F469573
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 616 | 368 | 566 | 326 |
Family's Representative Sequence
| Representative Sequence | 3300046476|Ga0495662_0004049|Ga0495662_0004049_5440_6549 |
| Length | 369 |
| Sequence | MLSTPDRLSPSLREEGTPMTSSPTTMRAVQLSAPGPVDNLRPATLPLPPERDGWVRIRVEAFGLNRSELKLRLGVSEGVSFPRVPGIEAAGTVDAAPADSGLVPGQKVVAMMGDMGRTYDGGYAEYTSVPLSQVIPVDTDLPWEVLGALPEMVQTAYGSLTVGLDLQPGQSVLIRGGTSSVGLAAAALATWRGATVLSTTRRPDRLALLKERGVDHPLLDTGEVAPAVRELYPSGVDAALDLVGTPTLPDTLRAVRVHGTACFGGSLSNQWTVRDFSPNEYLPRGVRLAGYFGDASDLSPAVFQEILDAVAAGQLAFPVDRVYDGLEQVPQAHDDMEHDRATGKLVVRVRHQHGGLERDAGGASASALA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2551306166 | Nocardia tenerifensis NBRC 101015 | Isolate | Rhizosphere |
| 2 | 2558860280 | Kutzneria sp. 744 | Isolate | Unclassified |
| 3 | 2565956761 | Rhodococcus qingshengii BKS 20-40 | Isolate | Rhizosphere |
| 4 | 2582581280 | Caulobacter henricii CF287 | Isolate | Rhizosphere |
| 5 | 2582581312 | Streptomyces atratus OK008 | Isolate | Rhizosphere |
| 6 | 2582581313 | Streptomyces mirabilis OV308 | Isolate | Rhizosphere |
| 7 | 2585428157 | Microbacterium sp. CF335 | Isolate | Rhizosphere |
| 8 | 2643221576 | Nocardioides sp. Root614 | Isolate | Unclassified |
| 9 | 2643221590 | Nocardioides sp. Root682 | Isolate | Unclassified |
| 10 | 2643221617 | Nocardioides sp. Root79 | Isolate | Unclassified |
| 11 | 2643221620 | Nocardioides sp. Root240 | Isolate | Unclassified |
| 12 | 2643221647 | Streptomyces sp. Root369 | Isolate | Unclassified |
| 13 | 2643221694 | Cellulomonas sp. Root137 | Isolate | Unclassified |
| 14 | 2643221722 | Cellulomonas sp. Root930 | Isolate | Unclassified |
| 15 | 2643221961 | Aeromicrobium sp. Root236 | Isolate | Unclassified |
| 16 | 2643221962 | Aeromicrobium sp. Root344 | Isolate | Unclassified |
| 17 | 2731639228 | Motilibacter peucedani DSM 45328 | Isolate | Rhizosphere |
| 18 | 2738541272 | Promicromonospora sp. AC04 | Isolate | Unclassified |
| 19 | 2738543027 | Promicromonospora sp. CF082 | Isolate | Unclassified |
| 20 | 2751185782 | Actinoplanes subtropicus NRRL B-24665 | Isolate | Rhizosphere |
| 21 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 22 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 23 | 2811994880 | Cellulomonas sp. SLBN-39 | Isolate | Unclassified |
| 24 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 25 | 2867428634 | Streptomyces sp. RP5T | Isolate | Unclassified |
| 26 | 2904535858 | Rhodococcus erythropolis 2017 | Isolate | Unclassified |
| 27 | 2919042368 | Curtobacterium sp. 320 | Isolate | Rhizosphere |
| 28 | 2922554459 | Rhodococcus sp. 66b | Isolate | Unclassified |
| 29 | 2928104781 | Curtobacterium sp. 1544 | Isolate | Rhizosphere |
| 30 | 2939657138 | Conyzicola nivalis 2857 | Isolate | Rhizosphere |
| 31 | 2946041624 | Microbacterium natoriense W4I9-1 | Isolate | Rhizosphere |
| 32 | 2954380949 | Streptomyces ciscaucasicus W1I15 | Isolate | Rhizosphere |
| 33 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 34 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 35 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 36 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 37 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 38 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 39 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 40 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 41 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 42 | 2954759201 | Streptomyces sp. SAI-208 | Isolate | Rhizosphere |
| 43 | 2984551494 | Curtobacterium sp. SORGH_AS776 | Isolate | Aerial Root |
| 44 | 2990059506 | Streptomyces sp. CAP261 | Isolate | Unclassified |
| 45 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 46 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 47 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 48 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 49 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 54 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 58 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 73 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 77 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 79 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 82 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 83 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 84 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 85 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 87 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 88 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 89 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 90 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 91 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 92 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 93 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 94 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 95 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 96 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 97 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 98 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 99 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 100 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 101 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 102 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 103 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 104 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 106 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 115 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300015688 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 | Metagenome | Rhizosphere |
| 129 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 130 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 131 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 132 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 133 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 183 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 187 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 188 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 189 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 190 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 191 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 192 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 193 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 194 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 195 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 196 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 197 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 198 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 199 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 200 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 201 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 202 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 203 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 204 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 205 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 206 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 207 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 208 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 209 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 210 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 211 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 212 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 213 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 214 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 215 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 216 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 217 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 218 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 219 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 220 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 221 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 222 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 223 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 224 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 225 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 226 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 227 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 228 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 229 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 230 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 231 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 232 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 291 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 292 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 293 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 294 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 295 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 296 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 297 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 298 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 299 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 300 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 301 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 302 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 303 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 304 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 305 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 306 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 307 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 308 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 309 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 310 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 311 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 312 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 313 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 314 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 315 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 335 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 336 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 337 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 338 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 339 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 340 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 341 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 342 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 344 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 345 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 349 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 350 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 351 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 352 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 353 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 354 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 355 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 356 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 357 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 358 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 359 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 360 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 361 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 362 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 363 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 364 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 365 | 8003314358 | Amycolatopsis sp. MtRt-6 | Isolate | Unclassified |
