga0495614_0008334_1060_2082 340
614 iso_pu_bacteria 2582581312 2585297230 340
615 iso_pu_bacteria 2643221617 2644100866 340
616 iso_pu_bacteria 2643221620 2644117275 340

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

180

312

0.89

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

51

139

0.88

PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

212

347

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fbg-assembly1.cif.gz_A crystal structure of a putative arginate lyase from staphylococcus haemolyticus 0.8606 15 338
3fbg-assembly1.cif.gz_B crystal structure of a putative arginate lyase from staphylococcus haemolyticus 0.848 16 338
3gaz-assembly1.cif.gz_B crystal structure of an alcohol dehydrogenase superfamily protein from novosphingobium aromaticivorans 0.8478 14 339
4dvj-assembly1.cif.gz_B crystal structure of a putative zinc-dependent alcohol dehydrogenase protein from rhizobium etli cfn 42 0.8454 12 337
3jyl-assembly1.cif.gz_A crystal structures of pseudomonas syringae pv. tomato dc3000 quinone oxidoreductase 0.8452 15 337
ID Description Score Start End Superfamily
af_P96826_1_126_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9434 15 133 3.90.180.10
4a27B01 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9246 13 138 3.90.180.10
af_Q3UNZ8_26_154_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.923 15 140 3.90.180.10
af_P47199_9_127_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.921 16 133 3.90.180.10
1yb5B01 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9186 13 138 3.90.180.10
ID Description Score Start End GO Terms
AF-A0A4V2NFX9-F1-model_v4 Alcohol dehydrogenase-like C-terminal domain-containing protein 0.9698 142 253 GO:0016491
AF-A0A428U2E7-F1-model_v4 Enoyl reductase (ER) domain-containing protein 0.9242 15 337 GO:0016491
AF-A0A382SV47-F1-model_v4 Alcohol dehydrogenase-like N-terminal domain-containing protein 0.9191 12 147 GO:0016651
GO:0070402
AF-G4WVN3-F1-model_v4 Putative medium chain dehydrogenases/reductase 0.9166 15 133
AF-A0A178CSZ7-F1-model_v4 deleted 0.9104 12 253

Feature Viewer

pLDDT pTM Quality
92.6 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map