| 366 | 8008558824 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 367 | 8053945823 | Actinomadura terrae OS3-83 | Isolate | Rhizosphere |
| 368 | 8055066027 | Sphaerisporangium corydalis NEAU-YHS15 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.56 |
| Metatranscriptomes | 0.32 |
| Isolates | 8.12 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.16 |
| Bulb | 0 |
| Endosphere | 8.44 |
| Nodule | 0.32 |
| Rhizoplane | 8.44 |
| Rhizosphere | 71.27 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.36 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24737J22298_10049646 | 3300001990 | Bacteria | 1276 |
| 2 | JGI25151J46595_10000769 | 3300003187 | Bacteria | 25987 |
| 3 | rootH1_10053053 | 3300003316 | Bacteria | 4362 |
| 4 | rootH1_10041438 | 3300003323 | Bacteria | 3359 |
| 5 | Ga0070658_10089133 | 3300005327 | Bacteria | 2540 |
| 6 | Ga0070676_10077517 | 3300005328 | Bacteria | 2009 |
| 7 | Ga0070683_100248091 | 3300005329 | Bacteria | 1693 |
| 8 | Ga0070670_100051560 | 3300005331 | Bacteria | 3533 |
| 9 | Ga0068869_100009466 | 3300005334 | Bacteria | 6322 |
| 10 | Ga0068869_100376377 | 3300005334 | Bacteria | 1163 |
| 11 | Ga0070680_100021304 | 3300005336 | Bacteria | 5150 |
| 12 | Ga0070680_100039866 | 3300005336 | Bacteria | 3801 |
| 13 | Ga0070682_100123974 | 3300005337 | Unclassified | 1739 |
| 14 | Ga0070660_100042237 | 3300005339 | Bacteria | 3479 |
| 15 | Ga0070689_100044844 | 3300005340 | Bacteria | 3403 |
| 16 | Ga0070691_10036013 | 3300005341 | Bacteria | 2332 |
| 17 | Ga0070661_100042434 | 3300005344 | Bacteria | 3320 |
| 18 | Ga0070692_10012861 | 3300005345 | Bacteria | 3887 |
| 19 | Ga0070668_100013949 | 3300005347 | Bacteria | 6008 |
| 20 | Ga0070668_100045665 | 3300005347 | Bacteria | 3361 |
| 21 | Ga0070675_100013573 | 3300005354 | Bacteria | 6406 |
| 22 | Ga0070671_100001046 | 3300005355 | Bacteria | 20386 |
| 23 | Ga0070671_100018102 | 3300005355 | Bacteria | 5719 |
| 24 | Ga0070709_10114926 | 3300005434 | Bacteria | 1814 |
| 25 | Ga0070709_10134016 | 3300005434 | Bacteria | 1694 |
| 26 | Ga0070714_100019448 | 3300005435 | Bacteria | 5534 |
| 27 | Ga0070714_100029866 | 3300005435 | Bacteria | 4534 |
| 28 | Ga0070714_100040151 | 3300005435 | Bacteria | 3943 |
| 29 | Ga0070714_100094693 | 3300005435 | Bacteria | 2621 |
| 30 | Ga0070714_100156243 | 3300005435 | Bacteria | 2059 |
| 31 | Ga0070714_100221932 | 3300005435 | Bacteria | 1737 |
| 32 | Ga0070714_100491348 | 3300005435 | Bacteria | 1169 |
| 33 | Ga0070713_100012145 | 3300005436 | Bacteria | 6307 |
| 34 | Ga0070713_100206272 | 3300005436 | Bacteria | 1777 |
| 35 | Ga0070713_100303915 | 3300005436 | Bacteria | 1469 |
| 36 | Ga0070713_100429742 | 3300005436 | Bacteria | 1237 |
| 37 | Ga0070710_10021580 | 3300005437 | Bacteria | 3358 |
| 38 | Ga0070710_10022589 | 3300005437 | Bacteria | 3293 |
| 39 | Ga0070710_10024425 | 3300005437 | Bacteria | 3188 |
| 40 | Ga0070710_10039256 | 3300005437 | Bacteria | 2604 |
| 41 | Ga0070710_10043380 | 3300005437 | Bacteria | 2491 |
| 42 | Ga0070710_10070421 | 3300005437 | Bacteria | 2014 |
| 43 | Ga0070711_100043287 | 3300005439 | Bacteria | 3049 |
| 44 | Ga0070708_100143684 | 3300005445 | Bacteria | 2214 |
| 45 | Ga0070708_100179380 | 3300005445 | Bacteria | 1979 |
| 46 | Ga0070663_100005950 | 3300005455 | Bacteria | 7301 |
| 47 | Ga0070663_100009489 | 3300005455 | Bacteria | 6028 |
| 48 | Ga0070663_100135328 | 3300005455 | Bacteria | 1876 |
| 49 | Ga0070663_100255333 | 3300005455 | Bacteria | 1389 |
| 50 | Ga0070678_100011405 | 3300005456 | Bacteria | 5481 |
| 51 | Ga0070681_10022171 | 3300005458 | Bacteria | 6374 |
| 52 | Ga0070681_10040295 | 3300005458 | Bacteria | 4680 |
| 53 | Ga0070706_100003816 | 3300005467 | Bacteria | 14727 |
| 54 | Ga0070706_100006313 | 3300005467 | Bacteria | 11197 |
| 55 | Ga0070707_100047224 | 3300005468 | Plasmid | 4121 |
| 56 | Ga0070698_100198624 | 3300005471 | Bacteria | 1941 |
| 57 | Ga0070679_100093227 | 3300005530 | Bacteria | 2999 |
| 58 | Ga0070672_100148946 | 3300005543 | Bacteria | 1935 |
| 59 | Ga0070686_100118353 | 3300005544 | Bacteria | 1815 |
| 60 | Ga0070686_100244121 | 3300005544 | Bacteria | 1309 |
| 61 | Ga0070693_100002076 | 3300005547 | Bacteria | 9168 |
| 62 | Ga0070665_100025406 | 3300005548 | Bacteria | 5969 |
| 63 | Ga0070665_100080901 | 3300005548 | Bacteria | 3254 |
| 64 | Ga0070665_100085505 | 3300005548 | Bacteria | 3159 |
| 65 | Ga0070665_100299521 | 3300005548 | Bacteria | 1611 |
| 66 | Ga0068855_100022930 | 3300005563 | Bacteria | 7482 |
| 67 | Ga0068855_100269422 | 3300005563 | Bacteria | 1894 |
| 68 | Ga0068857_100168394 | 3300005577 | Bacteria | 1991 |
| 69 | Ga0068857_100169096 | 3300005577 | Bacteria | 1986 |
| 70 | Ga0068854_100021103 | 3300005578 | Bacteria | 4416 |
| 71 | Ga0068854_100036359 | 3300005578 | Bacteria | 3452 |
| 72 | Ga0068856_100026135 | 3300005614 | Bacteria | 5692 |
| 73 | Ga0068856_100133767 | 3300005614 | Bacteria | 2485 |
| 74 | Ga0068856_100149698 | 3300005614 | Bacteria | 2343 |
| 75 | Ga0068856_100414784 | 3300005614 | Bacteria | 1367 |
| 76 | Ga0070702_100033876 | 3300005615 | Bacteria | 2811 |
| 77 | Ga0068852_100011084 | 3300005616 | Bacteria | 6769 |
| 78 | Ga0068852_100018355 | 3300005616 | Bacteria | 5510 |
| 79 | Ga0068852_100043303 | 3300005616 | Bacteria | 3817 |
| 80 | Ga0068859_100058411 | 3300005617 | Bacteria | 3886 |
| 81 | Ga0068859_100471998 | 3300005617 | Bacteria | 1350 |
| 82 | Ga0068864_100060920 | 3300005618 | Bacteria | 3268 |
| 83 | Ga0068870_10012123 | 3300005840 | Bacteria | 4019 |
| 84 | Ga0068870_10015112 | 3300005840 | Bacteria | 3656 |
| 85 | Ga0068863_100091661 | 3300005841 | Bacteria | 2882 |
| 86 | Ga0068858_100017388 | 3300005842 | Bacteria | 6746 |
| 87 | Ga0068860_100207870 | 3300005843 | Bacteria | 1898 |
| 88 | Ga0068860_100272859 | 3300005843 | Bacteria | 1651 |
| 89 | Ga0068862_100554305 | 3300005844 | Bacteria | 1098 |
| 90 | Ga0075365_10022559 | 3300006038 | Bacteria | 3946 |
| 91 | Ga0075365_10036575 | 3300006038 | Bacteria | 3181 |
| 92 | Ga0075365_10037810 | 3300006038 | Bacteria | 3134 |
| 93 | Ga0075364_10032174 | 3300006051 | Bacteria | 3370 |
| 94 | Ga0075367_10012007 | 3300006178 | Bacteria | 4601 |
| 95 | Ga0075369_10003754 | 3300006186 | Bacteria | 5555 |
| 96 | Ga0075369_10053157 | 3300006186 | Bacteria | 1757 |
| 97 | Ga0075370_10010023 | 3300006353 | Bacteria | 4941 |
| 98 | Ga0075370_10087778 | 3300006353 | Bacteria | 1792 |
| 99 | Ga0068871_100287482 | 3300006358 | Bacteria | 1440 |
| 100 | Ga0075430_100000153 | 3300006846 | Bacteria | 44870 |
| 101 | Ga0075431_100003539 | 3300006847 | Bacteria | 15125 |
| 102 | Ga0075429_100080704 | 3300006880 | Bacteria | 2836 |
| 103 | Ga0075436_100089276 | 3300006914 | Bacteria | 2141 |
| 104 | Ga0097620_100058410 | 3300006931 | Bacteria | 3886 |
| 105 | Ga0097620_100472003 | 3300006931 | Bacteria | 1350 |
| 106 | Ga0099794_10078094 | 3300007265 | Bacteria | 1630 |
| 107 | Ga0105240_10034163 | 3300009093 | Bacteria | 6562 |
| 108 | Ga0111539_10000053 | 3300009094 | Bacteria | 115976 |
| 109 | Ga0111539_10027595 | 3300009094 | Bacteria | 6934 |
| 110 | Ga0111539_10035413 | 3300009094 | Bacteria | 6044 |
| 111 | Ga0105245_10048790 | 3300009098 | Bacteria | 3788 |
| 112 | Ga0105245_10115652 | 3300009098 | Bacteria | 2500 |
| 113 | Ga0105241_10143173 | 3300009174 | Bacteria | 1949 |
| 114 | Ga0105248_10031176 | 3300009177 | Bacteria | 5959 |
| 115 | Ga0105237_10019291 | 3300009545 | Bacteria | 7044 |
| 116 | Ga0105237_10101540 | 3300009545 | Bacteria | 2868 |
| 117 | Ga0105237_10248185 | 3300009545 | Bacteria | 1782 |
| 118 | Ga0105238_10021125 | 3300009551 | Bacteria | 6634 |
| 119 | Ga0105238_10053988 | 3300009551 | Bacteria | 4037 |
| 120 | Ga0105238_10059219 | 3300009551 | Bacteria | 3837 |
| 121 | Ga0105249_10178605 | 3300009553 | Bacteria | 2064 |
| 122 | Ga0099796_10002604 | 3300010159 | Bacteria | 4004 |
| 123 | Ga0105239_10127048 | 3300010375 | Bacteria | 2835 |
| 124 | Ga0105246_10005389 | 3300011119 | Bacteria | 7788 |
| 125 | Ga0157373_10024658 | 3300013100 | Bacteria | 4356 |
| 126 | Ga0157371_10034782 | 3300013102 | Bacteria | 3613 |
| 127 | Ga0157370_10039800 | 3300013104 | Bacteria | 4541 |
| 128 | Ga0157370_10050565 | 3300013104 | Bacteria | 3972 |
| 129 | Ga0157369_10102172 | 3300013105 | Bacteria | 3055 |
| 130 | Ga0157374_10020541 | 3300013296 | Bacteria | 5861 |
| 131 | Ga0157374_10060763 | 3300013296 | Bacteria | 3537 |
| 132 | Ga0157374_10169788 | 3300013296 | Bacteria | 2127 |
| 133 | Ga0163162_10205612 | 3300013306 | Bacteria | 2098 |
| 134 | Ga0163162_10408358 | 3300013306 | Bacteria | 1491 |
| 135 | Ga0157372_10094799 | 3300013307 | Bacteria | 3399 |
| 136 | Ga0157372_10665523 | 3300013307 | Unclassified | 1212 |
| 137 | Ga0157375_10164341 | 3300013308 | Bacteria | 2364 |
| 138 | Ga0163163_10224422 | 3300014325 | Bacteria | 1928 |
| 139 | Ga0157377_10017106 | 3300014745 | Bacteria | 3745 |
| 140 | Ga0157379_10008747 | 3300014968 | Bacteria | 8824 |
| 141 | Ga0157379_10121175 | 3300014968 | Bacteria | 2353 |
| 142 | Ga0157379_10167057 | 3300014968 | Bacteria | 1986 |
| 143 | Ga0157379_10224513 | 3300014968 | Bacteria | 1702 |
| 144 | Ga0183367_1001 | 3300015688 | Bacteria | 1225545 |
| 145 | Ga0206354_10846943 | 3300020081 | Bacteria | 1924 |
| 146 | Ga0206353_10999702 | 3300020082 | Bacteria | 2340 |
| 147 | Ga0213875_10119799 | 3300021388 | Bacteria | 1230 |
| 148 | Ga0209129_1005596 | 3300025258 | Bacteria | 4374 |
| 149 | Ga0209025_1000238 | 3300025294 | Bacteria | 128478 |
| 150 | Ga0207692_10007199 | 3300025898 | Bacteria | 4547 |
| 151 | Ga0207692_10020494 | 3300025898 | Bacteria | 3008 |
| 152 | Ga0207692_10052261 | 3300025898 | Bacteria | 2076 |
| 153 | Ga0207692_10096169 | 3300025898 | Bacteria | 1616 |
| 154 | Ga0207710_10011014 | 3300025900 | Bacteria | 3809 |
| 155 | Ga0207688_10004087 | 3300025901 | Bacteria | 7951 |
| 156 | Ga0207647_10016829 | 3300025904 | Bacteria | 4982 |
| 157 | Ga0207647_10030328 | 3300025904 | Bacteria | 3490 |
| 158 | Ga0207685_10013593 | 3300025905 | Bacteria | 2523 |
| 159 | Ga0207699_10047042 | 3300025906 | Bacteria | 2527 |
| 160 | Ga0207643_10000320 | 3300025908 | Bacteria | 33014 |
| 161 | Ga0207643_10018843 | 3300025908 | Bacteria | 3781 |
| 162 | Ga0207705_10171379 | 3300025909 | Bacteria | 1634 |
| 163 | Ga0207684_10000572 | 3300025910 | Bacteria | 44774 |
| 164 | Ga0207684_10017279 | 3300025910 | Bacteria | 6188 |
| 165 | Ga0207684_10336492 | 3300025910 | Bacteria | 1300 |
| 166 | Ga0207654_10010884 | 3300025911 | Bacteria | 4630 |
| 167 | Ga0207654_10018963 | 3300025911 | Bacteria | 3619 |
| 168 | Ga0207707_10003499 | 3300025912 | Bacteria | 13902 |
| 169 | Ga0207707_10132784 | 3300025912 | Bacteria | 2177 |
| 170 | Ga0207695_10007844 | 3300025913 | Bacteria | 13497 |
| 171 | Ga0207695_10084442 | 3300025913 | Bacteria | 3206 |
| 172 | Ga0207695_10333529 | 3300025913 | Bacteria | 1405 |
| 173 | Ga0207695_10371672 | 3300025913 | Bacteria | 1316 |
| 174 | Ga0207671_10000128 | 3300025914 | Bacteria | 117836 |
| 175 | Ga0207671_10004312 | 3300025914 | Bacteria | 13675 |
| 176 | Ga0207671_10206507 | 3300025914 | Bacteria | 1535 |
| 177 | Ga0207693_10033591 | 3300025915 | Bacteria | 4047 |
| 178 | Ga0207693_10037038 | 3300025915 | Bacteria | 3845 |
| 179 | Ga0207693_10045847 | 3300025915 | Bacteria | 3434 |
| 180 | Ga0207693_10167531 | 3300025915 | Bacteria | 1730 |
| 181 | Ga0207663_10027738 | 3300025916 | Bacteria | 3305 |
| 182 | Ga0207663_10228053 | 3300025916 | Bacteria | 1359 |
| 183 | Ga0207657_10212793 | 3300025919 | Bacteria | 1551 |
| 184 | Ga0207649_10049456 | 3300025920 | Bacteria | 2597 |
| 185 | Ga0207646_10018661 | 3300025922 | Bacteria | 6466 |
| 186 | Ga0207646_10105726 | 3300025922 | Bacteria | 2524 |
| 187 | Ga0207650_10030103 | 3300025925 | Bacteria | 3907 |
| 188 | Ga0207659_10237032 | 3300025926 | Bacteria | 1474 |
| 189 | Ga0207687_10020072 | 3300025927 | Bacteria | 4432 |
| 190 | Ga0207700_10017397 | 3300025928 | Bacteria | 4801 |
| 191 | Ga0207700_10121435 | 3300025928 | Bacteria | 2119 |
| 192 | Ga0207700_10129643 | 3300025928 | Bacteria | 2057 |
| 193 | Ga0207700_10185332 | 3300025928 | Bacteria | 1745 |
| 194 | Ga0207664_10015710 | 3300025929 | Bacteria | 5504 |
| 195 | Ga0207664_10025275 | 3300025929 | Bacteria | 4471 |
| 196 | Ga0207664_10030369 | 3300025929 | Bacteria | 4126 |
| 197 | Ga0207644_10000937 | 3300025931 | Bacteria | 18559 |
| 198 | Ga0207644_10021755 | 3300025931 | Bacteria | 4373 |
| 199 | Ga0207690_10020389 | 3300025932 | Bacteria | 4096 |
| 200 | Ga0207706_10272702 | 3300025933 | Bacteria | 1476 |
| 201 | Ga0207686_10213512 | 3300025934 | Bacteria | 1389 |
| 202 | Ga0207665_10050991 | 3300025939 | Bacteria | 2784 |
| 203 | Ga0207665_10141037 | 3300025939 | Bacteria | 1718 |
| 204 | Ga0207691_10115416 | 3300025940 | Bacteria | 2384 |
| 205 | Ga0207689_10018038 | 3300025942 | Bacteria | 5960 |
| 206 | Ga0207661_10009547 | 3300025944 | Bacteria | 6964 |
| 207 | Ga0207679_10006069 | 3300025945 | Bacteria | 7617 |
| 208 | Ga0207667_10044156 | 3300025949 | Bacteria | 4724 |
| 209 | Ga0207668_10037346 | 3300025972 | Bacteria | 3250 |
| 210 | Ga0207640_10134746 | 3300025981 | Bacteria | 1791 |
| 211 | Ga0207677_10004031 | 3300026023 | Bacteria | 7841 |
| 212 | Ga0207703_10016168 | 3300026035 | Bacteria | 5816 |
| 213 | Ga0207703_10074891 | 3300026035 | Bacteria | 2804 |
| 214 | Ga0207703_10197546 | 3300026035 | Bacteria | 1785 |
| 215 | Ga0207639_10319921 | 3300026041 | Bacteria | 1377 |
| 216 | Ga0207678_10000094 | 3300026067 | Bacteria | 74360 |
| 217 | Ga0207678_10075872 | 3300026067 | Bacteria | 2880 |
| 218 | Ga0207708_10072017 | 3300026075 | Bacteria | 2648 |
| 219 | Ga0207702_10013617 | 3300026078 | Bacteria | 6755 |
| 220 | Ga0207702_10100318 | 3300026078 | Bacteria | 2554 |
| 221 | Ga0207702_10156663 | 3300026078 | Bacteria | 2077 |
| 222 | Ga0207641_10069736 | 3300026088 | Bacteria | 3020 |
| 223 | Ga0207641_10128323 | 3300026088 | Bacteria | 2273 |
| 224 | Ga0207641_10273869 | 3300026088 | Unclassified | 1585 |
| 225 | Ga0207676_10039831 | 3300026095 | Bacteria | 3597 |
| 226 | Ga0207676_10452349 | 3300026095 | Bacteria | 1211 |
| 227 | Ga0207674_10166648 | 3300026116 | Bacteria | 2157 |
| 228 | Ga0207674_10216035 | 3300026116 | Bacteria | 1866 |
| 229 | Ga0207675_100472221 | 3300026118 | Bacteria | 1245 |
| 230 | Ga0207683_10040447 | 3300026121 | Bacteria | 4068 |
| 231 | Ga0207698_10083755 | 3300026142 | Bacteria | 2582 |
| 232 | Ga0207698_10094713 | 3300026142 | Bacteria | 2456 |
| 233 | Ga0207698_10250505 | 3300026142 | Bacteria | 1620 |
| 234 | Ga0209179_1002691 | 3300027512 | Bacteria | 2447 |
| 235 | Ga0207428_10000061 | 3300027907 | Bacteria | 155152 |
| 236 | Ga0207428_10044090 | 3300027907 | Bacteria | 3599 |
| 237 | Ga0268266_10101673 | 3300028379 | Bacteria | 2534 |
| 238 | Ga0268266_10308046 | 3300028379 | Bacteria | 1479 |
| 239 | Ga0268266_10446837 | 3300028379 | Bacteria | 1228 |
| 240 | Ga0268265_10301100 | 3300028380 | Bacteria | 1444 |
| 241 | Ga0268264_10174958 | 3300028381 | Bacteria | 1945 |
| 242 | Ga0307517_10007075 | 3300028786 | Bacteria | 16452 |
| 243 | Ga0307517_10062147 | 3300028786 | Bacteria | 3518 |
| 244 | Ga0307517_10141210 | 3300028786 | Bacteria | 1690 |
| 245 | Ga0307515_10000054 | 3300028794 | Bacteria | 265489 |
| 246 | Ga0307515_10000506 | 3300028794 | Bacteria | 93172 |
| 247 | Ga0265338_10018231 | 3300028800 | Bacteria | 7524 |
| 248 | Ga0307511_10000238 | 3300030521 | Bacteria | 56455 |
| 249 | Ga0307511_10000290 | 3300030521 | Bacteria | 52945 |
| 250 | Ga0307511_10133628 | 3300030521 | Bacteria | 1485 |
| 251 | Ga0316178_1058387 | 3300030735 | Bacteria | 2280 |
| 252 | Ga0316182_1430484 | 3300030745 | Bacteria | 1781 |
| 253 | Ga0307509_10044423 | 3300031507 | Bacteria | 4801 |
| 254 | Ga0307509_10049988 | 3300031507 | Bacteria | 4479 |
| 255 | Ga0307509_10109537 | 3300031507 | Bacteria | 2771 |
| 256 | Ga0307408_100238547 | 3300031548 | Bacteria | 1493 |
| 257 | Ga0307508_10001814 | 3300031616 | Bacteria | 23664 |
| 258 | Ga0307508_10102062 | 3300031616 | Bacteria | 2465 |
| 259 | Ga0307514_10033652 | 3300031649 | Bacteria | 4089 |
| 260 | Ga0307516_10001002 | 3300031730 | Bacteria | 39096 |
| 261 | Ga0307516_10015060 | 3300031730 | Bacteria | 8152 |
| 262 | Ga0307413_10291866 | 3300031824 | Bacteria | 1232 |
| 263 | Ga0307518_10017622 | 3300031838 | Bacteria | 5120 |
| 264 | Ga0307518_10056347 | 3300031838 | Bacteria | 2855 |
| 265 | Ga0307410_10007200 | 3300031852 | Bacteria | 6072 |
| 266 | Ga0307410_10008780 | 3300031852 | Bacteria | 5629 |
| 267 | Ga0326468_10001733 | 3300031889 | Bacteria | 1871 |
| 268 | Ga0307406_10000031 | 3300031901 | Bacteria | 87391 |
| 269 | Ga0307406_10012500 | 3300031901 | Bacteria | 4839 |
| 270 | Ga0307406_10095206 | 3300031901 | Bacteria | 2014 |
| 271 | Ga0307406_10118269 | 3300031901 | Bacteria | 1837 |
| 272 | Ga0307409_100003063 | 3300031995 | Bacteria | 8943 |
| 273 | Ga0307416_100071809 | 3300032002 | Bacteria | 2878 |
| 274 | Ga0307416_100079778 | 3300032002 | Bacteria | 2760 |
| 275 | Ga0307411_10003015 | 3300032005 | Bacteria | 7678 |
| 276 | Ga0307507_10000008 | 3300033179 | Bacteria | 266336 |
| 277 | Ga0307507_10032691 | 3300033179 | Bacteria | 5424 |
| 278 | Ga0307507_10053330 | 3300033179 | Bacteria | 3864 |
| 279 | Ga0307510_10048199 | 3300033180 | Bacteria | 4549 |
| 280 | Ga0307510_10085969 | 3300033180 | Bacteria | 3018 |
| 281 | Ga0307510_10248956 | 3300033180 | Bacteria | 1266 |
| 282 | Ga0373934_0048507 | 3300035086 | Bacteria | 1681 |
| 283 | Ga0373936_0055295 | 3300035113 | Bacteria | 1611 |
| 284 | Ga0373954_0044835 | 3300035118 | Bacteria | 2065 |
| 285 | Ga0373943_0073750 | 3300035170 | Archaea | 1734 |
| 286 | Ga0373955_0031223 | 3300035172 | Bacteria | 2789 |
| 287 | Ga0373924_0005353 | 3300035410 | Bacteria | 4539 |
| 288 | Ga0373935_0045207 | 3300035692 | Archaea | 2778 |
| 289 | Ga0373927_0147362 | 3300035695 | Archaea | 1541 |
| 290 | Ga0373933_0046743 | 3300035724 | Bacteria | 2571 |
| 291 | Ga0373937_0023231 | 3300036401 | Bacteria | 5582 |
| 292 | Ga0373937_0109191 | 3300036401 | Bacteria | 2572 |
| 293 | Ga0373937_0449116 | 3300036401 | Bacteria | 1224 |
| 294 | Ga0373925_0001664 | 3300037068 | Bacteria | 18719 |
| 295 | Ga0373925_0079338 | 3300037068 | Archaea | 2494 |
| 296 | Ga0395900_0156704 | 3300037418 | Bacteria | 2326 |
| 297 | Ga0395898_0046801 | 3300037466 | Bacteria | 4248 |
| 298 | Ga0395898_0293107 | 3300037466 | Bacteria | 1552 |
| 299 | Ga0436364_0439304 | 3300037853 | Bacteria | 6424 |
| 300 | Ga0436364_1360742 | 3300037853 | Unclassified | 1329 |
| 301 | Ga0395901_0094126 | 3300038443 | Bacteria | 3138 |
| 302 | Ga0436361_0931125 | 3300039447 | Bacteria | 3524 |
| 303 | Ga0451789_0538276 | 3300041443 | Bacteria | 2103 |
| 304 | Ga0451793_1839129 | 3300041452 | Bacteria | 1082 |
| 305 | Ga0451795_1077384 | 3300041456 | Bacteria | 2698 |
| 306 | Ga0451833_0871186 | 3300041491 | Bacteria | 1343 |
| 307 | Ga0451835_0730700 | 3300041492 | Bacteria | 1239 |
| 308 | Ga0451853_0096543 | 3300041512 | Bacteria | 4047 |
| 309 | Ga0451853_0677297 | 3300041512 | Bacteria | 2429 |
| 310 | Ga0451853_3283600 | 3300041512 | Bacteria | 2278 |
| 311 | Ga0439455_0007474 | 3300042012 | Bacteria | 2312 |
| 312 | Ga0450903_002650 | 3300042138 | Bacteria | 3152 |
| 313 | Ga0466970_0020206 | 3300044765 | Bacteria | 3458 |
| 314 | Ga0495592_0017133 | 3300046454 | Bacteria | 5501 |
| 315 | Ga0495592_0155514 | 3300046454 | Bacteria | 1578 |
| 316 | Ga0495603_0014154 | 3300046455 | Bacteria | 4827 |
| 317 | Ga0495603_0117531 | 3300046455 | Bacteria | 1550 |
| 318 | Ga0495603_0176268 | 3300046455 | Bacteria | 1238 |
| 319 | Ga0495590_0001720 | 3300046457 | Bacteria | 9307 |
| 320 | Ga0495629_0076868 | 3300046459 | Bacteria | 2330 |
| 321 | Ga0495629_0128739 | 3300046459 | Bacteria | 1763 |
| 322 | Ga0495629_0178857 | 3300046459 | Bacteria | 1471 |
| 323 | Ga0495638_0072207 | 3300046460 | Bacteria | 2110 |
| 324 | Ga0495638_0083278 | 3300046460 | Bacteria | 1938 |
| 325 | Ga0495638_0105316 | 3300046460 | Bacteria | 1681 |
| 326 | Ga0495651_0000193 | 3300046462 | Bacteria | 45921 |
| 327 | Ga0495651_0015837 | 3300046462 | Bacteria | 5836 |
| 328 | Ga0495651_0086491 | 3300046462 | Bacteria | 2358 |
| 329 | Ga0495653_0010123 | 3300046463 | Bacteria | 7715 |
| 330 | Ga0495653_0043720 | 3300046463 | Bacteria | 3481 |
| 331 | Ga0495653_0052292 | 3300046463 | Bacteria | 3131 |
| 332 | Ga0495580_0155318 | 3300046472 | Archaea | 1585 |
| 333 | Ga0495580_0222424 | 3300046472 | Bacteria | 1297 |
| 334 | Ga0495582_0035575 | 3300046473 | Bacteria | 2739 |
| 335 | Ga0495582_0081614 | 3300046473 | Bacteria | 1796 |
| 336 | Ga0495582_0156392 | 3300046473 | Bacteria | 1295 |
| 337 | Ga0495639_0067458 | 3300046475 | Bacteria | 1648 |
| 338 | Ga0495662_0004049 | 3300046476 | Bacteria | 7382 |
| 339 | Ga0495662_0013950 | 3300046476 | Bacteria | 3911 |
| 340 | Ga0495662_0019331 | 3300046476 | Bacteria | 3294 |
| 341 | Ga0495664_0002297 | 3300046477 | Bacteria | 10249 |
| 342 | Ga0495664_0009794 | 3300046477 | Bacteria | 5373 |
| 343 | Ga0495664_0039666 | 3300046477 | Bacteria | 2783 |
| 344 | Ga0495664_0210241 | 3300046477 | Bacteria | 1178 |
| 345 | Ga0495584_0210294 | 3300046491 | Bacteria | 989 |
| 346 | Ga0495594_0049224 | 3300046499 | Bacteria | 2316 |
| 347 | Ga0495607_0162228 | 3300046501 | Bacteria | 1135 |
| 348 | Ga0495583_0029841 | 3300046506 | Bacteria | 2664 |
| 349 | Ga0495608_0021626 | 3300046511 | Bacteria | 4414 |
| 350 | Ga0495608_0051382 | 3300046511 | Bacteria | 2732 |
| 351 | Ga0495618_0049259 | 3300046514 | Bacteria | 2660 |
| 352 | Ga0495618_0122400 | 3300046514 | Bacteria | 1666 |
| 353 | Ga0495620_0010421 | 3300046515 | Bacteria | 4906 |
| 354 | Ga0495628_0034116 | 3300046516 | Bacteria | 4096 |
| 355 | Ga0495628_0171425 | 3300046516 | Bacteria | 1645 |
| 356 | Ga0495630_0052374 | 3300046517 | Bacteria | 3055 |
| 357 | Ga0495630_0283345 | 3300046517 | Bacteria | 1266 |
| 358 | Ga0495652_0006723 | 3300046529 | Bacteria | 10673 |
| 359 | Ga0495652_0039169 | 3300046529 | Bacteria | 4099 |
| 360 | Ga0495652_0186237 | 3300046529 | Bacteria | 1588 |
| 361 | Ga0495665_0054965 | 3300046531 | Bacteria | 2103 |
| 362 | Ga0495640_0008530 | 3300046533 | Bacteria | 8032 |
| 363 | Ga0495586_0039866 | 3300046535 | Bacteria | 2525 |
| 364 | Ga0495587_0001614 | 3300046536 | Bacteria | 15003 |
| 365 | Ga0495587_0003615 | 3300046536 | Bacteria | 10289 |
| 366 | Ga0495587_0055277 | 3300046536 | Bacteria | 2338 |
| 367 | Ga0495645_0024742 | 3300046543 | Bacteria | 4357 |
| 368 | Ga0495645_0027710 | 3300046543 | Bacteria | 4115 |
| 369 | Ga0495645_0235717 | 3300046543 | Bacteria | 1223 |
| 370 | Ga0495622_0051713 | 3300046557 | Bacteria | 1906 |
| 371 | Ga0495667_0006676 | 3300046559 | Bacteria | 7831 |
| 372 | Ga0495667_0023204 | 3300046559 | Bacteria | 4180 |
| 373 | Ga0495667_0091484 | 3300046559 | Bacteria | 1970 |
| 374 | Ga0495667_0154919 | 3300046559 | Bacteria | 1475 |
| 375 | Ga0495667_0236302 | 3300046559 | Bacteria | 1165 |
| 376 | Ga0495668_0028362 | 3300046616 | Bacteria | 3166 |
| 377 | Ga0495634_0005177 | 3300046642 | Bacteria | 10076 |
| 378 | Ga0495634_0055408 | 3300046642 | Bacteria | 2651 |
| 379 | Ga0495625_0043674 | 3300046660 | Bacteria | 3249 |
| 380 | Ga0495635_0005814 | 3300046663 | Bacteria | 8595 |
| 381 | Ga0495635_0009154 | 3300046663 | Bacteria | 6911 |
| 382 | Ga0495635_0009800 | 3300046663 | Bacteria | 6696 |
| 383 | Ga0495635_0036314 | 3300046663 | Bacteria | 3416 |
| 384 | Ga0495635_0053985 | 3300046663 | Bacteria | 2768 |
| 385 | Ga0495588_0000623 | 3300046674 | Bacteria | 16590 |
| 386 | Ga0495588_0047956 | 3300046674 | Bacteria | 2194 |
| 387 | Ga0495657_0014840 | 3300046675 | Bacteria | 5715 |
| 388 | Ga0495657_0050923 | 3300046675 | Bacteria | 2782 |
| 389 | Ga0495599_0001737 | 3300046678 | Bacteria | 12601 |
| 390 | Ga0495623_0025060 | 3300046679 | Bacteria | 3842 |
| 391 | Ga0495623_0152428 | 3300046679 | Bacteria | 1365 |
| 392 | Ga0495646_0019197 | 3300046680 | Bacteria | 4329 |
| 393 | Ga0495658_0222782 | 3300046683 | Bacteria | 1181 |
| 394 | Ga0495613_0017908 | 3300046689 | Bacteria | 5281 |
| 395 | Ga0495613_0028743 | 3300046689 | Bacteria | 4135 |
| 396 | Ga0495670_0107444 | 3300046691 | Bacteria | 1442 |
| 397 | Ga0495671_0010375 | 3300046692 | Bacteria | 5163 |
| 398 | Ga0495649_0169001 | 3300046694 | Unclassified | 1145 |
| 399 | Ga0495600_0039370 | 3300046809 | Bacteria | 3078 |
| 400 | Ga0495600_0104254 | 3300046809 | Bacteria | 1848 |
| 401 | Ga0495581_0017169 | 3300047315 | Bacteria | 4206 |
| 402 | Ga0495581_0119044 | 3300047315 | Bacteria | 1536 |
| 403 | Ga0495581_0207345 | 3300047315 | Bacteria | 1146 |
| 404 | Ga0495604_0001927 | 3300047317 | Bacteria | 16802 |
| 405 | Ga0495604_0018550 | 3300047317 | Bacteria | 5574 |
| 406 | Ga0495674_0041784 | 3300047319 | Bacteria | 4093 |
| 407 | Ga0495674_0051365 | 3300047319 | Bacteria | 3635 |
| 408 | Ga0495676_0006705 | 3300047321 | Bacteria | 10605 |
| 409 | Ga0495676_0031236 | 3300047321 | Bacteria | 4507 |
| 410 | Ga0495680_0011776 | 3300047322 | Bacteria | 7726 |
| 411 | Ga0495680_0013422 | 3300047322 | Bacteria | 7148 |
| 412 | Ga0495680_0031036 | 3300047322 | Bacteria | 4353 |
| 413 | Ga0495687_028725 | 3300047443 | Bacteria | 2583 |
| 414 | Ga0495687_047577 | 3300047443 | Bacteria | 1844 |
| 415 | Ga0495675_0008564 | 3300047444 | Bacteria | 6340 |
| 416 | Ga0495675_0079223 | 3300047444 | Bacteria | 2069 |
| 417 | Ga0495675_0104275 | 3300047444 | Bacteria | 1772 |
| 418 | Ga0495685_009411 | 3300047447 | Bacteria | 3262 |
| 419 | Ga0495681_0003038 | 3300047470 | Bacteria | 11792 |
| 420 | Ga0495684_0009851 | 3300047471 | Bacteria | 7375 |
| 421 | Ga0495684_0036590 | 3300047471 | Bacteria | 3762 |
| 422 | Ga0495684_0201420 | 3300047471 | Bacteria | 1467 |
| 423 | Ga0495686_0051873 | 3300047472 | Bacteria | 2573 |
| 424 | Ga0495593_0007930 | 3300047673 | Bacteria | 6187 |
| 425 | Ga0495593_0011852 | 3300047673 | Bacteria | 4999 |
| 426 | Ga0495593_0015508 | 3300047673 | Bacteria | 4315 |
| 427 | Ga0495602_0015865 | 3300048088 | Bacteria | 7588 |
| 428 | Ga0495602_0058210 | 3300048088 | Bacteria | 3385 |
| 429 | Ga0495614_0008334 | 3300048089 | Bacteria | 4612 |
| 430 | Ga0496100_0109768 | 3300048903 | Bacteria | 1914 |
| 431 | Ga0496100_0140925 | 3300048903 | Bacteria | 1709 |
| 432 | Ga0496100_0245086 | 3300048903 | Bacteria | 1324 |
| 433 | Ga0496101_0010635 | 3300048904 | Bacteria | 6080 |
| 434 | Ga0496101_0045780 | 3300048904 | Bacteria | 3135 |
| 435 | Ga0496102_0001164 | 3300048905 | Bacteria | 24021 |
| 436 | Ga0496102_0013298 | 3300048905 | Bacteria | 7128 |
| 437 | Ga0496102_0018536 | 3300048905 | Bacteria | 6117 |
| 438 | Ga0496102_0030678 | 3300048905 | Bacteria | 4812 |
| 439 | Ga0496103_0023376 | 3300048906 | Bacteria | 3727 |
| 440 | Ga0496103_0096014 | 3300048906 | Bacteria | 1873 |
| 441 | Ga0496104_0003780 | 3300048907 | Bacteria | 13096 |
| 442 | Ga0496104_0006354 | 3300048907 | Bacteria | 10393 |
| 443 | Ga0496104_0025893 | 3300048907 | Bacteria | 5410 |
| 444 | Ga0496104_0040093 | 3300048907 | Bacteria | 4388 |
| 445 | Ga0496104_0068623 | 3300048907 | Bacteria | 3369 |
| 446 | Ga0496105_0004557 | 3300048908 | Bacteria | 10435 |
| 447 | Ga0496105_0004641 | 3300048908 | Bacteria | 10357 |
| 448 | Ga0496105_0009355 | 3300048908 | Bacteria | 7660 |
| 449 | Ga0496105_0009672 | 3300048908 | Bacteria | 7546 |
| 450 | Ga0496105_0010073 | 3300048908 | Bacteria | 7419 |
| 451 | Ga0496105_0379064 | 3300048908 | Bacteria | 1126 |
| 452 | Ga0496106_0003460 | 3300048909 | Bacteria | 11762 |
| 453 | Ga0496106_0030080 | 3300048909 | Bacteria | 4049 |
| 454 | Ga0496107_0005163 | 3300048910 | Bacteria | 8913 |
| 455 | Ga0496108_0009938 | 3300048911 | Bacteria | 7715 |
| 456 | Ga0496108_0028166 | 3300048911 | Bacteria | 4647 |
| 457 | Ga0496109_0018717 | 3300048912 | Bacteria | 6089 |
| 458 | Ga0496109_0082248 | 3300048912 | Bacteria | 2967 |
| 459 | Ga0496109_0186968 | 3300048912 | Bacteria | 1946 |
| 460 | Ga0496109_0300446 | 3300048912 | Bacteria | 1514 |
| 461 | Ga0496110_0015154 | 3300048913 | Bacteria | 6410 |
| 462 | Ga0496110_0026626 | 3300048913 | Bacteria | 4951 |
| 463 | Ga0496110_0068792 | 3300048913 | Bacteria | 3134 |
| 464 | Ga0496111_0071682 | 3300048914 | Bacteria | 2522 |
| 465 | Ga0496111_0100269 | 3300048914 | Bacteria | 2127 |
| 466 | Ga0496112_0171370 | 3300048915 | Bacteria | 2135 |
| 467 | Ga0496112_0410236 | 3300048915 | Bacteria | 1294 |
| 468 | Ga0496113_0064126 | 3300048916 | Bacteria | 2777 |
| 469 | Ga0496113_0080568 | 3300048916 | Bacteria | 2494 |
| 470 | Ga0496114_0001749 | 3300048917 | Bacteria | 16473 |
| 471 | Ga0496114_0016437 | 3300048917 | Bacteria | 5964 |
| 472 | Ga0496114_0019655 | 3300048917 | Bacteria | 5474 |
| 473 | Ga0496114_0118339 | 3300048917 | Bacteria | 2276 |
| 474 | Ga0496114_0174745 | 3300048917 | Unclassified | 1874 |
| 475 | Ga0496114_0382612 | 3300048917 | Bacteria | 1246 |
| 476 | Ga0496115_0001869 | 3300048918 | Bacteria | 15067 |
| 477 | Ga0496115_0084765 | 3300048918 | Bacteria | 2584 |
| 478 | Ga0496115_0247680 | 3300048918 | Bacteria | 1468 |
| 479 | Ga0496117_0000048 | 3300048920 | Bacteria | 295908 |
| 480 | Ga0496117_0021466 | 3300048920 | Bacteria | 5221 |
| 481 | Ga0496118_0001393 | 3300048921 | Bacteria | 36444 |
| 482 | Ga0496119_0075350 | 3300048922 | Bacteria | 1961 |
| 483 | Ga0496120_0077076 | 3300048923 | Bacteria | 1815 |
| 484 | Ga0496122_0000978 | 3300048925 | Bacteria | 51309 |
| 485 | Ga0496123_0000304 | 3300048926 | Bacteria | 95535 |
| 486 | Ga0496123_0110174 | 3300048926 | Bacteria | 1576 |
| 487 | Ga0496124_0000040 | 3300048927 | Bacteria | 307061 |
| 488 | Ga0496124_0001775 | 3300048927 | Bacteria | 30001 |
| 489 | Ga0496124_0008784 | 3300048927 | Bacteria | 10494 |
| 490 | Ga0496124_0158177 | 3300048927 | Bacteria | 1769 |
| 491 | Ga0496125_0201723 | 3300048928 | Bacteria | 1301 |
| 492 | Ga0496126_0013732 | 3300048929 | Bacteria | 8214 |
| 493 | Ga0501031_0003529 | 3300049568 | Bacteria | 10038 |
| 494 | Ga0501031_0115679 | 3300049568 | Bacteria | 1752 |
| 495 | Ga0501032_0006366 | 3300049569 | Bacteria | 8702 |
| 496 | Ga0501033_0000714 | 3300049570 | Bacteria | 30480 |
| 497 | Ga0501034_0006870 | 3300049571 | Bacteria | 12167 |
| 498 | Ga0501036_0005945 | 3300049572 | Bacteria | 9889 |
| 499 | Ga0501037_0004508 | 3300049573 | Bacteria | 10122 |
| 500 | Ga0501038_0000681 | 3300049574 | Bacteria | 30246 |
| 501 | Ga0501039_0013729 | 3300049575 | Bacteria | 6196 |
| 502 | Ga0501043_0005753 | 3300049579 | Bacteria | 9988 |
| 503 | Ga0501046_0006461 | 3300049580 | Bacteria | 10370 |
| 504 | Ga0501047_0000063 | 3300049581 | Bacteria | 136761 |
| 505 | Ga0501047_0150550 | 3300049581 | Bacteria | 2203 |
| 506 | Ga0501047_0167823 | 3300049581 | Bacteria | 2065 |
| 507 | Ga0501048_0000390 | 3300049582 | Bacteria | 30459 |
| 508 | Ga0501069_0017460 | 3300049585 | Bacteria | 3862 |
| 509 | Ga0501070_0001914 | 3300049586 | Bacteria | 18377 |
| 510 | Ga0501073_0015719 | 3300049589 | Bacteria | 5486 |
| 511 | Ga0501079_0010050 | 3300049741 | Bacteria | 7185 |
| 512 | Ga0501083_0004350 | 3300049744 | Bacteria | 9976 |
| 513 | Ga0501035_0000963 | 3300049822 | Bacteria | 30420 |
| 514 | Ga0501044_0009798 | 3300049823 | Bacteria | 10417 |
| 515 | nmdc:mga03683_10910_c1 | 3300050489 | Bacteria | 3270 |
| 516 | nmdc:mga00v17_33297_c2 | 3300050491 | Bacteria | 2221 |
| 517 | nmdc:mga0yw44_103141_c1 | 3300050492 | Bacteria | 1819 |
| 518 | nmdc:mga0yw44_157562_c1 | 3300050492 | Bacteria | 1485 |
| 519 | nmdc:mga0yw44_23683_c1 | 3300050492 | Bacteria | 3463 |
| 520 | nmdc:mga06z11_3390_c1 | 3300050494 | Bacteria | 6162 |
| 521 | nmdc:mga04h51_97873_c1 | 3300050495 | Bacteria | 1065 |
| 522 | nmdc:mga07m45_111166_c1 | 3300050496 | Bacteria | 1578 |
| 523 | nmdc:mga07m45_3811_c1 | 3300050496 | Bacteria | 7296 |
| 524 | nmdc:mga09592_131420_c1 | 3300050508 | Bacteria | 2154 |
| 525 | nmdc:mga0qj67_8720_c1 | 3300050509 | Bacteria | 7531 |
| 526 | nmdc:mga06r32_1258_c1 | 3300050510 | Bacteria | 22755 |
| 527 | nmdc:mga08y16_22589_c1 | 3300050511 | Bacteria | 6642 |
| 528 | nmdc:mga08y16_4_c1 | 3300050511 | Bacteria | 916963 |
| 529 | nmdc:mga0n895_52304_c1 | 3300050512 | Bacteria | 4009 |
| 530 | Ga0495601_0102646 | 3300053077 | Bacteria | 1848 |
| 531 | Ga0495595_0003631 | 3300053084 | Bacteria | 6132 |
| 532 | Ga0495595_0120426 | 3300053084 | Bacteria | 1278 |
| 533 | Ga0495619_0029192 | 3300053085 | Bacteria | 3562 |
| 534 | Ga0495619_0259782 | 3300053085 | Bacteria | 1204 |
| 535 | Ga0500643_000297 | 3300053087 | Bacteria | 41873 |
| 536 | Ga0500643_006632 | 3300053087 | Bacteria | 4809 |
| 537 | Ga0500644_0000803 | 3300053088 | Bacteria | 10659 |
| 538 | Ga0500644_0003115 | 3300053088 | Bacteria | 4105 |
| 539 | Ga0500556_0000008 | 3300053104 | Bacteria | 304943 |
| 540 | Ga0500556_0016034 | 3300053104 | Bacteria | 2324 |
| 541 | Ga0500560_005526 | 3300053107 | Bacteria | 2807 |
| 542 | Ga0500560_057400 | 3300053107 | Bacteria | 1262 |
| 543 | Ga0500608_024034 | 3300053122 | Bacteria | 2842 |
| 544 | Ga0500658_0020324 | 3300053134 | Bacteria | 2506 |
| 545 | Ga0500559_0000577 | 3300053136 | Bacteria | 25137 |
| 546 | Ga0500559_0000811 | 3300053136 | Bacteria | 20360 |
| 547 | Ga0500559_0034668 | 3300053136 | Bacteria | 2177 |
| 548 | Ga0500568_0000003 | 3300053139 | Bacteria | 863587 |
| 549 | Ga0500573_0000014 | 3300053140 | Bacteria | 193353 |
| 550 | Ga0500573_0000043 | 3300053140 | Bacteria | 101932 |
| 551 | Ga0500573_0001248 | 3300053140 | Bacteria | 11994 |
| 552 | Ga0500573_0003828 | 3300053140 | Bacteria | 7845 |
| 553 | Ga0500573_0010149 | 3300053140 | Bacteria | 5248 |
| 554 | Ga0500573_0066731 | 3300053140 | Bacteria | 2057 |
| 555 | Ga0500573_0075799 | 3300053140 | Bacteria | 1914 |
| 556 | Ga0500577_0005536 | 3300053142 | Bacteria | 3413 |
| 557 | Ga0500577_0005586 | 3300053142 | Bacteria | 3403 |
| 558 | Ga0500577_0022950 | 3300053142 | Bacteria | 2078 |
| 559 | Ga0500616_0000079 | 3300053153 | Bacteria | 200717 |
| 560 | Ga0500616_0002030 | 3300053153 | Bacteria | 17854 |
| 561 | Ga0500622_0000037 | 3300053156 | Bacteria | 179427 |
| 562 | Ga0500624_001146 | 3300053157 | Bacteria | 4855 |
| 563 | Ga0500636_0002710 | 3300053177 | Bacteria | 9848 |
| 564 | Ga0500611_001596 | 3300053727 | Bacteria | 2538 |
| 565 | Ga0500645_012648 | 3300053730 | Bacteria | 2725 |
| 566 | Ga0501082_0009145 | 3300060353 | Bacteria | 8543 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005437 | Ga0070710_10070421 | Ga0070710_100704212 | 263 |
| 2 | 3300050495 | nmdc:mga04h51_97873_c1 | nmdc:mga04h51_97873_c1_94_975 | 278 |
| 3 | 3300050496 | nmdc:mga07m45_111166_c1 | nmdc:mga07m45_111166_c1_38_919 | 278 |
| 4 | 3300035170 | Ga0373943_0073750 | Ga0373943_0073750_123_992 | 279 |
| 5 | 3300003187 | JGI25151J46595_10000769 | JGI25151J46595_100007698 | 287 |
| 6 | 3300006353 | Ga0075370_10010023 | Ga0075370_100100233 | 287 |
| 7 | 3300025258 | Ga0209129_1005596 | Ga0209129_10055963 | 287 |
| 8 | 3300025294 | Ga0209025_1000238 | Ga0209025_100023868 | 287 |
| 9 | 3300009098 | Ga0105245_10115652 | Ga0105245_101156522 | 288 |
| 10 | 3300037068 | Ga0373925_0001664 | Ga0373925_0001664_5193_6068 | 290 |
| 11 | 3300041452 | Ga0451793_1839129 | Ga0451793_1839129_178_1059 | 292 |
| 12 | 3300046559 | Ga0495667_0154919 | Ga0495667_0154919_454_1335 | 292 |
| 13 | 3300048908 | Ga0496105_0379064 | Ga0496105_0379064_19_900 | 292 |
| 14 | 3300048912 | Ga0496109_0300446 | Ga0496109_0300446_32_913 | 292 |
| 15 | 3300048913 | Ga0496110_0068792 | Ga0496110_0068792_2180_3061 | 292 |
| 16 | 3300050496 | nmdc:mga07m45_3811_c1 | nmdc:mga07m45_3811_c1_6193_7218 | 294 |
| 17 | 3300041512 | Ga0451853_0677297 | Ga0451853_0677297_643_1536 | 296 |
| 18 | 3300048905 | Ga0496102_0030678 | Ga0496102_0030678_3684_4652 | 296 |
| 19 | 3300048916 | Ga0496113_0064126 | Ga0496113_0064126_891_1859 | 296 |
| 20 | 3300025911 | Ga0207654_10018963 | Ga0207654_100189632 | 298 |
| 21 | 3300031616 | Ga0307508_10001814 | Ga0307508_100018144 | 299 |
| 22 | 3300031649 | Ga0307514_10033652 | Ga0307514_100336524 | 299 |
| 23 | 3300028786 | Ga0307517_10062147 | Ga0307517_100621474 | 300 |
| 24 | 3300050492 | nmdc:mga0yw44_103141_c1 | nmdc:mga0yw44_103141_c1_87_1070 | 301 |
| 25 | 3300037466 | Ga0395898_0046801 | Ga0395898_0046801_1385_2293 | 302 |
| 26 | 3300053084 | Ga0495595_0120426 | Ga0495595_0120426_279_1190 | 302 |
| 27 | 3300048927 | Ga0496124_0008784 | Ga0496124_0008784_6638_7621 | 303 |
| 28 | 3300049568 | Ga0501031_0115679 | Ga0501031_0115679_51_1022 | 303 |
| 29 | 3300006178 | Ga0075367_10012007 | Ga0075367_100120073 | 304 |
| 30 | 3300046515 | Ga0495620_0010421 | Ga0495620_0010421_2108_3025 | 304 |
| 31 | 3300050494 | nmdc:mga06z11_3390_c1 | nmdc:mga06z11_3390_c1_992_1975 | 304 |
| 32 | 3300046557 | Ga0495622_0051713 | Ga0495622_0051713_405_1412 | 305 |
| 33 | 3300005467 | Ga0070706_100003816 | Ga0070706_1000038165 | 306 |
| 34 | 3300006038 | Ga0075365_10036575 | Ga0075365_100365754 | 306 |
| 35 | 3300046491 | Ga0495584_0210294 | Ga0495584_0210294_44_967 | 306 |
| 36 | 3300050492 | nmdc:mga0yw44_23683_c1 | nmdc:mga0yw44_23683_c1_1219_2196 | 306 |
| 37 | 3300005329 | Ga0070683_100248091 | Ga0070683_1002480911 | 307 |
| 38 | 3300042012 | Ga0439455_0007474 | Ga0439455_0007474_383_1399 | 307 |
| 39 | 3300042138 | Ga0450903_002650 | Ga0450903_002650_759_1775 | 307 |
| 40 | 3300005327 | Ga0070658_10089133 | Ga0070658_100891334 | 309 |
| 41 | 3300005328 | Ga0070676_10077517 | Ga0070676_100775173 | 309 |
| 42 | 3300005331 | Ga0070670_100051560 | Ga0070670_1000515603 | 309 |
| 43 | 3300005334 | Ga0068869_100009466 | Ga0068869_1000094664 | 309 |
| 44 | 3300005336 | Ga0070680_100021304 | Ga0070680_1000213045 | 309 |
| 45 | 3300005339 | Ga0070660_100042237 | Ga0070660_1000422374 | 309 |
| 46 | 3300005340 | Ga0070689_100044844 | Ga0070689_1000448442 | 309 |
| 47 | 3300005341 | Ga0070691_10036013 | Ga0070691_100360131 | 309 |
| 48 | 3300005344 | Ga0070661_100042434 | Ga0070661_1000424343 | 309 |
| 49 | 3300005345 | Ga0070692_10012861 | Ga0070692_100128611 | 309 |
| 50 | 3300005354 | Ga0070675_100013573 | Ga0070675_1000135734 | 309 |
| 51 | 3300005434 | Ga0070709_10134016 | Ga0070709_101340161 | 309 |
| 52 | 3300005435 | Ga0070714_100221932 | Ga0070714_1002219322 | 309 |
| 53 | 3300005436 | Ga0070713_100303915 | Ga0070713_1003039151 | 309 |
| 54 | 3300005455 | Ga0070663_100005950 | Ga0070663_1000059505 | 309 |
| 55 | 3300005456 | Ga0070678_100011405 | Ga0070678_1000114055 | 309 |
| 56 | 3300005458 | Ga0070681_10022171 | Ga0070681_100221715 | 309 |
| 57 | 3300005530 | Ga0070679_100093227 | Ga0070679_1000932274 | 309 |
| 58 | 3300005543 | Ga0070672_100148946 | Ga0070672_1001489463 | 309 |
| 59 | 3300005547 | Ga0070693_100002076 | Ga0070693_1000020765 | 309 |
| 60 | 3300005548 | Ga0070665_100085505 | Ga0070665_1000855053 | 309 |
| 61 | 3300005563 | Ga0068855_100269422 | Ga0068855_1002694222 | 309 |
| 62 | 3300005577 | Ga0068857_100169096 | Ga0068857_1001690963 | 309 |
| 63 | 3300005578 | Ga0068854_100021103 | Ga0068854_1000211036 | 309 |
| 64 | 3300005615 | Ga0070702_100033876 | Ga0070702_1000338764 | 309 |
| 65 | 3300005616 | Ga0068852_100018355 | Ga0068852_1000183557 | 309 |
| 66 | 3300005617 | Ga0068859_100058411 | Ga0068859_1000584115 | 309 |
| 67 | 3300005618 | Ga0068864_100060920 | Ga0068864_1000609204 | 309 |
| 68 | 3300005840 | Ga0068870_10012123 | Ga0068870_100121234 | 309 |
| 69 | 3300005841 | Ga0068863_100091661 | Ga0068863_1000916614 | 309 |
| 70 | 3300005842 | Ga0068858_100017388 | Ga0068858_1000173883 | 309 |
| 71 | 3300005843 | Ga0068860_100272859 | Ga0068860_1002728592 | 309 |
| 72 | 3300006358 | Ga0068871_100287482 | Ga0068871_1002874821 | 309 |
| 73 | 3300006914 | Ga0075436_100089276 | Ga0075436_1000892764 | 309 |
| 74 | 3300006931 | Ga0097620_100058410 | Ga0097620_1000584101 | 309 |
| 75 | 3300009098 | Ga0105245_10048790 | Ga0105245_100487902 | 309 |
| 76 | 3300009177 | Ga0105248_10031176 | Ga0105248_100311764 | 309 |
| 77 | 3300009545 | Ga0105237_10019291 | Ga0105237_100192915 | 309 |
| 78 | 3300009545 | Ga0105237_10248185 | Ga0105237_102481852 | 309 |
| 79 | 3300009551 | Ga0105238_10059219 | Ga0105238_100592191 | 309 |
| 80 | 3300010375 | Ga0105239_10127048 | Ga0105239_101270484 | 309 |
| 81 | 3300011119 | Ga0105246_10005389 | Ga0105246_100053891 | 309 |
| 82 | 3300013100 | Ga0157373_10024658 | Ga0157373_100246582 | 309 |
| 83 | 3300013102 | Ga0157371_10034782 | Ga0157371_100347822 | 309 |
| 84 | 3300013104 | Ga0157370_10039800 | Ga0157370_100398004 | 309 |
| 85 | 3300013105 | Ga0157369_10102172 | Ga0157369_101021722 | 309 |
| 86 | 3300013296 | Ga0157374_10060763 | Ga0157374_100607633 | 309 |
| 87 | 3300013306 | Ga0163162_10205612 | Ga0163162_102056122 | 309 |
| 88 | 3300013307 | Ga0157372_10094799 | Ga0157372_100947994 | 309 |
| 89 | 3300014325 | Ga0163163_10224422 | Ga0163163_102244222 | 309 |
| 90 | 3300014745 | Ga0157377_10017106 | Ga0157377_100171064 | 309 |
| 91 | 3300014968 | Ga0157379_10121175 | Ga0157379_101211751 | 309 |
| 92 | 3300014968 | Ga0157379_10167057 | Ga0157379_101670572 | 309 |
| 93 | 3300020082 | Ga0206353_10999702 | Ga0206353_109997024 | 309 |
| 94 | 3300025901 | Ga0207688_10004087 | Ga0207688_100040875 | 309 |
| 95 | 3300025908 | Ga0207643_10000320 | Ga0207643_1000032030 | 309 |
| 96 | 3300025909 | Ga0207705_10171379 | Ga0207705_101713792 | 309 |
| 97 | 3300025912 | Ga0207707_10132784 | Ga0207707_101327841 | 309 |
| 98 | 3300025913 | Ga0207695_10371672 | Ga0207695_103716722 | 309 |
| 99 | 3300025914 | Ga0207671_10206507 | Ga0207671_102065071 | 309 |
| 100 | 3300025919 | Ga0207657_10212793 | Ga0207657_102127931 | 309 |
| 101 | 3300025920 | Ga0207649_10049456 | Ga0207649_100494563 | 309 |
| 102 | 3300025925 | Ga0207650_10030103 | Ga0207650_100301034 | 309 |
| 103 | 3300025927 | Ga0207687_10020072 | Ga0207687_100200722 | 309 |
| 104 | 3300025928 | Ga0207700_10121435 | Ga0207700_101214352 | 309 |
| 105 | 3300025933 | Ga0207706_10272702 | Ga0207706_102727021 | 309 |
| 106 | 3300025940 | Ga0207691_10115416 | Ga0207691_101154164 | 309 |
| 107 | 3300025942 | Ga0207689_10018038 | Ga0207689_100180388 | 309 |
| 108 | 3300025944 | Ga0207661_10009547 | Ga0207661_100095476 | 309 |
| 109 | 3300025945 | Ga0207679_10006069 | Ga0207679_100060696 | 309 |
| 110 | 3300025981 | Ga0207640_10134746 | Ga0207640_101347461 | 309 |
| 111 | 3300026023 | Ga0207677_10004031 | Ga0207677_100040318 | 309 |
| 112 | 3300026035 | Ga0207703_10016168 | Ga0207703_100161685 | 309 |
| 113 | 3300026041 | Ga0207639_10319921 | Ga0207639_103199211 | 309 |
| 114 | 3300026067 | Ga0207678_10000094 | Ga0207678_1000009451 | 309 |
| 115 | 3300026075 | Ga0207708_10072017 | Ga0207708_100720174 | 309 |
| 116 | 3300026078 | Ga0207702_10013617 | Ga0207702_100136175 | 309 |
| 117 | 3300026088 | Ga0207641_10128323 | Ga0207641_101283231 | 309 |
| 118 | 3300026095 | Ga0207676_10039831 | Ga0207676_100398313 | 309 |
| 119 | 3300026116 | Ga0207674_10166648 | Ga0207674_101666482 | 309 |
| 120 | 3300026121 | Ga0207683_10040447 | Ga0207683_100404471 | 309 |
| 121 | 3300026142 | Ga0207698_10250505 | Ga0207698_102505052 | 309 |
| 122 | 3300027907 | Ga0207428_10044090 | Ga0207428_100440904 | 309 |
| 123 | 3300028379 | Ga0268266_10446837 | Ga0268266_104468371 | 309 |
| 124 | 3300028381 | Ga0268264_10174958 | Ga0268264_101749582 | 309 |
| 125 | 3300041491 | Ga0451833_0871186 | Ga0451833_0871186_70_1059 | 309 |
| 126 | 3300048906 | Ga0496103_0023376 | Ga0496103_0023376_2161_3162 | 309 |
| 127 | 3300048907 | Ga0496104_0025893 | Ga0496104_0025893_1568_2569 | 309 |
| 128 | 3300048908 | Ga0496105_0009355 | Ga0496105_0009355_3889_4890 | 309 |
| 129 | 3300048909 | Ga0496106_0030080 | Ga0496106_0030080_288_1289 | 309 |
| 130 | 3300048912 | Ga0496109_0018717 | Ga0496109_0018717_411_1412 | 309 |
| 131 | 3300048915 | Ga0496112_0171370 | Ga0496112_0171370_161_1162 | 309 |
| 132 | 3300048918 | Ga0496115_0084765 | Ga0496115_0084765_137_1138 | 309 |
| 133 | 3300050511 | nmdc:mga08y16_22589_c1 | nmdc:mga08y16_22589_c1_4201_5202 | 309 |
| 134 | 3300050512 | nmdc:mga0n895_52304_c1 | nmdc:mga0n895_52304_c1_1322_2323 | 309 |
| 135 | 3300025913 | Ga0207695_10333529 | Ga0207695_103335291 | 310 |
| 136 | 3300026118 | Ga0207675_100472221 | Ga0207675_1004722211 | 310 |
| 137 | 3300031889 | Ga0326468_10001733 | Ga0326468_100017332 | 312 |
| 138 | 3300053730 | Ga0500645_012648 | Ga0500645_012648_398_1402 | 312 |
| 139 | iso_pu_bacteria | 2558860280 | 2559423251 | 312 |
| 140 | 3300005355 | Ga0070671_100001046 | Ga0070671_1000010465 | 313 |
| 141 | 3300025931 | Ga0207644_10000937 | Ga0207644_1000093713 | 313 |
| 142 | 3300031730 | Ga0307516_10015060 | Ga0307516_100150602 | 313 |
| 143 | 3300047443 | Ga0495687_028725 | Ga0495687_028725_551_1561 | 313 |
| 144 | 3300005435 | Ga0070714_100019448 | Ga0070714_1000194489 | 314 |
| 145 | 3300005437 | Ga0070710_10021580 | Ga0070710_100215802 | 314 |
| 146 | 3300025898 | Ga0207692_10007199 | Ga0207692_100071995 | 314 |
| 147 | 3300025905 | Ga0207685_10013593 | Ga0207685_100135932 | 314 |
| 148 | 3300025929 | Ga0207664_10015710 | Ga0207664_100157102 | 314 |
| 149 | 3300025939 | Ga0207665_10050991 | Ga0207665_100509913 | 314 |
| 150 | 3300036401 | Ga0373937_0449116 | Ga0373937_0449116_250_1197 | 314 |
| 151 | 3300046683 | Ga0495658_0222782 | Ga0495658_0222782_21_1022 | 314 |
| 152 | iso_pu_bacteria | 8003314358 | 8003319993 | 314 |
| 153 | 3300030521 | Ga0307511_10000290 | Ga0307511_1000029038 | 315 |
| 154 | 3300005455 | Ga0070663_100009489 | Ga0070663_1000094895 | 316 |
| 155 | 3300053142 | Ga0500577_0005536 | Ga0500577_0005536_1220_2191 | 316 |
| 156 | 3300013308 | Ga0157375_10164341 | Ga0157375_101643412 | 317 |
| 157 | 3300025934 | Ga0207686_10213512 | Ga0207686_102135122 | 317 |
| 158 | 3300031616 | Ga0307508_10102062 | Ga0307508_101020622 | 317 |
| 159 | 3300031852 | Ga0307410_10008780 | Ga0307410_100087803 | 317 |
| 160 | 3300031901 | Ga0307406_10095206 | Ga0307406_100952063 | 317 |
| 161 | 3300031995 | Ga0307409_100003063 | Ga0307409_1000030633 | 317 |
| 162 | 3300032002 | Ga0307416_100079778 | Ga0307416_1000797784 | 317 |
| 163 | 3300037466 | Ga0395898_0293107 | Ga0395898_0293107_411_1388 | 317 |
| 164 | 3300048903 | Ga0496100_0140925 | Ga0496100_0140925_683_1660 | 317 |
| 165 | 3300048905 | Ga0496102_0001164 | Ga0496102_0001164_6021_6998 | 317 |
| 166 | 3300048907 | Ga0496104_0040093 | Ga0496104_0040093_853_1830 | 317 |
| 167 | 3300048908 | Ga0496105_0004557 | Ga0496105_0004557_4561_5538 | 317 |
| 168 | 3300048911 | Ga0496108_0028166 | Ga0496108_0028166_1111_2088 | 317 |
| 169 | 3300048917 | Ga0496114_0019655 | Ga0496114_0019655_1100_2077 | 317 |
| 170 | 3300049581 | Ga0501047_0167823 | Ga0501047_0167823_509_1474 | 317 |
| 171 | 3300053142 | Ga0500577_0005586 | Ga0500577_0005586_1352_2323 | 317 |
| 172 | 3300053727 | Ga0500611_001596 | Ga0500611_001596_1264_2226 | 317 |
| 173 | iso_pu_bacteria | 2643221694 | 2644524208 | 317 |
| 174 | iso_pu_bacteria | 2643221722 | 2644668306 | 317 |
| 175 | 3300046674 | Ga0495588_0000623 | Ga0495588_0000623_3241_4206 | 318 |
| 176 | 3300053157 | Ga0500624_001146 | Ga0500624_001146_386_1351 | 318 |
| 177 | iso_pu_bacteria | 2582581280 | 2585154929 | 318 |
| 178 | 3300046694 | Ga0495649_0169001 | Ga0495649_0169001_115_1089 | 319 |
| 179 | 3300049568 | Ga0501031_0003529 | Ga0501031_0003529_4651_5628 | 319 |
| 180 | 3300049569 | Ga0501032_0006366 | Ga0501032_0006366_3195_4172 | 319 |
| 181 | 3300049570 | Ga0501033_0000714 | Ga0501033_0000714_4560_5537 | 319 |
| 182 | 3300049571 | Ga0501034_0006870 | Ga0501034_0006870_8559_9536 | 319 |
| 183 | 3300049572 | Ga0501036_0005945 | Ga0501036_0005945_4587_5564 | 319 |
| 184 | 3300049573 | Ga0501037_0004508 | Ga0501037_0004508_4589_5566 | 319 |
| 185 | 3300049574 | Ga0501038_0000681 | Ga0501038_0000681_4408_5385 | 319 |
| 186 | 3300049575 | Ga0501039_0013729 | Ga0501039_0013729_4548_5525 | 319 |
| 187 | 3300049579 | Ga0501043_0005753 | Ga0501043_0005753_4429_5406 | 319 |
| 188 | 3300049580 | Ga0501046_0006461 | Ga0501046_0006461_4394_5371 | 319 |
| 189 | 3300049581 | Ga0501047_0000063 | Ga0501047_0000063_24891_25868 | 319 |
| 190 | 3300049582 | Ga0501048_0000390 | Ga0501048_0000390_4355_5332 | 319 |
| 191 | 3300049585 | Ga0501069_0017460 | Ga0501069_0017460_2605_3582 | 319 |
| 192 | 3300049586 | Ga0501070_0001914 | Ga0501070_0001914_4450_5427 | 319 |
| 193 | 3300049589 | Ga0501073_0015719 | Ga0501073_0015719_4368_5345 | 319 |
| 194 | 3300049741 | Ga0501079_0010050 | Ga0501079_0010050_1854_2831 | 319 |
| 195 | 3300049744 | Ga0501083_0004350 | Ga0501083_0004350_4585_5562 | 319 |
| 196 | 3300049822 | Ga0501035_0000963 | Ga0501035_0000963_4551_5528 | 319 |
| 197 | 3300049823 | Ga0501044_0009798 | Ga0501044_0009798_4421_5398 | 319 |
| 198 | 3300053140 | Ga0500573_0001248 | Ga0500573_0001248_1271_2233 | 319 |
| 199 | 3300053140 | Ga0500573_0066731 | Ga0500573_0066731_69_1031 | 319 |
| 200 | 3300060353 | Ga0501082_0009145 | Ga0501082_0009145_4268_5245 | 319 |
| 201 | 3300005467 | Ga0070706_100006313 | Ga0070706_1000063132 | 320 |
| 202 | 3300006846 | Ga0075430_100000153 | Ga0075430_10000015335 | 320 |
| 203 | 3300025910 | Ga0207684_10017279 | Ga0207684_100172792 | 320 |
| 204 | 3300048912 | Ga0496109_0186968 | Ga0496109_0186968_580_1545 | 320 |
| 205 | 3300050509 | nmdc:mga0qj67_8720_c1 | nmdc:mga0qj67_8720_c1_834_1814 | 320 |
| 206 | 3300005544 | Ga0070686_100118353 | Ga0070686_1001183532 | 321 |
| 207 | 3300006186 | Ga0075369_10053157 | Ga0075369_100531572 | 321 |
| 208 | 3300026088 | Ga0207641_10273869 | Ga0207641_102738692 | 321 |
| 209 | 3300031548 | Ga0307408_100238547 | Ga0307408_1002385471 | 321 |
| 210 | 3300031852 | Ga0307410_10007200 | Ga0307410_100072003 | 321 |
| 211 | 3300046455 | Ga0495603_0117531 | Ga0495603_0117531_236_1204 | 321 |
| 212 | 3300046459 | Ga0495629_0178857 | Ga0495629_0178857_232_1200 | 321 |
| 213 | 3300046460 | Ga0495638_0072207 | Ga0495638_0072207_1063_2031 | 321 |
| 214 | 3300046463 | Ga0495653_0043720 | Ga0495653_0043720_1012_1980 | 321 |
| 215 | 3300046473 | Ga0495582_0035575 | Ga0495582_0035575_622_1590 | 321 |
| 216 | 3300046476 | Ga0495662_0019331 | Ga0495662_0019331_1152_2120 | 321 |
| 217 | 3300046477 | Ga0495664_0210241 | Ga0495664_0210241_140_1108 | 321 |
| 218 | 3300046501 | Ga0495607_0162228 | Ga0495607_0162228_111_1079 | 321 |
| 219 | 3300046531 | Ga0495665_0054965 | Ga0495665_0054965_870_1838 | 321 |
| 220 | 3300046535 | Ga0495586_0039866 | Ga0495586_0039866_811_1779 | 321 |
| 221 | 3300046536 | Ga0495587_0055277 | Ga0495587_0055277_108_1076 | 321 |
| 222 | 3300046543 | Ga0495645_0235717 | Ga0495645_0235717_28_996 | 321 |
| 223 | 3300046559 | Ga0495667_0091484 | Ga0495667_0091484_497_1465 | 321 |
| 224 | 3300046616 | Ga0495668_0028362 | Ga0495668_0028362_409_1377 | 321 |
| 225 | 3300046674 | Ga0495588_0047956 | Ga0495588_0047956_765_1733 | 321 |
| 226 | 3300046691 | Ga0495670_0107444 | Ga0495670_0107444_112_1080 | 321 |
| 227 | 3300047444 | Ga0495675_0104275 | Ga0495675_0104275_449_1417 | 321 |
| 228 | 3300048903 | Ga0496100_0245086 | Ga0496100_0245086_156_1124 | 321 |
| 229 | 3300048907 | Ga0496104_0068623 | Ga0496104_0068623_2158_3126 | 321 |
| 230 | 3300048908 | Ga0496105_0004641 | Ga0496105_0004641_4834_5802 | 321 |
| 231 | 3300048917 | Ga0496114_0001749 | Ga0496114_0001749_8025_8993 | 321 |
| 232 | 3300048927 | Ga0496124_0001775 | Ga0496124_0001775_9075_10049 | 321 |
| 233 | 3300048928 | Ga0496125_0201723 | Ga0496125_0201723_76_1044 | 321 |
| 234 | 3300053087 | Ga0500643_000297 | Ga0500643_000297_2186_3154 | 321 |
| 235 | 3300053087 | Ga0500643_006632 | Ga0500643_006632_3287_4255 | 321 |
| 236 | 3300053088 | Ga0500644_0000803 | Ga0500644_0000803_2708_3676 | 321 |
| 237 | 3300053104 | Ga0500556_0016034 | Ga0500556_0016034_458_1426 | 321 |
| 238 | 3300053122 | Ga0500608_024034 | Ga0500608_024034_1411_2379 | 321 |
| 239 | 3300053140 | Ga0500573_0000014 | Ga0500573_0000014_116918_117886 | 321 |
| 240 | 3300053156 | Ga0500622_0000037 | Ga0500622_0000037_75162_76130 | 321 |
| 241 | iso_pu_bacteria | 2565956761 | 2566994103 | 321 |
| 242 | iso_pu_bacteria | 2585428157 | 2588107095 | 321 |
| 243 | iso_pu_bacteria | 2643221961 | 2645720467 | 321 |
| 244 | iso_pu_bacteria | 2643221962 | 2645723393 | 321 |
| 245 | iso_pu_bacteria | 2904535858 | 2904539871 | 321 |
| 246 | iso_pu_bacteria | 2922554459 | 2922560441 | 321 |
| 247 | 3300035692 | Ga0373935_0045207 | Ga0373935_0045207_529_1527 | 322 |
| 248 | 3300035695 | Ga0373927_0147362 | Ga0373927_0147362_33_1031 | 322 |
| 249 | 3300037068 | Ga0373925_0079338 | Ga0373925_0079338_968_1966 | 322 |
| 250 | 3300046457 | Ga0495590_0001720 | Ga0495590_0001720_2652_3623 | 322 |
| 251 | 3300046472 | Ga0495580_0155318 | Ga0495580_0155318_156_1154 | 322 |
| 252 | 3300053140 | Ga0500573_0000043 | Ga0500573_0000043_24229_25200 | 322 |
| 253 | 3300053140 | Ga0500573_0010149 | Ga0500573_0010149_3860_4831 | 322 |
| 254 | 3300053140 | Ga0500573_0075799 | Ga0500573_0075799_431_1402 | 322 |
| 255 | iso_pu_bacteria | 2738541272 | 2738695549 | 322 |
| 256 | iso_pu_bacteria | 2738543027 | 2739326307 | 322 |
| 257 | iso_pu_bacteria | 2811994880 | 2812363358 | 322 |
| 258 | iso_pu_bacteria | 2939657138 | 2939660787 | 322 |
| 259 | iso_pu_bacteria | 2946041624 | 2946042016 | 322 |
| 260 | 3300005445 | Ga0070708_100179380 | Ga0070708_1001793802 | 323 |
| 261 | 3300005840 | Ga0068870_10015112 | Ga0068870_100151121 | 323 |
| 262 | 3300006847 | Ga0075431_100003539 | Ga0075431_1000035399 | 323 |
| 263 | 3300009094 | Ga0111539_10000053 | Ga0111539_1000005320 | 323 |
| 264 | 3300027907 | Ga0207428_10000061 | Ga0207428_1000006141 | 323 |
| 265 | 3300028794 | Ga0307515_10000506 | Ga0307515_1000050619 | 323 |
| 266 | 3300031824 | Ga0307413_10291866 | Ga0307413_102918661 | 323 |
| 267 | 3300037853 | Ga0436364_0439304 | Ga0436364_0439304_2316_3290 | 323 |
| 268 | 3300039447 | Ga0436361_0931125 | Ga0436361_0931125_2413_3387 | 323 |
| 269 | 3300044765 | Ga0466970_0020206 | Ga0466970_0020206_1244_2236 | 323 |
| 270 | 3300050508 | nmdc:mga09592_131420_c1 | nmdc:mga09592_131420_c1_197_1177 | 323 |
| 271 | 3300050510 | nmdc:mga06r32_1258_c1 | nmdc:mga06r32_1258_c1_20772_21752 | 323 |
| 272 | 3300050511 | nmdc:mga08y16_4_c1 | nmdc:mga08y16_4_c1_20927_21904 | 323 |
| 273 | 3300053136 | Ga0500559_0034668 | Ga0500559_0034668_52_1026 | 323 |
| 274 | 3300053142 | Ga0500577_0022950 | Ga0500577_0022950_193_1167 | 323 |
| 275 | iso_pu_bacteria | 2731639228 | 2731908802 | 323 |
| 276 | iso_pu_bacteria | 2919042368 | 2919042565 | 323 |
| 277 | iso_pu_bacteria | 2928104781 | 2928104881 | 323 |
| 278 | iso_pu_bacteria | 2984551494 | 2984555155 | 323 |
| 279 | 3300006038 | Ga0075365_10037810 | Ga0075365_100378105 | 324 |
| 280 | 3300006880 | Ga0075429_100080704 | Ga0075429_1000807041 | 324 |
| 281 | 3300009094 | Ga0111539_10027595 | Ga0111539_100275954 | 324 |
| 282 | 3300026095 | Ga0207676_10452349 | Ga0207676_104523491 | 324 |
| 283 | 3300048903 | Ga0496100_0109768 | Ga0496100_0109768_641_1621 | 324 |
| 284 | 3300048904 | Ga0496101_0045780 | Ga0496101_0045780_1129_2109 | 324 |
| 285 | 3300048905 | Ga0496102_0013298 | Ga0496102_0013298_4539_5519 | 324 |
| 286 | 3300048909 | Ga0496106_0003460 | Ga0496106_0003460_202_1182 | 324 |
| 287 | 3300048910 | Ga0496107_0005163 | Ga0496107_0005163_4641_5621 | 324 |
| 288 | 3300048917 | Ga0496114_0118339 | Ga0496114_0118339_234_1214 | 324 |
| 289 | 3300048918 | Ga0496115_0001869 | Ga0496115_0001869_5871_6851 | 324 |
| 290 | 3300048920 | Ga0496117_0000048 | Ga0496117_0000048_24375_25370 | 324 |
| 291 | 3300048925 | Ga0496122_0000978 | Ga0496122_0000978_36270_37253 | 324 |
| 292 | 3300048926 | Ga0496123_0000304 | Ga0496123_0000304_26524_27507 | 324 |
| 293 | 3300005337 | Ga0070682_100123974 | Ga0070682_1001239742 | 325 |
| 294 | 3300005435 | Ga0070714_100040151 | Ga0070714_1000401512 | 325 |
| 295 | 3300005436 | Ga0070713_100429742 | Ga0070713_1004297421 | 325 |
| 296 | 3300005437 | Ga0070710_10022589 | Ga0070710_100225895 | 325 |
| 297 | 3300005439 | Ga0070711_100043287 | Ga0070711_1000432874 | 325 |
| 298 | 3300005455 | Ga0070663_100135328 | Ga0070663_1001353282 | 325 |
| 299 | 3300005455 | Ga0070663_100255333 | Ga0070663_1002553331 | 325 |
| 300 | 3300005544 | Ga0070686_100244121 | Ga0070686_1002441211 | 325 |
| 301 | 3300005548 | Ga0070665_100080901 | Ga0070665_1000809013 | 325 |
| 302 | 3300005578 | Ga0068854_100036359 | Ga0068854_1000363593 | 325 |
| 303 | 3300005616 | Ga0068852_100011084 | Ga0068852_1000110844 | 325 |
| 304 | 3300006038 | Ga0075365_10022559 | Ga0075365_100225594 | 325 |
| 305 | 3300006051 | Ga0075364_10032174 | Ga0075364_100321742 | 325 |
| 306 | 3300006186 | Ga0075369_10003754 | Ga0075369_100037542 | 325 |
| 307 | 3300006353 | Ga0075370_10087778 | Ga0075370_100877782 | 325 |
| 308 | 3300010159 | Ga0099796_10002604 | Ga0099796_100026044 | 325 |
| 309 | 3300020081 | Ga0206354_10846943 | Ga0206354_108469433 | 325 |
| 310 | 3300025904 | Ga0207647_10016829 | Ga0207647_100168292 | 325 |
| 311 | 3300025910 | Ga0207684_10000572 | Ga0207684_1000057240 | 325 |
| 312 | 3300025913 | Ga0207695_10084442 | Ga0207695_100844423 | 325 |
| 313 | 3300025914 | Ga0207671_10004312 | Ga0207671_100043127 | 325 |
| 314 | 3300025915 | Ga0207693_10167531 | Ga0207693_101675311 | 325 |
| 315 | 3300025929 | Ga0207664_10025275 | Ga0207664_100252752 | 325 |
| 316 | 3300026067 | Ga0207678_10075872 | Ga0207678_100758722 | 325 |
| 317 | 3300026142 | Ga0207698_10083755 | Ga0207698_100837551 | 325 |
| 318 | 3300027512 | Ga0209179_1002691 | Ga0209179_10026912 | 325 |
| 319 | 3300028786 | Ga0307517_10007075 | Ga0307517_100070757 | 325 |
| 320 | 3300028800 | Ga0265338_10018231 | Ga0265338_100182315 | 325 |
| 321 | 3300031507 | Ga0307509_10049988 | Ga0307509_100499882 | 325 |
| 322 | 3300031901 | Ga0307406_10012500 | Ga0307406_100125002 | 325 |
| 323 | 3300031901 | Ga0307406_10118269 | Ga0307406_101182692 | 325 |
| 324 | 3300035086 | Ga0373934_0048507 | Ga0373934_0048507_491_1471 | 325 |
| 325 | 3300035113 | Ga0373936_0055295 | Ga0373936_0055295_573_1553 | 325 |
| 326 | 3300035118 | Ga0373954_0044835 | Ga0373954_0044835_479_1459 | 325 |
| 327 | 3300035172 | Ga0373955_0031223 | Ga0373955_0031223_272_1252 | 325 |
| 328 | 3300035724 | Ga0373933_0046743 | Ga0373933_0046743_1354_2334 | 325 |
| 329 | 3300036401 | Ga0373937_0109191 | Ga0373937_0109191_272_1252 | 325 |
| 330 | 3300037418 | Ga0395900_0156704 | Ga0395900_0156704_154_1134 | 325 |
| 331 | 3300038443 | Ga0395901_0094126 | Ga0395901_0094126_383_1363 | 325 |
| 332 | 3300041443 | Ga0451789_0538276 | Ga0451789_0538276_18_998 | 325 |
| 333 | 3300041456 | Ga0451795_1077384 | Ga0451795_1077384_351_1346 | 325 |
| 334 | 3300046455 | Ga0495603_0176268 | Ga0495603_0176268_75_1055 | 325 |
| 335 | 3300046459 | Ga0495629_0076868 | Ga0495629_0076868_56_1036 | 325 |
| 336 | 3300046460 | Ga0495638_0083278 | Ga0495638_0083278_674_1654 | 325 |
| 337 | 3300046462 | Ga0495651_0086491 | Ga0495651_0086491_422_1402 | 325 |
| 338 | 3300046463 | Ga0495653_0052292 | Ga0495653_0052292_400_1380 | 325 |
| 339 | 3300046472 | Ga0495580_0222424 | Ga0495580_0222424_292_1272 | 325 |
| 340 | 3300046473 | Ga0495582_0156392 | Ga0495582_0156392_38_1018 | 325 |
| 341 | 3300046499 | Ga0495594_0049224 | Ga0495594_0049224_628_1608 | 325 |
| 342 | 3300046516 | Ga0495628_0171425 | Ga0495628_0171425_223_1203 | 325 |
| 343 | 3300046517 | Ga0495630_0283345 | Ga0495630_0283345_128_1108 | 325 |
| 344 | 3300046529 | Ga0495652_0186237 | Ga0495652_0186237_64_1044 | 325 |
| 345 | 3300046559 | Ga0495667_0006676 | Ga0495667_0006676_6661_7641 | 325 |
| 346 | 3300046559 | Ga0495667_0236302 | Ga0495667_0236302_23_1003 | 325 |
| 347 | 3300046663 | Ga0495635_0009800 | Ga0495635_0009800_1283_2263 | 325 |
| 348 | 3300046663 | Ga0495635_0053985 | Ga0495635_0053985_290_1270 | 325 |
| 349 | 3300046809 | Ga0495600_0039370 | Ga0495600_0039370_1807_2787 | 325 |
| 350 | 3300046809 | Ga0495600_0104254 | Ga0495600_0104254_149_1129 | 325 |
| 351 | 3300047315 | Ga0495581_0119044 | Ga0495581_0119044_388_1368 | 325 |
| 352 | 3300047315 | Ga0495581_0207345 | Ga0495581_0207345_107_1087 | 325 |
| 353 | 3300047319 | Ga0495674_0051365 | Ga0495674_0051365_1208_2188 | 325 |
| 354 | 3300047322 | Ga0495680_0013422 | Ga0495680_0013422_3846_4826 | 325 |
| 355 | 3300047443 | Ga0495687_047577 | Ga0495687_047577_695_1675 | 325 |
| 356 | 3300047447 | Ga0495685_009411 | Ga0495685_009411_1308_2288 | 325 |
| 357 | 3300047471 | Ga0495684_0009851 | Ga0495684_0009851_788_1768 | 325 |
| 358 | 3300047471 | Ga0495684_0201420 | Ga0495684_0201420_274_1254 | 325 |
| 359 | 3300047673 | Ga0495593_0015508 | Ga0495593_0015508_1609_2589 | 325 |
| 360 | 3300048088 | Ga0495602_0058210 | Ga0495602_0058210_999_1979 | 325 |
| 361 | 3300048904 | Ga0496101_0010635 | Ga0496101_0010635_2068_3048 | 325 |
| 362 | 3300048905 | Ga0496102_0018536 | Ga0496102_0018536_883_1863 | 325 |
| 363 | 3300048906 | Ga0496103_0096014 | Ga0496103_0096014_280_1260 | 325 |
| 364 | 3300048911 | Ga0496108_0009938 | Ga0496108_0009938_1229_2209 | 325 |
| 365 | 3300048912 | Ga0496109_0082248 | Ga0496109_0082248_999_1979 | 325 |
| 366 | 3300048917 | Ga0496114_0174745 | Ga0496114_0174745_751_1731 | 325 |
| 367 | 3300048917 | Ga0496114_0382612 | Ga0496114_0382612_253_1233 | 325 |
| 368 | 3300048918 | Ga0496115_0247680 | Ga0496115_0247680_15_1007 | 325 |
| 369 | 3300048929 | Ga0496126_0013732 | Ga0496126_0013732_6230_7210 | 325 |
| 370 | 3300050491 | nmdc:mga00v17_33297_c2 | nmdc:mga00v17_33297_c2_683_1663 | 325 |
| 371 | 3300050492 | nmdc:mga0yw44_157562_c1 | nmdc:mga0yw44_157562_c1_483_1463 | 325 |
| 372 | iso_pu_bacteria | 2643221576 | 2643891132 | 325 |
| 373 | iso_pu_bacteria | 2643221590 | 2643960188 | 325 |
| 374 | 3300014968 | Ga0157379_10224513 | Ga0157379_102245132 | 326 |
| 375 | 3300031901 | Ga0307406_10000031 | Ga0307406_1000003128 | 326 |
| 376 | 3300037853 | Ga0436364_1360742 | Ga0436364_1360742_70_1071 | 326 |
| 377 | 3300041512 | Ga0451853_0096543 | Ga0451853_0096543_1408_2388 | 326 |
| 378 | 3300046454 | Ga0495592_0155514 | Ga0495592_0155514_561_1541 | 326 |
| 379 | 3300046511 | Ga0495608_0051382 | Ga0495608_0051382_1561_2541 | 326 |
| 380 | 3300046514 | Ga0495618_0122400 | Ga0495618_0122400_504_1484 | 326 |
| 381 | 3300046663 | Ga0495635_0036314 | Ga0495635_0036314_122_1102 | 326 |
| 382 | 3300046679 | Ga0495623_0152428 | Ga0495623_0152428_75_1055 | 326 |
| 383 | 3300046689 | Ga0495613_0017908 | Ga0495613_0017908_1511_2491 | 326 |
| 384 | 3300047322 | Ga0495680_0011776 | Ga0495680_0011776_3796_4776 | 326 |
| 385 | 3300047444 | Ga0495675_0079223 | Ga0495675_0079223_774_1754 | 326 |
| 386 | 3300047472 | Ga0495686_0051873 | Ga0495686_0051873_634_1617 | 326 |
| 387 | 3300053077 | Ga0495601_0102646 | Ga0495601_0102646_481_1461 | 326 |
| 388 | 3300053136 | Ga0500559_0000577 | Ga0500559_0000577_21165_22148 | 326 |
| 389 | 3300053136 | Ga0500559_0000811 | Ga0500559_0000811_18884_19867 | 326 |
| 390 | 3300053140 | Ga0500573_0003828 | Ga0500573_0003828_3988_4971 | 326 |
| 391 | 3300053153 | Ga0500616_0000079 | Ga0500616_0000079_60016_60999 | 326 |
| 392 | 3300053153 | Ga0500616_0002030 | Ga0500616_0002030_14807_15790 | 326 |
| 393 | iso_pu_bacteria | 2551306166 | 2552112291 | 326 |
| 394 | 3300005435 | Ga0070714_100094693 | Ga0070714_1000946933 | 327 |
| 395 | 3300005437 | Ga0070710_10039256 | Ga0070710_100392562 | 327 |
| 396 | 3300005445 | Ga0070708_100143684 | Ga0070708_1001436842 | 327 |
| 397 | 3300005468 | Ga0070707_100047224 | Ga0070707_1000472244 | 327 |
| 398 | 3300013307 | Ga0157372_10665523 | Ga0157372_106655232 | 327 |
| 399 | 3300025898 | Ga0207692_10096169 | Ga0207692_100961691 | 327 |
| 400 | 3300025915 | Ga0207693_10033591 | Ga0207693_100335912 | 327 |
| 401 | 3300025922 | Ga0207646_10018661 | Ga0207646_100186612 | 327 |
| 402 | 3300025928 | Ga0207700_10017397 | Ga0207700_100173972 | 327 |
| 403 | 3300025939 | Ga0207665_10141037 | Ga0207665_101410371 | 327 |
| 404 | 3300048920 | Ga0496117_0021466 | Ga0496117_0021466_3530_4531 | 327 |
| 405 | 3300048921 | Ga0496118_0001393 | Ga0496118_0001393_16102_17103 | 327 |
| 406 | 3300048922 | Ga0496119_0075350 | Ga0496119_0075350_402_1403 | 327 |
| 407 | 3300048923 | Ga0496120_0077076 | Ga0496120_0077076_521_1522 | 327 |
| 408 | 3300048926 | Ga0496123_0110174 | Ga0496123_0110174_511_1512 | 327 |
| 409 | 3300048927 | Ga0496124_0000040 | Ga0496124_0000040_272693_273694 | 327 |
| 410 | 3300048927 | Ga0496124_0158177 | Ga0496124_0158177_68_1069 | 327 |
| 411 | 3300053104 | Ga0500556_0000008 | Ga0500556_0000008_113514_114506 | 327 |
| 412 | 3300053134 | Ga0500658_0020324 | Ga0500658_0020324_872_1897 | 327 |
| 413 | 3300053139 | Ga0500568_0000003 | Ga0500568_0000003_194145_195137 | 327 |
| 414 | 3300046462 | Ga0495651_0000193 | Ga0495651_0000193_33664_34665 | 328 |
| 415 | 3300046529 | Ga0495652_0006723 | Ga0495652_0006723_5413_6414 | 328 |
| 416 | 3300053085 | Ga0495619_0259782 | Ga0495619_0259782_70_1056 | 328 |
| 417 | 3300053177 | Ga0500636_0002710 | Ga0500636_0002710_3060_4133 | 328 |
| 418 | iso_pu_bacteria | 2582581313 | 2585303084 | 328 |
| 419 | iso_pu_bacteria | 2643221647 | 2644266967 | 328 |
| 420 | iso_pu_bacteria | 2786546132 | 2786674157 | 328 |
| 421 | iso_pu_bacteria | 2867428634 | 2867428977 | 328 |
| 422 | iso_pu_bacteria | 2954380949 | 2954381785 | 328 |
| 423 | iso_pu_bacteria | 2954673503 | 2954681254 | 328 |
| 424 | iso_pu_bacteria | 2954682443 | 2954682904 | 328 |
| 425 | iso_pu_bacteria | 2954691527 | 2954692601 | 328 |
| 426 | iso_pu_bacteria | 2954701450 | 2954707674 | 328 |
| 427 | iso_pu_bacteria | 2954711539 | 2954712262 | 328 |
| 428 | iso_pu_bacteria | 2954721474 | 2954722207 | 328 |
| 429 | iso_pu_bacteria | 2954731030 | 2954739642 | 328 |
| 430 | iso_pu_bacteria | 2954740390 | 2954741097 | 328 |
| 431 | iso_pu_bacteria | 2954749733 | 2954758469 | 328 |
| 432 | iso_pu_bacteria | 2954759201 | 2954760108 | 328 |
| 433 | iso_pu_bacteria | 8053945823 | 8053947708 | 328 |
| 434 | iso_pu_bacteria | 8055066027 | 8055067701 | 328 |
| 435 | 3300046473 | Ga0495582_0081614 | Ga0495582_0081614_374_1366 | 329 |
| 436 | 3300048908 | Ga0496105_0009672 | Ga0496105_0009672_3838_4830 | 329 |
| 437 | 3300048913 | Ga0496110_0026626 | Ga0496110_0026626_1193_2185 | 329 |
| 438 | 3300048914 | Ga0496111_0071682 | Ga0496111_0071682_1272_2264 | 329 |
| 439 | 3300048916 | Ga0496113_0080568 | Ga0496113_0080568_359_1351 | 329 |
| 440 | 3300048917 | Ga0496114_0016437 | Ga0496114_0016437_3497_4489 | 329 |
| 441 | 3300050489 | nmdc:mga03683_10910_c1 | nmdc:mga03683_10910_c1_1570_2619 | 329 |
| 442 | 3300005334 | Ga0068869_100376377 | Ga0068869_1003763771 | 331 |
| 443 | 3300005336 | Ga0070680_100039866 | Ga0070680_1000398665 | 331 |
| 444 | 3300005355 | Ga0070671_100018102 | Ga0070671_1000181024 | 331 |
| 445 | 3300005434 | Ga0070709_10114926 | Ga0070709_101149261 | 331 |
| 446 | 3300005435 | Ga0070714_100029866 | Ga0070714_1000298664 | 331 |
| 447 | 3300005435 | Ga0070714_100156243 | Ga0070714_1001562432 | 331 |
| 448 | 3300005435 | Ga0070714_100491348 | Ga0070714_1004913481 | 331 |
| 449 | 3300005436 | Ga0070713_100012145 | Ga0070713_1000121456 | 331 |
| 450 | 3300005437 | Ga0070710_10024425 | Ga0070710_100244252 | 331 |
| 451 | 3300005437 | Ga0070710_10043380 | Ga0070710_100433802 | 331 |
| 452 | 3300005458 | Ga0070681_10040295 | Ga0070681_100402952 | 331 |
| 453 | 3300005548 | Ga0070665_100025406 | Ga0070665_1000254065 | 331 |
| 454 | 3300005548 | Ga0070665_100299521 | Ga0070665_1002995212 | 331 |
| 455 | 3300005563 | Ga0068855_100022930 | Ga0068855_1000229305 | 331 |
| 456 | 3300005577 | Ga0068857_100168394 | Ga0068857_1001683942 | 331 |
| 457 | 3300005614 | Ga0068856_100026135 | Ga0068856_1000261352 | 331 |
| 458 | 3300005614 | Ga0068856_100133767 | Ga0068856_1001337673 | 331 |
| 459 | 3300005614 | Ga0068856_100149698 | Ga0068856_1001496983 | 331 |
| 460 | 3300005614 | Ga0068856_100414784 | Ga0068856_1004147842 | 331 |
| 461 | 3300005616 | Ga0068852_100043303 | Ga0068852_1000433032 | 331 |
| 462 | 3300005617 | Ga0068859_100471998 | Ga0068859_1004719982 | 331 |
| 463 | 3300005844 | Ga0068862_100554305 | Ga0068862_1005543051 | 331 |
| 464 | 3300006931 | Ga0097620_100472003 | Ga0097620_1004720032 | 331 |
| 465 | 3300007265 | Ga0099794_10078094 | Ga0099794_100780941 | 331 |
| 466 | 3300009093 | Ga0105240_10034163 | Ga0105240_100341633 | 331 |
| 467 | 3300009094 | Ga0111539_10035413 | Ga0111539_100354135 | 331 |
| 468 | 3300009174 | Ga0105241_10143173 | Ga0105241_101431731 | 331 |
| 469 | 3300009545 | Ga0105237_10101540 | Ga0105237_101015403 | 331 |
| 470 | 3300009551 | Ga0105238_10021125 | Ga0105238_100211253 | 331 |
| 471 | 3300009551 | Ga0105238_10053988 | Ga0105238_100539884 | 331 |
| 472 | 3300009553 | Ga0105249_10178605 | Ga0105249_101786053 | 331 |
| 473 | 3300013104 | Ga0157370_10050565 | Ga0157370_100505654 | 331 |
| 474 | 3300013296 | Ga0157374_10020541 | Ga0157374_100205414 | 331 |
| 475 | 3300013296 | Ga0157374_10169788 | Ga0157374_101697882 | 331 |
| 476 | 3300013306 | Ga0163162_10408358 | Ga0163162_104083582 | 331 |
| 477 | 3300014968 | Ga0157379_10008747 | Ga0157379_100087479 | 331 |
| 478 | 3300021388 | Ga0213875_10119799 | Ga0213875_101197991 | 331 |
| 479 | 3300025898 | Ga0207692_10020494 | Ga0207692_100204944 | 331 |
| 480 | 3300025898 | Ga0207692_10052261 | Ga0207692_100522612 | 331 |
| 481 | 3300025900 | Ga0207710_10011014 | Ga0207710_100110142 | 331 |
| 482 | 3300025906 | Ga0207699_10047042 | Ga0207699_100470422 | 331 |
| 483 | 3300025910 | Ga0207684_10336492 | Ga0207684_103364921 | 331 |
| 484 | 3300025911 | Ga0207654_10010884 | Ga0207654_100108842 | 331 |
| 485 | 3300025912 | Ga0207707_10003499 | Ga0207707_1000349910 | 331 |
| 486 | 3300025913 | Ga0207695_10007844 | Ga0207695_100078447 | 331 |
| 487 | 3300025914 | Ga0207671_10000128 | Ga0207671_10000128118 | 331 |
| 488 | 3300025915 | Ga0207693_10037038 | Ga0207693_100370384 | 331 |
| 489 | 3300025915 | Ga0207693_10045847 | Ga0207693_100458475 | 331 |
| 490 | 3300025916 | Ga0207663_10027738 | Ga0207663_100277381 | 331 |
| 491 | 3300025916 | Ga0207663_10228053 | Ga0207663_102280531 | 331 |
| 492 | 3300025922 | Ga0207646_10105726 | Ga0207646_101057262 | 331 |
| 493 | 3300025926 | Ga0207659_10237032 | Ga0207659_102370321 | 331 |
| 494 | 3300025928 | Ga0207700_10129643 | Ga0207700_101296432 | 331 |
| 495 | 3300025928 | Ga0207700_10185332 | Ga0207700_101853322 | 331 |
| 496 | 3300025929 | Ga0207664_10030369 | Ga0207664_100303693 | 331 |
| 497 | 3300025931 | Ga0207644_10021755 | Ga0207644_100217553 | 331 |
| 498 | 3300025932 | Ga0207690_10020389 | Ga0207690_100203894 | 331 |
| 499 | 3300025949 | Ga0207667_10044156 | Ga0207667_100441565 | 331 |
| 500 | 3300026035 | Ga0207703_10197546 | Ga0207703_101975462 | 331 |
| 501 | 3300026078 | Ga0207702_10100318 | Ga0207702_101003183 | 331 |
| 502 | 3300026078 | Ga0207702_10156663 | Ga0207702_101566632 | 331 |
| 503 | 3300026116 | Ga0207674_10216035 | Ga0207674_102160352 | 331 |
| 504 | 3300026142 | Ga0207698_10094713 | Ga0207698_100947132 | 331 |
| 505 | 3300028379 | Ga0268266_10101673 | Ga0268266_101016732 | 331 |
| 506 | 3300028379 | Ga0268266_10308046 | Ga0268266_103080462 | 331 |
| 507 | 3300028786 | Ga0307517_10141210 | Ga0307517_101412103 | 331 |
| 508 | 3300030521 | Ga0307511_10000238 | Ga0307511_1000023853 | 331 |
| 509 | 3300031507 | Ga0307509_10044423 | Ga0307509_100444232 | 331 |
| 510 | 3300031507 | Ga0307509_10109537 | Ga0307509_101095372 | 331 |
| 511 | 3300031838 | Ga0307518_10017622 | Ga0307518_100176221 | 331 |
| 512 | 3300031838 | Ga0307518_10056347 | Ga0307518_100563472 | 331 |
| 513 | 3300033179 | Ga0307507_10000008 | Ga0307507_10000008167 | 331 |
| 514 | 3300033179 | Ga0307507_10053330 | Ga0307507_100533301 | 331 |
| 515 | 3300033180 | Ga0307510_10085969 | Ga0307510_100859693 | 331 |
| 516 | 3300033180 | Ga0307510_10248956 | Ga0307510_102489562 | 331 |
| 517 | 3300035410 | Ga0373924_0005353 | Ga0373924_0005353_1488_2489 | 331 |
| 518 | 3300036401 | Ga0373937_0023231 | Ga0373937_0023231_1575_2576 | 331 |
| 519 | 3300046454 | Ga0495592_0017133 | Ga0495592_0017133_211_1212 | 331 |
| 520 | 3300046455 | Ga0495603_0014154 | Ga0495603_0014154_2311_3312 | 331 |
| 521 | 3300046460 | Ga0495638_0105316 | Ga0495638_0105316_565_1566 | 331 |
| 522 | 3300046462 | Ga0495651_0015837 | Ga0495651_0015837_3365_4366 | 331 |
| 523 | 3300046463 | Ga0495653_0010123 | Ga0495653_0010123_222_1223 | 331 |
| 524 | 3300046477 | Ga0495664_0002297 | Ga0495664_0002297_979_1980 | 331 |
| 525 | 3300046506 | Ga0495583_0029841 | Ga0495583_0029841_999_2000 | 331 |
| 526 | 3300046511 | Ga0495608_0021626 | Ga0495608_0021626_3239_4240 | 331 |
| 527 | 3300046516 | Ga0495628_0034116 | Ga0495628_0034116_200_1201 | 331 |
| 528 | 3300046517 | Ga0495630_0052374 | Ga0495630_0052374_1833_2834 | 331 |
| 529 | 3300046529 | Ga0495652_0039169 | Ga0495652_0039169_1630_2631 | 331 |
| 530 | 3300046533 | Ga0495640_0008530 | Ga0495640_0008530_4350_5351 | 331 |
| 531 | 3300046536 | Ga0495587_0001614 | Ga0495587_0001614_12532_13533 | 331 |
| 532 | 3300046543 | Ga0495645_0024742 | Ga0495645_0024742_3041_4042 | 331 |
| 533 | 3300046543 | Ga0495645_0027710 | Ga0495645_0027710_2893_3894 | 331 |
| 534 | 3300046559 | Ga0495667_0023204 | Ga0495667_0023204_222_1223 | 331 |
| 535 | 3300046663 | Ga0495635_0009154 | Ga0495635_0009154_3752_4753 | 331 |
| 536 | 3300046675 | Ga0495657_0050923 | Ga0495657_0050923_1575_2576 | 331 |
| 537 | 3300046678 | Ga0495599_0001737 | Ga0495599_0001737_1592_2593 | 331 |
| 538 | 3300046679 | Ga0495623_0025060 | Ga0495623_0025060_236_1237 | 331 |
| 539 | 3300046680 | Ga0495646_0019197 | Ga0495646_0019197_3112_4113 | 331 |
| 540 | 3300047317 | Ga0495604_0018550 | Ga0495604_0018550_2842_3843 | 331 |
| 541 | 3300047319 | Ga0495674_0041784 | Ga0495674_0041784_220_1221 | 331 |
| 542 | 3300047322 | Ga0495680_0031036 | Ga0495680_0031036_222_1223 | 331 |
| 543 | 3300047444 | Ga0495675_0008564 | Ga0495675_0008564_4176_5177 | 331 |
| 544 | 3300047471 | Ga0495684_0036590 | Ga0495684_0036590_194_1195 | 331 |
| 545 | 3300048088 | Ga0495602_0015865 | Ga0495602_0015865_206_1207 | 331 |
| 546 | 3300048907 | Ga0496104_0003780 | Ga0496104_0003780_7089_8090 | 331 |
| 547 | 3300048907 | Ga0496104_0006354 | Ga0496104_0006354_3236_4237 | 331 |
| 548 | 3300048908 | Ga0496105_0010073 | Ga0496105_0010073_877_1878 | 331 |
| 549 | 3300048913 | Ga0496110_0015154 | Ga0496110_0015154_2058_3059 | 331 |
| 550 | 3300048914 | Ga0496111_0100269 | Ga0496111_0100269_480_1481 | 331 |
| 551 | 3300048915 | Ga0496112_0410236 | Ga0496112_0410236_158_1171 | 331 |
| 552 | 3300049581 | Ga0501047_0150550 | Ga0501047_0150550_420_1421 | 331 |
| 553 | 3300053084 | Ga0495595_0003631 | Ga0495595_0003631_1571_2572 | 331 |
| 554 | 3300053085 | Ga0495619_0029192 | Ga0495619_0029192_393_1394 | 331 |
| 555 | 3300053088 | Ga0500644_0003115 | Ga0500644_0003115_1645_2646 | 331 |
| 556 | 3300053107 | Ga0500560_057400 | Ga0500560_057400_157_1158 | 331 |
| 557 | 3300030735 | Ga0316178_1058387 | Ga0316178_10583872 | 334 |
| 558 | 3300030745 | Ga0316182_1430484 | Ga0316182_14304842 | 334 |
| 559 | 3300005436 | Ga0070713_100206272 | Ga0070713_1002062721 | 335 |
| 560 | 3300005471 | Ga0070698_100198624 | Ga0070698_1001986241 | 335 |
| 561 | 3300028794 | Ga0307515_10000054 | Ga0307515_1000005494 | 335 |
| 562 | 3300030521 | Ga0307511_10133628 | Ga0307511_101336282 | 335 |
| 563 | 3300033179 | Ga0307507_10032691 | Ga0307507_100326913 | 335 |
| 564 | 3300033180 | Ga0307510_10048199 | Ga0307510_100481992 | 335 |
| 565 | 3300046459 | Ga0495629_0128739 | Ga0495629_0128739_362_1450 | 335 |
| 566 | 3300046660 | Ga0495625_0043674 | Ga0495625_0043674_1734_2780 | 335 |
| 567 | 3300046692 | Ga0495671_0010375 | Ga0495671_0010375_3414_4460 | 335 |
| 568 | 3300047470 | Ga0495681_0003038 | Ga0495681_0003038_4734_5780 | 335 |
| 569 | 3300053107 | Ga0500560_005526 | Ga0500560_005526_718_1764 | 335 |
| 570 | iso_pu_bacteria | 2990059506 | 2990064035 | 335 |
| 571 | iso_pu_bacteria | 2643221647 | 2644269081 | 336 |
| 572 | iso_pu_bacteria | 2751185782 | 2753267016 | 336 |
| 573 | iso_pu_bacteria | 2784746768 | 2785365640 | 336 |
| 574 | iso_pu_bacteria | 2862382967 | 2862387964 | 336 |
| 575 | iso_pu_bacteria | 2954701450 | 2954704123 | 336 |
| 576 | iso_pu_bacteria | 8008558824 | 8008560020 | 336 |
| 577 | 3300025908 | Ga0207643_10018843 | Ga0207643_100188433 | 337 |
| 578 | 3300046475 | Ga0495639_0067458 | Ga0495639_0067458_371_1420 | 339 |
| 579 | 3300046476 | Ga0495662_0004049 | Ga0495662_0004049_5440_6549 | 339 |
| 580 | 3300046477 | Ga0495664_0009794 | Ga0495664_0009794_3694_4803 | 339 |
| 581 | 3300046514 | Ga0495618_0049259 | Ga0495618_0049259_961_2070 | 339 |
| 582 | 3300046536 | Ga0495587_0003615 | Ga0495587_0003615_5246_6355 | 339 |
| 583 | 3300046642 | Ga0495634_0005177 | Ga0495634_0005177_3397_4506 | 339 |
| 584 | 3300046663 | Ga0495635_0005814 | Ga0495635_0005814_3867_4976 | 339 |
| 585 | 3300046675 | Ga0495657_0014840 | Ga0495657_0014840_4008_5117 | 339 |
| 586 | 3300046689 | Ga0495613_0028743 | Ga0495613_0028743_2966_4075 | 339 |
| 587 | 3300047315 | Ga0495581_0017169 | Ga0495581_0017169_3030_4139 | 339 |
| 588 | 3300047317 | Ga0495604_0001927 | Ga0495604_0001927_15266_16375 | 339 |
| 589 | 3300047321 | Ga0495676_0031236 | Ga0495676_0031236_2828_3937 | 339 |
| 590 | 3300047673 | Ga0495593_0011852 | Ga0495593_0011852_759_1868 | 339 |
| 591 | 3300001990 | JGI24737J22298_10049646 | JGI24737J22298_100496462 | 340 |
| 592 | 3300003316 | rootH1_10053053 | rootH1_100530532 | 340 |
| 593 | 3300003323 | rootH1_10041438 | rootH1_100414382 | 340 |
| 594 | 3300005347 | Ga0070668_100013949 | Ga0070668_1000139492 | 340 |
| 595 | 3300005347 | Ga0070668_100045665 | Ga0070668_1000456652 | 340 |
| 596 | 3300005843 | Ga0068860_100207870 | Ga0068860_1002078702 | 340 |
| 597 | 3300015688 | Ga0183367_1001 | Ga0183367_1001520 | 340 |
| 598 | 3300025904 | Ga0207647_10030328 | Ga0207647_100303282 | 340 |
| 599 | 3300025972 | Ga0207668_10037346 | Ga0207668_100373463 | 340 |
| 600 | 3300026035 | Ga0207703_10074891 | Ga0207703_100748911 | 340 |
| 601 | 3300026088 | Ga0207641_10069736 | Ga0207641_100697362 | 340 |
| 602 | 3300028380 | Ga0268265_10301100 | Ga0268265_103011002 | 340 |
| 603 | 3300031730 | Ga0307516_10001002 | Ga0307516_1000100230 | 340 |
| 604 | 3300032002 | Ga0307416_100071809 | Ga0307416_1000718092 | 340 |
| 605 | 3300032005 | Ga0307411_10003015 | Ga0307411_100030159 | 340 |
| 606 | 3300041492 | Ga0451835_0730700 | Ga0451835_0730700_130_1209 | 340 |
| 607 | 3300041512 | Ga0451853_3283600 | Ga0451853_3283600_363_1385 | 340 |
| 608 | 3300046476 | Ga0495662_0013950 | Ga0495662_0013950_463_1485 | 340 |
| 609 | 3300046477 | Ga0495664_0039666 | Ga0495664_0039666_1487_2509 | 340 |
| 610 | 3300046642 | Ga0495634_0055408 | Ga0495634_0055408_160_1182 | 340 |
| 611 | 3300047321 | Ga0495676_0006705 | Ga0495676_0006705_123_1145 | 340 |
| 612 | 3300047673 | Ga0495593_0007930 | Ga0495593_0007930_1251_2273 | 340 |
| 613 | 3300048089 | Ga0495614_0008334 | Ga0495614_0008334_1060_2082 | 340 |
| 614 | iso_pu_bacteria | 2582581312 | 2585297230 | 340 |
| 615 | iso_pu_bacteria | 2643221617 | 2644100866 | 340 |
| 616 | iso_pu_bacteria | 2643221620 | 2644117275 | 340 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3fbg-assembly1.cif.gz_A | crystal structure of a putative arginate lyase from staphylococcus haemolyticus | 0.8606 | 15 | 338 |
| 3fbg-assembly1.cif.gz_B | crystal structure of a putative arginate lyase from staphylococcus haemolyticus | 0.848 | 16 | 338 |
| 3gaz-assembly1.cif.gz_B | crystal structure of an alcohol dehydrogenase superfamily protein from novosphingobium aromaticivorans | 0.8478 | 14 | 339 |
| 4dvj-assembly1.cif.gz_B | crystal structure of a putative zinc-dependent alcohol dehydrogenase protein from rhizobium etli cfn 42 | 0.8454 | 12 | 337 |
| 3jyl-assembly1.cif.gz_A | crystal structures of pseudomonas syringae pv. tomato dc3000 quinone oxidoreductase | 0.8452 | 15 | 337 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P96826_1_126_3.90.180.10 | Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain | 0.9434 | 15 | 133 | 3.90.180.10 |
| 4a27B01 | Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain | 0.9246 | 13 | 138 | 3.90.180.10 |
| af_Q3UNZ8_26_154_3.90.180.10 | Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain | 0.923 | 15 | 140 | 3.90.180.10 |
| af_P47199_9_127_3.90.180.10 | Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain | 0.921 | 16 | 133 | 3.90.180.10 |
| 1yb5B01 | Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain | 0.9186 | 13 | 138 | 3.90.180.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4V2NFX9-F1-model_v4 | Alcohol dehydrogenase-like C-terminal domain-containing protein | 0.9698 | 142 | 253 |
GO:0016491
|
| AF-A0A428U2E7-F1-model_v4 | Enoyl reductase (ER) domain-containing protein | 0.9242 | 15 | 337 |
GO:0016491
|
| AF-A0A382SV47-F1-model_v4 | Alcohol dehydrogenase-like N-terminal domain-containing protein | 0.9191 | 12 | 147 |
GO:0016651
GO:0070402 |
| AF-G4WVN3-F1-model_v4 | Putative medium chain dehydrogenases/reductase | 0.9166 | 15 | 133 |
|
| AF-A0A178CSZ7-F1-model_v4 | deleted | 0.9104 | 12 | 253 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar